Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30018413
Length (bp)1211
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30018413) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30018413) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018413

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal region of the whole animalSMED30018413SMESG000025656.1 SmedASXL_007522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30018413SMESG000025656.1 SmedASXL_007522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30018413SMESG000025656.1 SmedASXL_007522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
prepharyngeal regionSMED30018413SMESG000025656.1 SmedASXL_007522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30018413SMESG000025656.1 SmedASXL_007522SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30018413SMESG000025656.1 Smed-Hox3bsmed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30018413SMESG000025656.1 SMED30018413smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30018413SMESG000025656.1 dd_Smed_v6_25769_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30018413SMESG000025656.1 dd_Smed_v6_25769_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30018413SMESG000025656.1 SMESG000001565.1 OX_Smed_1.0.10985ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: PDX1 (pancreatic and duodenal homeobox 1 [Source:HGNC Symbol;Acc:HGNC:6107])

HSP 1 Score: 78.1814 bits (191), Expect = 1.292e-15
Identity = 34/63 (53.97%), Postives = 48/63 (76.19%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQK 717
            KR RT ++++QLLELEKEF+   Y+ R  R+ LA  LNL E+ IK+WFQNRRMK K++E +++
Sbjct:  147 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKR 209          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXB3 (homeobox B3 [Source:HGNC Symbol;Acc:HGNC:5114])

HSP 1 Score: 78.1814 bits (191), Expect = 1.404e-15
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSS 756
            KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P  S
Sbjct:   57 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGS 132          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: GSX2 (GS homeobox 2 [Source:HGNC Symbol;Acc:HGNC:24959])

HSP 1 Score: 78.1814 bits (191), Expect = 1.544e-15
Identity = 39/73 (53.42%), Postives = 49/73 (67.12%), Query Frame = 1
Query:  502 SDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKR 720
            SDAS     KR RT F+ +QLLELE+EF    YL R  RI +A  LNL EKQ+K+WFQNRR+K K++    +R
Sbjct:  194 SDASQVPNGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGTQR 266          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 79.337 bits (194), Expect = 1.547e-15
Identity = 41/98 (41.84%), Postives = 57/98 (58.16%), Query Frame = 1
Query:  472 SKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTI 765
             +SCE+      + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P+ S  +
Sbjct:  181 GESCED-----KSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPERSPPL 273          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HOXD3 (homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137])

HSP 1 Score: 79.337 bits (194), Expect = 1.547e-15
Identity = 41/98 (41.84%), Postives = 57/98 (58.16%), Query Frame = 1
Query:  472 SKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTI 765
             +SCE+      + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P+ S  +
Sbjct:  181 GESCED-----KSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPASQSPERSPPL 273          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-9 (Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Prot;Acc:P56407])

HSP 1 Score: 73.9442 bits (180), Expect = 1.100e-15
Identity = 41/94 (43.62%), Postives = 60/94 (63.83%), Query Frame = 1
Query:  460 KSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDN 741
            KS   ++ E PIE+   +    RK+ RTTFS  Q+ ELEK+F    YL  ++R  LA +L++ E Q+K+WFQNRR K K+ ESE++R   + D+
Sbjct:   51 KSSLDQAKESPIEKCQKTK---RKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIESEKERSGEIPDD 141          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-12 (Homeobox protein ceh-12 [Source:UniProtKB/Swiss-Prot;Acc:P17487])

HSP 1 Score: 71.633 bits (174), Expect = 1.158e-15
Identity = 34/57 (59.65%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKR 699
            +RPRT FS  QL++LEK+F    YL R  R  LA +L+L E QIK+WFQNRRMK KR
Sbjct:    2 RRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRMKNKR 58          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-12 (Homeobox protein ceh-12 [Source:UniProtKB/Swiss-Prot;Acc:P17487])

HSP 1 Score: 73.559 bits (179), Expect = 3.114e-15
Identity = 34/57 (59.65%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKR 699
            +RPRT FS  QL++LEK+F    YL R  R  LA +L+L E QIK+WFQNRRMK KR
Sbjct:  111 RRPRTAFSSEQLVQLEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRMKNKR 167          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 73.1738 bits (178), Expect = 2.258e-14
Identity = 36/74 (48.65%), Postives = 52/74 (70.27%), Query Frame = 1
Query:  508 ASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            +S H MRK+ R  ++++Q LELEKEF++  Y+ +  R  LA  L+L E+Q+K+WFQNRRMK K+    QK+R S
Sbjct:  194 SSSHAMRKK-RKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKK----QKQRTS 262          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 73.1738 bits (178), Expect = 2.258e-14
Identity = 36/74 (48.65%), Postives = 52/74 (70.27%), Query Frame = 1
Query:  508 ASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            +S H MRK+ R  ++++Q LELEKEF++  Y+ +  R  LA  L+L E+Q+K+WFQNRRMK K+    QK+R S
Sbjct:  194 SSSHAMRKK-RKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKK----QKQRTS 262          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: ind (gene:FBgn0025776 transcript:FBtr0333875)

HSP 1 Score: 84.7297 bits (208), Expect = 6.033e-18
Identity = 37/61 (60.66%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESE 711
            KR RT F+ +QLLELE+EF H AYL R  RI +A +L L EKQ+K+WFQNRR+K+K+  SE
Sbjct:  228 KRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQKKGGSE 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: zen (gene:FBgn0004053 transcript:FBtr0081670)

HSP 1 Score: 80.8777 bits (198), Expect = 1.424e-16
Identity = 60/166 (36.14%), Postives = 82/166 (49.40%), Query Frame = 1
Query:  235 QSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEE-PIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            Q+ VG  S D S+   Y D  Y  G+H    ++N I  P  +N  ++  TT               ND C P+        S E  P + +  S  +  KR RT F+  QL+ELE EF    YL R  RI +A +L+L E+Q+K+WFQNRRMK K+D    +  KS
Sbjct:   12 QAKVGSYSADPSEVK-YSDLIY--GHHH---DVNPIGLPPNYNQMNSNPTT--------------LNDHCSPQHVHQQHVSSDENLPSQPNHDSQRVKLKRSRTAFTSVQLVELENEFKSNMYLYRTRRIEIAQRLSLCERQVKIWFQNRRMKFKKDIQGHREPKS 157          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: exex (gene:FBgn0041156 transcript:FBtr0076751)

HSP 1 Score: 78.5666 bits (192), Expect = 1.659e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRK 726
            +RPRT F+  QLLELEK+F    YL R  R  +A  L L E Q+K+WFQNRRMK KR +  Q+  K
Sbjct:  440 RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQEAK 505          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: zen2 (gene:FBgn0004054 transcript:FBtr0081671)

HSP 1 Score: 75.8702 bits (185), Expect = 2.274e-15
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNK 780
            KR RT FS  QL+ELE+EF    YL R  RI ++ +L L E+Q+K+WFQNRRMK K+  + +    +L  ++P SS +  D  K
Sbjct:   44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQK 127          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: zen2 (gene:FBgn0004054 transcript:FBtr0290296)

HSP 1 Score: 75.485 bits (184), Expect = 2.653e-15
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNK 780
            KR RT FS  QL+ELE+EF    YL R  RI ++ +L L E+Q+K+WFQNRRMK K+  + +    +L  ++P SS +  D  K
Sbjct:   24 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQK 107          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxc3a (homeobox C3a [Source:NCBI gene;Acc:30421])

HSP 1 Score: 82.4185 bits (202), Expect = 1.592e-17
Identity = 59/162 (36.42%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  301 ENGNHFSDINLNYISDPYRFNYD---STEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEP--------IERSDA----SPHIMR----KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            + GN ++  NL+ +  PY F+ D   S +     E+E     K    + SCL    K  W +    P        +E  D+       ++R    KR R  F+ SQLLELEKEF  +AYL R  R+ +A  L L ++QIK+WFQNRRMK K+D  E+   KS
Sbjct:   57 DKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALERE-----KACELSTSCL-STMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKS 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxc3a (homeobox C3a [Source:NCBI gene;Acc:30421])

HSP 1 Score: 82.4185 bits (202), Expect = 1.592e-17
Identity = 59/162 (36.42%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  301 ENGNHFSDINLNYISDPYRFNYD---STEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEP--------IERSDA----SPHIMR----KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            + GN ++  NL+ +  PY F+ D   S +     E+E     K    + SCL    K  W +    P        +E  D+       ++R    KR R  F+ SQLLELEKEF  +AYL R  R+ +A  L L ++QIK+WFQNRRMK K+D  E+   KS
Sbjct:   57 DKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALERE-----KACELSTSCL-STMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKS 212          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 83.1889 bits (204), Expect = 1.981e-17
Identity = 44/101 (43.56%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  445 LPEETKSDWSKSCEEPIERSDASPHIMRKRP---RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLND 738
            +P     DW K    P +   A  +    +P   RT FS  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E    KSL++
Sbjct:  160 VPTGQTFDWMKVKRNPPKTGKAGEYGFGGQPNTVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPKSLSE 260          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 83.5741 bits (205), Expect = 2.025e-17
Identity = 44/101 (43.56%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  445 LPEETKSDWSKSCEEPIERSDASPHIMRKRP---RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLND 738
            +P     DW K    P +   A  +    +P   RT FS  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E    KSL++
Sbjct:  195 VPTGQTFDWMKVKRNPPKTGKAGEYGFGGQPNTVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPKSLSE 295          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: hoxc3a (homeobox C3a [Source:NCBI gene;Acc:30421])

HSP 1 Score: 81.2629 bits (199), Expect = 4.385e-17
Identity = 59/162 (36.42%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  301 ENGNHFSDINLNYISDPYRFNYD---STEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEP--------IERSDA----SPHIMR----KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            + GN ++  NL+ +  PY F+ D   S +     E+E     K    + SCL    K  W +    P        +E  D+       ++R    KR R  F+ SQLLELEKEF  +AYL R  R+ +A  L L ++QIK+WFQNRRMK K+D  E+   KS
Sbjct:   70 DKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALERE-----KACELSTSCLST-MKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKS 225          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: castor2 (cytosolic arginine sensor for mTORC1 subunit 2 [Source:Xenbase;Acc:XB-GENE-949506])

HSP 1 Score: 84.7297 bits (208), Expect = 2.410e-17
Identity = 50/114 (43.86%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  481 CEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKF----HLPFQNSMS 810
            CEE   +S   P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     PD S T+   N       LP  NS+S
Sbjct:  170 CEE---KSPTGPS--SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGIMHSPAGQSPDRSPTLSGSNHVGYSSQLPTVNSLS 278          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: hnf4b (hepatocyte nuclear factor 4, beta [Source:Xenbase;Acc:XB-GENE-485826])

HSP 1 Score: 82.0333 bits (201), Expect = 5.125e-17
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS--LNDNLPDSSNTIVDHNKFHLPFQNS--MSRSSNQCSESATGNIP 855
            KR RT ++++QLLELEKEF+   Y+ R  R+ LA  LNL E+ IK+WFQNRRMK K++E +++ R S    D++  S++ I D  +     QN+  + RSS   +   +  IP
Sbjct:  148 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGRGSDPEQDSVVSSADVIKDEPQCLGNSQNTGDLVRSSALPTSPQSNPIP 260          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: hoxa1 (homeobox A1 [Source:NCBI gene;Acc:493379])

HSP 1 Score: 79.7221 bits (195), Expect = 4.818e-16
Identity = 39/85 (45.88%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  466 DWSKSCEEPIERSDASPHIMRKRP---RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESE 711
            DW K    P +   A  +    +P   RT F+  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E
Sbjct:  194 DWMKVKRNPPKTGKAGEYGFAGQPNTARTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKE 278          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: klf7 (Kruppel-like factor 7 (ubiquitous) [Source:Xenbase;Acc:XB-GENE-1012735])

HSP 1 Score: 77.7962 bits (190), Expect = 7.989e-16
Identity = 36/67 (53.73%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            KR RT F+ +QLLELE+EF    YL R  RI +A  LNL EKQ+K+WFQNRR+K K++      R S
Sbjct:  138 KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSSTHRAS 204          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: hoxd8 (homeobox D8 [Source:NCBI gene;Acc:100216142])

HSP 1 Score: 77.0258 bits (188), Expect = 1.455e-15
Identity = 58/175 (33.14%), Postives = 83/175 (47.43%), Query Frame = 1
Query:  232 LQSGVGINSYDSSKTGGYHDYFYENGN------HFSDINLNYISDPYR-FNYDSTEA----TTTFEKESSQLE--KFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQK 717
            + SG     Y  S +G   DY++  G         +   +    DP + + YD  +     TT  E E  Q    K    +    PE    +   S   P  R+  +P   R+R R T+S+ Q LELEKEF+   YL R  RI ++  L L E+Q+K+WFQNRRMK K++ S+ K
Sbjct:   30 VGSGRAPLVYSGSGSGAPQDYYHHPGTLPSPGYQPAPCGITCHGDPAKLYGYDHFQRQHIFTTHQEAEPVQYPDCKSPSASIGADPEHLHQNSPASHMFPWMRAQVAP--GRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENSKDK 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Pdx1 (pancreatic and duodenal homeobox 1 [Source:MGI Symbol;Acc:MGI:102851])

HSP 1 Score: 78.5666 bits (192), Expect = 6.504e-16
Identity = 34/63 (53.97%), Postives = 48/63 (76.19%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQK 717
            KR RT ++++QLLELEKEF+   Y+ R  R+ LA  LNL E+ IK+WFQNRRMK K++E +++
Sbjct:  148 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKR 210          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxb3 (homeobox B3 [Source:MGI Symbol;Acc:MGI:96184])

HSP 1 Score: 79.337 bits (194), Expect = 1.137e-15
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSS 756
            KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P  S
Sbjct:  192 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGS 267          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxb3 (homeobox B3 [Source:MGI Symbol;Acc:MGI:96184])

HSP 1 Score: 79.337 bits (194), Expect = 1.137e-15
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSS 756
            KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P  S
Sbjct:  192 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGS 267          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxd3 (homeobox D3 [Source:MGI Symbol;Acc:MGI:96207])

HSP 1 Score: 73.559 bits (179), Expect = 1.307e-15
Identity = 38/83 (45.78%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  466 DWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQ 714
            D  ++CE+      + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +
Sbjct:   20 DGGENCED-----KSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAK 97          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hoxa3 (homeobox A3 [Source:MGI Symbol;Acc:MGI:96175])

HSP 1 Score: 78.9518 bits (193), Expect = 1.673e-15
Identity = 37/76 (48.68%), Postives = 48/76 (63.16%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSS 756
            KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     P  S
Sbjct:  193 KRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKGKGMLTSSGGQSPSRS 268          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q98SI1|HXA1A_DANRE (Homeobox protein Hox-A1a OS=Danio rerio OX=7955 GN=hoxa1a PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.528e-16
Identity = 44/101 (43.56%), Postives = 56/101 (55.45%), Query Frame = 1
Query:  445 LPEETKSDWSKSCEEPIERSDASPHIMRKRP---RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLND 738
            +P     DW K    P +   A  +    +P   RT FS  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E    KSL++
Sbjct:  195 VPTGQTFDWMKVKRNPPKTGKAGEYGFGGQPNTVRTNFSTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPKSLSE 295          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P28174|HXC3A_DANRE (Homeobox protein Hox-C3a OS=Danio rerio OX=7955 GN=hoxc3a PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.266e-16
Identity = 58/162 (35.80%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  301 ENGNHFSDINLNYISDPYRFNYD---STEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEP--------IERSDA----SPHIMR----KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            + GN ++  NL+ +  PY F+ D   S +     E++     K    + SCL    K  W +    P        +E  D+       ++R    KR R  F+ SQLLELEKEF  +AYL R  R+ +A  L L ++QIK+WFQNRRMK K+D  E+   KS
Sbjct:   57 DKGNVWNFQNLSNVQHPYSFSDDGNHSLDPANALERK-----KACELSTSCL-STMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEKSTAKS 212          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|A1L2P5|HXD3_XENLA (Homeobox protein Hox-D3 OS=Xenopus laevis OX=8355 GN=hoxd3 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.037e-16
Identity = 49/114 (42.98%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  481 CEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKF----HLPFQNSMS 810
            CEE   +S   P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S     PD S  +   N       LP  NS+S
Sbjct:  168 CEE---KSPTGPS--SKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGIMHSPTGQSPDRSPPLSGPNLVGYSSQLPTVNSLS 276          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O42370|HXD3A_DANRE (Homeobox protein Hox-D3a OS=Danio rerio OX=7955 GN=hoxd3a PE=2 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.246e-16
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  472 SKSCEEPIERSD--ASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKF----HLPFQNSMS 810
            S +C    E  D  + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S   + PD S  +   N       LP  NS+S
Sbjct:  141 STNCPAAGETCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGSNHIGYSGQLPNVNSLS 259          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P14837|PDX1_XENLA (Pancreas/duodenum homeobox protein 1 OS=Xenopus laevis OX=8355 GN=pdx1 PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 7.582e-16
Identity = 39/84 (46.43%), Postives = 58/84 (69.05%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS--LNDNLPDSSNTIVDH 774
            KR RT ++++QLLELEKEF+   Y+ R  R+ LA  LNL E+ IK+WFQNRRMK K++E +++ R S    D++  S++ + D 
Sbjct:  148 KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGRGSDPEQDSVVSSADVLKDE 231          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1S6KMJ5 (Homeobox domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 312/312 (100.00%), Postives = 312/312 (100.00%), Query Frame = 1
Query:  205 MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSHFHYCSEFPYDEL 1140
            MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSHFHYCSEFPYDEL
Sbjct:    1 MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSHFHYCSEFPYDEL 312          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: F1CDE7 (XLOX OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 287/312 (91.99%), Postives = 294/312 (94.23%), Query Frame = 1
Query:  205 MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSHFHYCSEFPYDEL 1140
            MESN+FHHLL SGVGIN YDSSK GGYH  FYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKF YFNDSCLPEETKSDWSKSCEE IER D SPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEK+IKVWFQNRRM+RKRDESEQKRRKSL DNLPDSSNT VDHNKFHLPFQNSMSRSSN CSESATGNIPWNL++GFPSYNFDSSC RSPLAKNDCL +SGFNFESFINHYN LYDFPSTIESQYPYNVDNP FISYD SFP+NLPNCNQSSHFHYCSE PYDEL
Sbjct:    1 MESNQFHHLLHSGVGINPYDSSKPGGYHASFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFTYFNDSCLPEETKSDWSKSCEELIERPDTSPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKRIKVWFQNRRMRRKRDESEQKRRKSLTDNLPDSSNTNVDHNKFHLPFQNSMSRSSNNCSESATGNIPWNLEDGFPSYNFDSSCRRSPLAKNDCLSNSGFNFESFINHYNHLYDFPSTIESQYPYNVDNPPFISYDPSFPSNLPNCNQSSHFHYCSELPYDEL 312          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A3B3UCG8 (Homeobox domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.102e-16
Identity = 57/151 (37.75%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  325 INLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRK---RDESEQKRRKSLNDNLPDSSNTIV 768
            + ++   D   FN +++E T T  K+S  +  +A F   C         +  C E +  S A  + +   PRT+FS  QL ELEKEF    YL RA R+ +AG L L E Q+KVWFQNRRMK+K   RD      R  L D + D+   I+
Sbjct:   47 LQISSTDDTLMFNPETSEDTKTKTKKSGGICHYAAFERIC-------KLAGLCVEEVG-SPADRNAVNGAPRTSFSTRQLTELEKEFHFNKYLTRARRVEVAGTLRLSETQVKVWFQNRRMKQKKLRRDGLTSDARLPLRDGVSDTVIIIL 189          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: W5N9X0 (Homeobox domain-containing protein OS=Lepisosteus oculatus OX=7918 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.324e-16
Identity = 41/85 (48.24%), Postives = 57/85 (67.06%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRR------KSLNDNLPDSSNTI 765
            KR RT +S++QL+ELEKEF ++ Y+ RA R+ LA  L L E+ +K+WFQNRRMKRKR+E+++ R       K  ND  P   N +
Sbjct:  127 KRTRTAYSRAQLVELEKEFHYSKYISRARRVELAAALGLTERHVKIWFQNRRMKRKREEAQRHRGSSSDPLKKRNDEDPGHENVL 211          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A0L7LK52 (Hox protein zen OS=Operophtera brumata OX=104452 GN=OBRU01_06973 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.584e-16
Identity = 52/114 (45.61%), Postives = 65/114 (57.02%), Query Frame = 1
Query:  463 SDWSKSCEEPIERSDASPHIMRK----RPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSN--TIVDHNKFH 786
            SD   + E PI+   + P+  +K    R RT ++ SQL+ELE EF    YL R  RI LA  L L E+QIK+WFQNRRMK K+D    K   S++DN P SS    I DH   H
Sbjct:  218 SDKRTASELPIDDMPSEPYTYQKGFTKRARTAYTSSQLVELENEFHQNRYLCRPRRIELATYLQLSERQIKIWFQNRRMKYKKDNKHNKPSSSVDDNSPSSSKDLPIQDHKMSH 331          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:103034417])

HSP 1 Score: 83.5741 bits (205), Expect = 3.149e-17
Identity = 48/116 (41.38%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  481 CEEPIERSD--ASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKF----HLPFQNSMS 810
            C  P +  D  + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S   + PD S  +   N       LP  NS+S
Sbjct:  142 CTAPGDTCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGPNHVGYSGQLPNVNSLS 257          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:103034417])

HSP 1 Score: 83.5741 bits (205), Expect = 3.149e-17
Identity = 48/116 (41.38%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  481 CEEPIERSD--ASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKF----HLPFQNSMS 810
            C  P +  D  + P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S   + PD S  +   N       LP  NS+S
Sbjct:  142 CTAPGDTCDDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKSKGIMHSPLGHSPDRSPPLSGPNHVGYSGQLPNVNSLS 257          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045941.1 (pancreas/duodenum homeobox protein 1-like [Source:NCBI gene;Acc:103022002])

HSP 1 Score: 79.7221 bits (195), Expect = 5.971e-17
Identity = 44/104 (42.31%), Postives = 66/104 (63.46%), Query Frame = 1
Query:  472 SKSCEEPIER---SDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQ---KRRKSLNDNLPDSSNTI 765
            +++C+ P+      D+  H   KR RT +S++QLLELEKEF+   Y+ R  R  LA  LNL E+ IK+WFQNRRMK K++E+++   K  K   ++  DS++T 
Sbjct:  117 TQACQAPVTGYFCEDSEEH---KRSRTAYSRAQLLELEKEFLFNRYISRPRRYELATSLNLTERHIKIWFQNRRMKWKKEEAKKRGSKESKECKEHHVDSTSTT 217          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: gsx2 (GS homeobox 2 [Source:NCBI gene;Acc:103043972])

HSP 1 Score: 80.4925 bits (197), Expect = 7.147e-17
Identity = 39/73 (53.42%), Postives = 50/73 (68.49%), Query Frame = 1
Query:  502 SDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKR 720
            SD+SP    KR RT F+ +QLLELE+EF    YL R  RI +A  LNL EKQ+K+WFQNRR+K K++    +R
Sbjct:  144 SDSSPVQGGKRMRTAFTSTQLLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGAQR 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: hoxa1a (homeobox A1a [Source:NCBI gene;Acc:58051])

HSP 1 Score: 80.8777 bits (198), Expect = 1.524e-16
Identity = 52/153 (33.99%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  313 HFSDINLNYISDPYRFNYDSTEATTTFEKE-SSQLEKFAYFNDSC-------LPEETKSDWSKSCEEPIERSDASPHIMRKRP---RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLND 738
            H     L Y +  Y    D  +A  TF    S+ L      +D+C       L      DW K    P +      +    +P   RT F+  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E    K++++
Sbjct:  156 HLHHGQLQYAAAAYGHGQD--QANLTFVGGCSNHLSPLHGHHDTCCSPLSDGLSTAQTFDWMKVKRNPPKTGKVGEYGYGGQPNTVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGLMPKTVSE 306          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 2.170e-17
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRK 726
            +RPRT FS  QLLELE+ F    YL R  R  +A  L L E Q+K+WFQNRRMK KR +  Q + K
Sbjct:    4 RRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKRGKGGQLQEK 69          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000986.1 (pep scaffold:Pmarinus_7.0:GL477479:36520:39429:-1 gene:ENSPMAG00000000894.1 transcript:ENSPMAT00000000986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.191e-16
Identity = 34/60 (56.67%), Postives = 44/60 (73.33%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDES 708
            KR RT FS  QLL LE+EF  + YL R  RI +A +L L EKQ+K+WFQNRR+K+K+ E+
Sbjct:    3 KRARTAFSSGQLLALEREFSASRYLSRLRRIHVAARLRLSEKQVKIWFQNRRVKQKKSET 62          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007188.1 (pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1 gene:ENSPMAG00000006495.1 transcript:ENSPMAT00000007188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 1.668e-15
Identity = 35/65 (53.85%), Postives = 43/65 (66.15%), Query Frame = 1
Query:  538 RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSL 732
            RT FS  QL ELEKEF    YL RA R+ +A  L L E Q+K+WFQNRRMK+K+ E E    ++L
Sbjct:  301 RTNFSTKQLTELEKEFHFNKYLTRARRVEIAAALQLNETQVKIWFQNRRMKQKKREKEGHSLQTL 365          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.795e-15
Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 1
Query:  526 RKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQK 717
            R+R R T+S+ Q LELEKEF+   YL R  RI ++  L L E+Q+K+WFQNRRMK K++ +  K
Sbjct:   27 RRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKENNRDK 90          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 69.3218 bits (168), Expect = 3.409e-15
Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRD 702
            KR RT +++ Q+LELEKEF    YL R  RI +A  L L E+QIK+WFQNRRMK K+D
Sbjct:    3 KRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKD 60          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: HOX2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS10])

HSP 1 Score: 75.485 bits (184), Expect = 6.408e-16
Identity = 34/59 (57.63%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDE 705
            KR RT ++  QLLELEKEF    YL R  RI +A  L+L EKQ+K+WFQNRR+K K+D+
Sbjct:  124 KRIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRVKWKKDK 182          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO45719 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS07])

HSP 1 Score: 68.5514 bits (166), Expect = 4.265e-15
Identity = 32/56 (57.14%), Postives = 42/56 (75.00%), Query Frame = 1
Query:  532 RPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKR 699
            R RT ++ SQ LELEKEF+++ Y+ R  R  LA  L+L EK IK+WFQNRRMK+K+
Sbjct:    1 RARTAYTASQQLELEKEFLYSRYITRTRRKELANTLDLSEKHIKIWFQNRRMKKKK 56          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: HOX6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S277])

HSP 1 Score: 72.7886 bits (177), Expect = 1.202e-14
Identity = 34/58 (58.62%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRD 702
            ++ R TF+Q QL+ELEKEF  + YL R  RI +A  L L E QIK+WFQNRRMK KR+
Sbjct:  154 QKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWFQNRRMKWKRE 211          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: MOXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR27])

HSP 1 Score: 68.1662 bits (165), Expect = 1.502e-14
Identity = 34/68 (50.00%), Postives = 44/68 (64.71%), Query Frame = 1
Query:  526 RKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKS 729
            +++ RT FS+ QL ELE+EF    YL R  R  +A  L+L E+Q+KVWFQNRRMK KR       +KS
Sbjct:   14 KRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVKVWFQNRRMKWKRGRGGVPVKKS 81          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO34127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ94])

HSP 1 Score: 67.3958 bits (163), Expect = 1.698e-14
Identity = 33/62 (53.23%), Postives = 40/62 (64.52%), Query Frame = 1
Query:  526 RKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESE 711
            +K+PRT F++SQ+ ELEK F    YL    R  LAG L L + Q+K WFQNRRMK KR   E
Sbjct:    1 KKKPRTAFTESQISELEKRFQSQKYLGSKERSELAGTLGLTDTQVKTWFQNRRMKLKRQRQE 62          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: pdx1 (pancreatic and duodenal homeobox 1 [Source:NCBI gene;Acc:101160115])

HSP 1 Score: 82.4185 bits (202), Expect = 1.568e-17
Identity = 44/96 (45.83%), Postives = 60/96 (62.50%), Query Frame = 1
Query:  508 ASPHIMR-----KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNK 780
            A P++M      KR RT ++++QLLELEKEF+   Y+ R  R+ LA  L+L E+ IK+WFQNRRMK K++E   +RR    D   DSS T  D  +
Sbjct:  134 AGPYVMAETEENKRTRTAYTRAQLLELEKEFLFNRYISRPRRVELALTLSLTERHIKIWFQNRRMKWKKEED--RRRARGGDPDQDSSITSGDQGE 227          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: hoxd3a (homeobox D3 [Source:NCBI gene;Acc:101164107])

HSP 1 Score: 79.7221 bits (195), Expect = 5.099e-16
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  514 PHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHN 777
            P    KR RT ++ +QL+ELEKEF    YL R  R+ +A  LNL E+QIK+WFQNRRMK K+D+  +    S   + PD S  +   N
Sbjct:  161 PGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKSKGLAHSPLGHSPDRSPPLSGPN 248          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: gsx1 (GS homeobox 1 [Source:NCBI gene;Acc:100049468])

HSP 1 Score: 77.7962 bits (190), Expect = 5.249e-16
Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRR 723
            KR RT F+ +QLLELE+EF    YL R  RI +A  LNL EKQ+K+WFQNRR+K K++     +R
Sbjct:  137 KRMRTAFTSTQLLELEREFTSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSSGQR 201          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: HOXA7 (homeobox A7 [Source:NCBI gene;Acc:110015904])

HSP 1 Score: 77.411 bits (189), Expect = 6.198e-16
Identity = 37/63 (58.73%), Postives = 44/63 (69.84%), Query Frame = 1
Query:  526 RKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQ 714
            RKR R T+S+ Q LELEKEF    YL R  R+ +A  L L E+QIK+WFQNRRMK K+D  EQ
Sbjct:  123 RKRGRQTYSRYQTLELEKEFHFNRYLSRRRRVEIAHALTLTERQIKIWFQNRRMKWKKDHKEQ 185          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: gsx2 (GS homeobox 2 [Source:NCBI gene;Acc:100144353])

HSP 1 Score: 77.0258 bits (188), Expect = 8.209e-16
Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKR 720
            KR RT F+ +QLLELE+EF    YL R  RI +A  LNL EKQ+K+WFQNRR+K K++    +R
Sbjct:  137 KRMRTAFTSTQLLELEREFSTNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKATQR 200          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000025656.1 (SMESG000025656.1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 295/312 (94.55%), Postives = 296/312 (94.87%), Query Frame = 1
Query:  205 MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSHFHYCSEFPYDEL 1140
            MESNRFHHLLQSGVGINSYDSSKT               DINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLN+NLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSF NNLPNCNQSSHFHYCSEFPYDEL
Sbjct:    1 MESNRFHHLLQSGVGINSYDSSKT---------------DINLNYISDPYRFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERSDASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNENLPDSSNTIVDHNKFHLPFQNSMSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFNFESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFHNNLPNCNQSSHFHYCSEFPYDEL 297          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000062714.1 (SMESG000062714.1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.678e-15
Identity = 36/62 (58.06%), Postives = 44/62 (70.97%), Query Frame = 1
Query:  526 RKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESE 711
            +++ RT FS+ Q+LELEKEF    YL R  R  LA  LNL E+QIKVWFQNRRMK KR + +
Sbjct:  231 QRKERTAFSKGQILELEKEFSVHNYLTRLRRYELAVALNLNERQIKVWFQNRRMKCKRSKGQ 292          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.029e-14
Identity = 33/58 (56.90%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRD 702
            KR R  +S+ Q LELEKEF +  YL R  RI +A  + L E+QIK+WFQNRRMK K+D
Sbjct:  106 KRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 163          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000043155.1 (SMESG000043155.1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.052e-14
Identity = 37/75 (49.33%), Postives = 51/75 (68.00%), Query Frame = 1
Query:  520 IMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNDNL 744
            + ++R R T+S+ Q LELEKEF    YL R  RI +A  L L E+QIK+WFQNRRMK K+   E+++ + LND +
Sbjct:  249 VQKRRGRQTYSRHQTLELEKEFQFNHYLTRRRRIEIAHNLCLSERQIKIWFQNRRMKLKK---ERQQIRELNDEI 320          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000071019.1 (SMESG000071019.1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.092e-14
Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 1
Query:  529 KRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRD 702
            KR RT +++ Q+LELEKEF    YL R  RI +A  L L E+Q+K+WFQNRRMK K+D
Sbjct:  226 KRNRTAYTRQQILELEKEFHFNKYLTRKRRIEIAQSLQLSERQVKIWFQNRRMKWKKD 283          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDX11.292e-1553.97pancreatic and duodenal homeobox 1 [Source:HGNC Sy... [more]
HOXB31.404e-1548.68homeobox B3 [Source:HGNC Symbol;Acc:HGNC:5114][more]
GSX21.544e-1553.42GS homeobox 2 [Source:HGNC Symbol;Acc:HGNC:24959][more]
HOXD31.547e-1541.84homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
HOXD31.547e-1541.84homeobox D3 [Source:HGNC Symbol;Acc:HGNC:5137][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-91.100e-1543.62Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Pr... [more]
ceh-121.158e-1559.65Homeobox protein ceh-12 [Source:UniProtKB/Swiss-P... [more]
ceh-123.114e-1559.65Homeobox protein ceh-12 [Source:UniProtKB/Swiss-P... [more]
php-32.258e-1448.65Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-32.258e-1448.65Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ind6.033e-1860.66gene:FBgn0025776 transcript:FBtr0333875[more]
zen1.424e-1636.14gene:FBgn0004053 transcript:FBtr0081670[more]
exex1.659e-1553.03gene:FBgn0041156 transcript:FBtr0076751[more]
zen22.274e-1545.24gene:FBgn0004054 transcript:FBtr0081671[more]
zen22.653e-1545.24gene:FBgn0004054 transcript:FBtr0290296[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc3a1.592e-1736.42homeobox C3a [Source:NCBI gene;Acc:30421][more]
hoxc3a1.592e-1736.42homeobox C3a [Source:NCBI gene;Acc:30421][more]
hoxa1a1.981e-1743.56homeobox A1a [Source:NCBI gene;Acc:58051][more]
hoxa1a2.025e-1743.56homeobox A1a [Source:NCBI gene;Acc:58051][more]
hoxc3a4.385e-1736.42homeobox C3a [Source:NCBI gene;Acc:30421][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
castor22.410e-1743.86cytosolic arginine sensor for mTORC1 subunit 2 [So... [more]
hnf4b5.125e-1741.59hepatocyte nuclear factor 4, beta [Source:Xenbase;... [more]
hoxa14.818e-1645.88homeobox A1 [Source:NCBI gene;Acc:493379][more]
klf77.989e-1653.73Kruppel-like factor 7 (ubiquitous) [Source:Xenbase... [more]
hoxd81.455e-1533.14homeobox D8 [Source:NCBI gene;Acc:100216142][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdx16.504e-1653.97pancreatic and duodenal homeobox 1 [Source:MGI Sym... [more]
Hoxb31.137e-1548.68homeobox B3 [Source:MGI Symbol;Acc:MGI:96184][more]
Hoxb31.137e-1548.68homeobox B3 [Source:MGI Symbol;Acc:MGI:96184][more]
Hoxd31.307e-1545.78homeobox D3 [Source:MGI Symbol;Acc:MGI:96207][more]
Hoxa31.673e-1548.68homeobox A3 [Source:MGI Symbol;Acc:MGI:96175][more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98SI1|HXA1A_DANRE1.528e-1643.56Homeobox protein Hox-A1a OS=Danio rerio OX=7955 GN... [more]
sp|P28174|HXC3A_DANRE4.266e-1635.80Homeobox protein Hox-C3a OS=Danio rerio OX=7955 GN... [more]
sp|A1L2P5|HXD3_XENLA7.037e-1642.98Homeobox protein Hox-D3 OS=Xenopus laevis OX=8355 ... [more]
sp|O42370|HXD3A_DANRE7.246e-1641.18Homeobox protein Hox-D3a OS=Danio rerio OX=7955 GN... [more]
sp|P14837|PDX1_XENLA7.582e-1646.43Pancreas/duodenum homeobox protein 1 OS=Xenopus la... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMJ50.000e+0100.00Homeobox domain-containing protein OS=Schmidtea me... [more]
F1CDE70.000e+091.99XLOX OS=Schmidtea polychroa OX=50054 PE=2 SV=1[more]
A0A3B3UCG81.102e-1637.75Homeobox domain-containing protein OS=Poecilia lat... [more]
W5N9X06.324e-1648.24Homeobox domain-containing protein OS=Lepisosteus ... [more]
A0A0L7LK529.584e-1645.61Hox protein zen OS=Operophtera brumata OX=104452 G... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd3a3.149e-1741.38homeobox D3 [Source:NCBI gene;Acc:103034417][more]
hoxd3a3.149e-1741.38homeobox D3 [Source:NCBI gene;Acc:103034417][more]
ENSAMXT00000045941.15.971e-1742.31pancreas/duodenum homeobox protein 1-like [Source:... [more]
gsx27.147e-1753.42GS homeobox 2 [Source:NCBI gene;Acc:103043972][more]
hoxa1a1.524e-1633.99homeobox A1a [Source:NCBI gene;Acc:58051][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001141.12.170e-1753.03pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
ENSPMAT00000000986.11.191e-1656.67pep scaffold:Pmarinus_7.0:GL477479:36520:39429:-1 ... [more]
ENSPMAT00000007188.11.668e-1553.85pep scaffold:Pmarinus_7.0:GL477571:301368:307708:1... [more]
ENSPMAT00000005057.11.795e-1551.56pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
hoxd4a3.409e-1558.62homeobox D4a [Source:NCBI gene;Acc:30329][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
HOX26.408e-1657.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457194.265e-1557.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX61.202e-1458.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOXC1.502e-1450.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341271.698e-1453.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdx11.568e-1745.83pancreatic and duodenal homeobox 1 [Source:NCBI ge... [more]
hoxd3a5.099e-1645.45homeobox D3 [Source:NCBI gene;Acc:101164107][more]
gsx15.249e-1653.85GS homeobox 1 [Source:NCBI gene;Acc:100049468][more]
HOXA76.198e-1658.73homeobox A7 [Source:NCBI gene;Acc:110015904][more]
gsx28.209e-1654.69GS homeobox 2 [Source:NCBI gene;Acc:100144353][more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025656.10.000e+094.55SMESG000025656.1[more]
SMESG000062714.12.678e-1558.06SMESG000062714.1[more]
SMESG000044469.11.029e-1456.90SMESG000044469.1[more]
SMESG000043155.12.052e-1449.33SMESG000043155.1[more]
SMESG000071019.12.092e-1456.90SMESG000071019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018413 ID=SMED30018413|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1211bp
CAACGTTTATAGCATAAAAATTAATTTTGAGGTCGACAATATTTATTTAT
TGGAAAAAATTTCAAATCATTTCTCATAACCAATAGAAATCGAGATGCTG
GCGGAGTCGTGAAATAATATTCAAGCCAATTATATTGATTGGAGAATGCG
AAAATCATTTAGATATTATTATCAATCAGCAGAATTTTCCATTCATTGTT
GTCAATGGAATCTAATCGATTTCACCACCTGCTTCAATCCGGCGTTGGCA
TAAATTCATACGATTCATCCAAGACTGGTGGATATCATGACTATTTTTAT
GAAAATGGAAATCATTTTTCAGATATTAATTTGAACTACATCTCTGATCC
CTATCGATTTAATTATGATTCAACGGAAGCTACAACGACTTTTGAAAAAG
AATCCTCCCAACTCGAGAAATTCGCATATTTCAATGATTCTTGTTTGCCA
GAGGAAACGAAATCTGACTGGAGCAAGTCGTGTGAAGAACCAATCGAAAG
ATCTGACGCTAGTCCACACATCATGAGAAAGAGGCCCCGAACGACATTTT
CTCAATCGCAACTATTGGAGTTGGAAAAGGAATTTATTCATACCGCTTAT
CTGGATCGAGCAAACCGAATCTCTTTAGCAGGCAAATTAAATCTGAAAGA
AAAACAAATTAAAGTTTGGTTTCAAAATAGACGAATGAAAAGAAAAAGAG
ACGAAAGCGAACAGAAACGTCGAAAATCGCTTAATGACAATCTGCCCGAT
TCGTCAAATACAATTGTAGATCACAACAAATTTCATTTGCCATTTCAAAA
TTCAATGAGTCGCAGTTCGAATCAATGTTCAGAATCAGCGACGGGAAACA
TTCCATGGAACCTGGATAATGGGTTCCCCAGCTACAATTTTGATAGTTCC
TGTCCTCGAAGTCCACTTGCAAAAAACGATTGTCTCGGTCATTCTGGCTT
TAATTTCGAGTCGTTTATCAATCATTACAATCAACTATACGATTTTCCAT
CGACAATTGAATCTCAATATCCATATAATGTCGACAATCCGGCATTTATT
TCCTATGATTCTTCCTTTCCCAACAACCTTCCAAACTGCAATCAATCCTC
CCATTTTCATTATTGCTCAGAATTTCCTTATGATGAGCTACAAAATTATC
AGAACTATTATCAGAACAATTACTTCGAATAATTAAATTTGTGATTAATT
GTTATCTCCGG
back to top

protein sequence of SMED30018413-orf-1

>SMED30018413-orf-1 ID=SMED30018413-orf-1|Name=SMED30018413-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MESNRFHHLLQSGVGINSYDSSKTGGYHDYFYENGNHFSDINLNYISDPY
RFNYDSTEATTTFEKESSQLEKFAYFNDSCLPEETKSDWSKSCEEPIERS
DASPHIMRKRPRTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEK
QIKVWFQNRRMKRKRDESEQKRRKSLNDNLPDSSNTIVDHNKFHLPFQNS
MSRSSNQCSESATGNIPWNLDNGFPSYNFDSSCPRSPLAKNDCLGHSGFN
FESFINHYNQLYDFPSTIESQYPYNVDNPAFISYDSSFPNNLPNCNQSSH
FHYCSEFPYDELQNYQNYYQNNYFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000421tail
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 158..178
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 80..168
e-value: 9.5E-25
score: 88.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 160..185
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 160..178
NoneNo IPR availablePANTHERPTHR45664FAMILY NOT NAMEDcoord: 67..214
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 130..141
score: 35.44
coord: 145..155
score: 54.07
coord: 155..164
score: 79.93
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 108..170
e-value: 7.6E-24
score: 95.2
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 109..165
e-value: 8.7E-21
score: 73.5
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 106..166
score: 20.099
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 109..167
e-value: 5.8281E-22
score: 85.3728
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 141..164
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 98..166