Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30018393
Length (bp)1879
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30018393) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30018393) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018393

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30018393SMESG000021519.1 dd_Smed_v4_8090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018393SMESG000021519.1 dd_Smed_v4_8090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018393SMESG000021519.1 dd_Smed_v4_8090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30018393SMESG000021519.1 dd_Smed_v6_8090_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018393SMESG000021519.1 OX_Smed_1.0.11592ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 318.546 bits (815), Expect = 6.397e-100
Identity = 190/453 (41.94%), Postives = 276/453 (60.93%), Query Frame = 1
Query:  265 KRMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            +R++   R N  N +  +K+SL R++ +++   C   R+ +TLP+ SIII F++  W +L++T   +L RSP  L+ EI+++DD +D   ++  +  Y++  F +VR++   KREGLI+ R+LGA +A G V+ F+DSHC   V WLPPLL+ I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD++ QKKL+  LNCKSF WFM  +A+D+   YPP+         I       +C D+K+   G  + ++ C + GR E   N  Q F+FT   +IRPG     +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  102 ERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMAL-FPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIR-NVGTGLCADTKHGALGSPLRLEGCVR-GRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKY 549          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 312.768 bits (800), Expect = 6.509e-98
Identity = 191/453 (42.16%), Postives = 277/453 (61.15%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITN 1617
            N F    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI EI+++DD ++   ++ K+  Y+++ F+ VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      + DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L+++L CK F WFM  VA+D+   YPP+         I      ++CVDSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  CFD  + +  + L  C  M  NQ W Y    +  H ++N
Sbjct:   92 NIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIR-NVAANLCVDSKHGATGTELRLDICVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSN 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 313.153 bits (801), Expect = 7.200e-98
Identity = 191/453 (42.16%), Postives = 277/453 (61.15%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITN 1617
            N F    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI EI+++DD ++   ++ K+  Y+++ F+ VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      + DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L+++L CK F WFM  VA+D+   YPP+         I      ++CVDSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  CFD  + +  + L  C  M  NQ W Y    +  H ++N
Sbjct:  109 NIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIR-NVAANLCVDSKHGATGTELRLDICVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSN 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:HGNC Symbol;Acc:HGNC:33844])

HSP 1 Score: 286.96 bits (733), Expect = 3.611e-90
Identity = 167/375 (44.53%), Postives = 230/375 (61.33%), Query Frame = 1
Query:  529 MRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITN 1617
            ++ K+  Y+++ F+ VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      + DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L+++L CK F WFM  VA+D+   YPP+         I      ++CVDSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  CFD  + +  + L  C  M  NQ W Y    +  H ++N
Sbjct:    3 LKDKLEEYMAR-FSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDISAQKELRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIR-NVAANLCVDSKHGATGTELRLDICVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSN 372          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 248.825 bits (634), Expect = 3.990e-74
Identity = 130/300 (43.33%), Postives = 177/300 (59.00%), Query Frame = 1
Query:  718 IKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLPRLHN-NKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD++ QKKL+  LNCKSF WFM  +A+D+   YPP+         I       +C D+K+   G  + ++ C + GR E   N  Q F+FT   +IRPG     +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  192 IARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIR-NVGTGLCADTKHGALGSPLRLEGCVR-GRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKY 487          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 320.857 bits (821), Expect = 4.923e-101
Identity = 183/454 (40.31%), Postives = 285/454 (62.78%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN--VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDT-SLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYS-FDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSE--TLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N++  + +SL R+I +++  +CK + ++  LP+VS+I  F++    TL+++   ++ RSP  L+KEI+++DD ++   +R  +  ++ KN  +  V+V+   KREGLI+ R LGA+ A G++L+F+D+H      WLPPLL+PI E+Y+TV CPF+D+ D +T  +  QDEGARG+FDW FNY RLP    ++  P  PF++P+M G  FAI+ KWFWELGGYDEGL+IWGGEQ+ELSFK+W C GRMV+ PCSR+  I++  Y+ F        + +NYKR+AE+WMD++K+ +Y +H     + D GD+   K +++KL CKSFDWFM+ +A+D    YP +         I      + C+D+++++Q  R G+ +C    + +   EQ    T   +IRP  R +CFD   S +   ++L  C  M  NQ ++Y     QI +  S +C+
Sbjct:  126 NAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIR-NVGTNFCIDTQFKEQNQRFGLRKCTSDDK-DGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCL 576          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-10 (Putative polypeptide N-acetylgalactosaminyltransferase 10 [Source:UniProtKB/Swiss-Prot;Acc:O45947])

HSP 1 Score: 322.013 bits (824), Expect = 1.443e-100
Identity = 183/454 (40.31%), Postives = 285/454 (62.78%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN--VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDT-SLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYS-FDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSE--TLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N++  + +SL R+I +++  +CK + ++  LP+VS+I  F++    TL+++   ++ RSP  L+KEI+++DD ++   +R  +  ++ KN  +  V+V+   KREGLI+ R LGA+ A G++L+F+D+H      WLPPLL+PI E+Y+TV CPF+D+ D +T  +  QDEGARG+FDW FNY RLP    ++  P  PF++P+M G  FAI+ KWFWELGGYDEGL+IWGGEQ+ELSFK+W C GRMV+ PCSR+  I++  Y+ F        + +NYKR+AE+WMD++K+ +Y +H     + D GD+   K +++KL CKSFDWFM+ +A+D    YP +         I      + C+D+++++Q  R G+ +C    + +   EQ    T   +IRP  R +CFD   S +   ++L  C  M  NQ ++Y     QI +  S +C+
Sbjct:  207 NAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIR-NVGTNFCIDTQFKEQNQRFGLRKCTSDDK-DGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCL 657          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 240.736 bits (613), Expect = 1.119e-70
Identity = 163/454 (35.90%), Postives = 260/454 (57.27%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG---ARGAFDWN--FNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N +  + +S++RT+      +CK  ++N+ LP  S+II F++  W  L++T   +L R+P  L++E++++DD +D +  +  +  Y+S+    V+++   KREGLI+ARL GA +A G+VL ++DSHC     W+ PLL+ IK +  TV CP ID+ D +T  Y   +    + G FDW   FN+  +P R   N+T P DP  +P M G +F+I +K+F +LG YD G +IWGGE  ELSFKIWMCGG +  VPCS +  +F+    + +      +++N  R+AE+W+D++K + Y+R   +   F  GDIS +KKL++ L CKSF W+++N+  ++      +   E  N        +  C+D K    G  VG+ QC+  G +     Q +  + D EIR  +   C DY  S   +M+  C  M  NQ+W YN  + ++ +  SQKC+
Sbjct:  144 NQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLGDF--GDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAG----GKNRQCIDYK-PSGGKTVGMYQCHNQGGN-----QYWMLSKDGEIR--RDESCVDYAGSD--VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCL 581          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 240.736 bits (613), Expect = 1.119e-70
Identity = 163/454 (35.90%), Postives = 260/454 (57.27%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG---ARGAFDWN--FNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N +  + +S++RT+      +CK  ++N+ LP  S+II F++  W  L++T   +L R+P  L++E++++DD +D +  +  +  Y+S+    V+++   KREGLI+ARL GA +A G+VL ++DSHC     W+ PLL+ IK +  TV CP ID+ D +T  Y   +    + G FDW   FN+  +P R   N+T P DP  +P M G +F+I +K+F +LG YD G +IWGGE  ELSFKIWMCGG +  VPCS +  +F+    + +      +++N  R+AE+W+D++K + Y+R   +   F  GDIS +KKL++ L CKSF W+++N+  ++      +   E  N        +  C+D K    G  VG+ QC+  G +     Q +  + D EIR  +   C DY  S   +M+  C  M  NQ+W YN  + ++ +  SQKC+
Sbjct:  144 NQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLGDF--GDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAG----GKNRQCIDYK-PSGGKTVGMYQCHNQGGN-----QYWMLSKDGEIR--RDESCVDYAGSD--VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCL 581          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 240.736 bits (613), Expect = 1.119e-70
Identity = 163/454 (35.90%), Postives = 260/454 (57.27%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG---ARGAFDWN--FNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N +  + +S++RT+      +CK  ++N+ LP  S+II F++  W  L++T   +L R+P  L++E++++DD +D +  +  +  Y+S+    V+++   KREGLI+ARL GA +A G+VL ++DSHC     W+ PLL+ IK +  TV CP ID+ D +T  Y   +    + G FDW   FN+  +P R   N+T P DP  +P M G +F+I +K+F +LG YD G +IWGGE  ELSFKIWMCGG +  VPCS +  +F+    + +      +++N  R+AE+W+D++K + Y+R   +   F  GDIS +KKL++ L CKSF W+++N+  ++      +   E  N        +  C+D K    G  VG+ QC+  G +     Q +  + D EIR  +   C DY  S   +M+  C  M  NQ+W YN  + ++ +  SQKC+
Sbjct:  144 NQYASDMISVHRTLPTNIDAECKTEKYNENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGVNVLKRNSIRLAEVWLDDYKTYYYERINNQLGDF--GDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAG----GKNRQCIDYK-PSGGKTVGMYQCHNQGGN-----QYWMLSKDGEIR--RDESCVDYAGSD--VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCL 581          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072973)

HSP 1 Score: 316.62 bits (810), Expect = 8.787e-99
Identity = 194/477 (40.67%), Postives = 291/477 (61.01%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDIND-TDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-------DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYR--NSSETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            D E+ R+L       KRM+    FN +   + +S+ R++ +++   C+   +   LP+VS+II FY+     LM++   L+ RSP  L+KEI+++DD++D   +  ++  YI+++F  VRVV   +R GLI AR  GA+ A  +VL+F+DSH      WLPPLLEPI  N +T  CPFID+ D T+    +QDEGARGAFDW F Y RLP L  +   P DPF +PIM G +FAI+R++FWELGGYDEGL+IWGGEQ+ELSFKIWMCGG M + PCSRI  I++   +        D++H      KNYKR+AE+WMD +K ++Y      Y S D GD+++QK ++ KLNCKSF WFME VA+D++  YPP+        ++    + ++C+D+  RK+ +++G+  C + I   ++ +    S+  D  +R  ++  C D +  +++  + L  C     NQ W Y+    Q+ +
Sbjct:  153 DDESQRDLE------KRMSLENGFN-ALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLH------KNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLR--RKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKH 614          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0333442)

HSP 1 Score: 316.62 bits (810), Expect = 8.787e-99
Identity = 194/477 (40.67%), Postives = 291/477 (61.01%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDIND-TDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-------DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYR--NSSETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            D E+ R+L       KRM+    FN +   + +S+ R++ +++   C+   +   LP+VS+II FY+     LM++   L+ RSP  L+KEI+++DD++D   +  ++  YI+++F  VRVV   +R GLI AR  GA+ A  +VL+F+DSH      WLPPLLEPI  N +T  CPFID+ D T+    +QDEGARGAFDW F Y RLP L  +   P DPF +PIM G +FAI+R++FWELGGYDEGL+IWGGEQ+ELSFKIWMCGG M + PCSRI  I++   +        D++H      KNYKR+AE+WMD +K ++Y      Y S D GD+++QK ++ KLNCKSF WFME VA+D++  YPP+        ++    + ++C+D+  RK+ +++G+  C + I   ++ +    S+  D  +R  ++  C D +  +++  + L  C     NQ W Y+    Q+ +
Sbjct:  153 DDESQRDLE------KRMSLENGFN-ALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLH------KNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLR--RKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKH 614          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant6 (gene:FBgn0035375 transcript:FBtr0072972)

HSP 1 Score: 316.62 bits (810), Expect = 8.787e-99
Identity = 194/477 (40.67%), Postives = 291/477 (61.01%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDIND-TDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-------DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYR--NSSETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            D E+ R+L       KRM+    FN +   + +S+ R++ +++   C+   +   LP+VS+II FY+     LM++   L+ RSP  L+KEI+++DD++D   +  ++  YI+++F  VRVV   +R GLI AR  GA+ A  +VL+F+DSH      WLPPLLEPI  N +T  CPFID+ D T+    +QDEGARGAFDW F Y RLP L  +   P DPF +PIM G +FAI+R++FWELGGYDEGL+IWGGEQ+ELSFKIWMCGG M + PCSRI  I++   +        D++H      KNYKR+AE+WMD +K ++Y      Y S D GD+++QK ++ KLNCKSF WFME VA+D++  YPP+        ++    + ++C+D+  RK+ +++G+  C + I   ++ +    S+  D  +R  ++  C D +  +++  + L  C     NQ W Y+    Q+ +
Sbjct:  153 DDESQRDLE------KRMSLENGFN-ALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLH------KNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLR--RKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKH 614          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0333248)

HSP 1 Score: 265.388 bits (677), Expect = 1.042e-79
Identity = 160/448 (35.71%), Postives = 272/448 (60.71%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN-VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFID-INDTDTSLYSQD-EGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKD-IYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            N    +++S+ R++ +L++  CK  ++   LP++S+I  F++  + TL+++   ++ R+P  L+K+I+++DD ++ + ++  ++ Y+ ++F + V +V   +R+GLI AR+ GAK+A G+V+VF DSH  V   WLPPL+EPI  N K  TCP +D I+  D S +S + +GARG FDW   Y +LP L  +  D   P+ +P+M G +FAI   +FW+LGGYD+ L+IWGGEQ+ELSFKIWMCGG +++VPCSR+  IF+  +           + KN+KR+AE+WMD +K+++Y+R  + Y + D GD+++Q+ ++++L CKSF WFM  VA D L  +PP+         I   ++   C+D+  +   + VG+  C +     + N+    S   D  ++ G  ++C D      + T+ +  C     NQ W Y+  + ++ +
Sbjct:  147 NGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQNVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMK-GFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVH 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant4 (gene:FBgn0051956 transcript:FBtr0114524)

HSP 1 Score: 265.388 bits (677), Expect = 1.042e-79
Identity = 160/448 (35.71%), Postives = 272/448 (60.71%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN-VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFID-INDTDTSLYSQD-EGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKD-IYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            N    +++S+ R++ +L++  CK  ++   LP++S+I  F++  + TL+++   ++ R+P  L+K+I+++DD ++ + ++  ++ Y+ ++F + V +V   +R+GLI AR+ GAK+A G+V+VF DSH  V   WLPPL+EPI  N K  TCP +D I+  D S +S + +GARG FDW   Y +LP L  +  D   P+ +P+M G +FAI   +FW+LGGYD+ L+IWGGEQ+ELSFKIWMCGG +++VPCSR+  IF+  +           + KN+KR+AE+WMD +K+++Y+R  + Y + D GD+++Q+ ++++L CKSF WFM  VA D L  +PP+         I   ++   C+D+  +   + VG+  C +     + N+    S   D  ++ G  ++C D      + T+ +  C     NQ W Y+  + ++ +
Sbjct:  147 NGLISDRISVNRSVPDLRLEACKTRKYLAKLPNISVIFIFFNEHFNTLLRSIYSVINRTPPELLKQIVLVDDGSEWDVLKQPLDDYVQQHFPHLVTIVRNPERQGLIGARIAGAKVAVGQVMVFFDSHIEVNYNWLPPLIEPIAINPKISTCPMVDTISHEDFSYFSGNKDGARGGFDWKMLYKQLPVLPEDALDKSMPYRSPVMMGGLFAINTDFFWDLGGYDDQLDIWGGEQYELSFKIWMCGGMLLDVPCSRVAHIFRGPMKPRGNPRGHNFVAKNHKRVAEVWMDEYKQYVYKRDPKTYDNLDAGDLTRQRGVRERLKCKSFHWFMTEVAPDFLVKFPPVEPPSYAAGIIQNVANPVYCLDNMGKSTEEAVGMFSCADNRTHPQPNQFWELSIFRDLRMK-GFDSVCLDVHEGPPNATVWMWSCHSQGGNQFWYYDRQTQRLVH 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 305.064 bits (780), Expect = 4.766e-95
Identity = 191/485 (39.38%), Postives = 280/485 (57.73%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK-NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            N +    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   +  R+P  LI EI+++DD +D   +++ +  Y+S+ F  VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC   + WLPPLL+ I +N KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P        DP DP+ +P+M G +FA+ R+WFWELGGYD GLEIWGGEQFE+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GD++ QK+L++ L CK F W+M  VA+D+   YPP+         I   +   +CVDSK+   G  + +D C + G       EQ F+F    +IRPG     R  CFD  + +  + L  C  M  NQ W Y      + ++ S  C+  +     + +N C   S  Q+WI Q  N
Sbjct:  108 NIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEYTEYIYQRR-PEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR-NAASGLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQHWSYRKDK-SLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVN 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNTL6 (si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-115])

HSP 1 Score: 305.064 bits (780), Expect = 4.766e-95
Identity = 191/485 (39.38%), Postives = 280/485 (57.73%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK-NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            N +    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   +  R+P  LI EI+++DD +D   +++ +  Y+S+ F  VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC   + WLPPLL+ I +N KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P        DP DP+ +P+M G +FA+ R+WFWELGGYD GLEIWGGEQFE+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GD++ QK+L++ L CK F W+M  VA+D+   YPP+         I   +   +CVDSK+   G  + +D C + G       EQ F+F    +IRPG     R  CFD  + +  + L  C  M  NQ W Y      + ++ S  C+  +     + +N C   S  Q+WI Q  N
Sbjct:  108 NIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTLHSISNRTPDHLIAEIILVDDYSDREHLKAHLAEYMSR-FPKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEANINWLPPLLDQIAQNPKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQGPDPSDPYQSPVMAGGLFAVNRQWFWELGGYDTGLEIWGGEQFEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEYTEYIYQRR-PEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR-NAASGLCVDSKHGSTGTELRLDNCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQNSPITLYDCHGMKGNQHWSYRKDK-SLYHLVSSGCMDCSPNDKRIFMNKCDPKSETQQWIFQKVN 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10-like [Source:NCBI gene;Acc:103910015])

HSP 1 Score: 281.952 bits (720), Expect = 1.420e-88
Identity = 167/400 (41.75%), Postives = 238/400 (59.50%), Query Frame = 1
Query:  565 FTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCNDN 1731
               VR++   KREGLI+ RLLGA  A+G+V+ F+DSHC   V WLPPLL+ I +N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP +PFD+P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + +F+YQR   EY     GD+S+QK+L+ +L+C+SF WFME VA+D+   YPP+         +       +CV+SK+   G  + ++ C    G    +  Q F+F    +IR G     + +CFD  + +  + L  C  M  NQ W Y    S  H I+N     C+  ++    LL+++C  SS+ Q+W+ Q  N +
Sbjct:    4 LPKVRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLDRIAQNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAQLAKPDPSEPFDSPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPGGVSLARNLKRVAEVWMDEYAEFLYQRR-PEYRHLSSGDVSQQKELRSRLHCRSFRWFMEEVAWDLPKHYPPVEPPAAAWGELR-NVGTGLCVESKHFSSGSPIRLEPCLRSRGEPSWSHGQVFTFGWRQDIRVGDPLHTKKVCFDAVSHNSPVTLYDCHGMKGNQLWAYRKDRSLFHPISN----SCVSADAAQKRLLMSSCDASSSSQQWVFQNTNSS 396          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 239.195 bits (609), Expect = 1.484e-70
Identity = 162/465 (34.84%), Postives = 258/465 (55.48%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP  S++I F++  W TL++T   ++ RSPR L++EI+++DD ++ + ++ ++  Y+ K    VRVV   +R GLI+ARL GA ++ G+V+ F+D+HC     WL PLL  IK + KTV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDIS +  L+Q+L CK F W++ENV  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G       Q FS+T++ EIR    +LC D    +  +M+ +C  +  NQ WEY+     + ++ S +C+
Sbjct:   73 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMG-----GNQVFSYTANKEIR--TDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCL 522          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 239.195 bits (609), Expect = 1.484e-70
Identity = 162/465 (34.84%), Postives = 258/465 (55.48%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP  S++I F++  W TL++T   ++ RSPR L++EI+++DD ++ + ++ ++  Y+ K    VRVV   +R GLI+ARL GA ++ G+V+ F+D+HC     WL PLL  IK + KTV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDIS +  L+Q+L CK F W++ENV  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G       Q FS+T++ EIR    +LC D    +  +M+ +C  +  NQ WEY+     + ++ S +C+
Sbjct:   73 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKTKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMG-----GNQVFSYTANKEIR--TDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCL 522          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 317.775 bits (813), Expect = 9.502e-100
Identity = 205/489 (41.92%), Postives = 292/489 (59.71%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            N F   K++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI+E++++DD +D   +R K+  Y++  +  VR+V   KREGLI+ RLLGA +AKG+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      +TDP +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+ELSFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L++ L CK F W+M  VA+D+   YPP+         I      ++C+DSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  CFD  + S  + L  C  M  NQ+W Y    +  H +TN     CI  N     L +N C   S  Q+WI +  N
Sbjct:  108 NIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRR-PEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEIR-NVASNLCIDSKHGATGTELRLDTCVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSYRKDKTLFHPVTN----SCIDCNPAEKKLFMNRCDPLSETQQWIFEHVN 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 317.39 bits (812), Expect = 1.573e-99
Identity = 189/441 (42.86%), Postives = 277/441 (62.81%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDF--EIRPG--QRNL--CFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            N F  +K+SL R++ +++ + CK   +   LP+ S+II F++  W +L++T   +L RSP  LI EI+++DD +D   ++S++  Y++ NF  V++V   KREGLI+ R+LGA +A G+VL F+DSHC   V WLPPLL+P+ +NYKTV CP ID+ D+D   Y    G   RGAFDW   Y R+P      K DP DPFD+P+M G +FAI R+WFW+LGGYD GLEIWGGEQ+E+SFK+WMCGGRMV+ PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   +Y     GD++ QK+L++KL C+ F WFM  +A+D+   YPP+ +       I     D +CV  K+   G  + ++ CN+ GR+      R  FT  +  +IRPG  Q  +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  111 NIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNVRMD-MCVGVKHVTSGTEIRLEACNK-GRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKY 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:779898])

HSP 1 Score: 317.39 bits (812), Expect = 1.573e-99
Identity = 189/441 (42.86%), Postives = 277/441 (62.81%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDF--EIRPG--QRNL--CFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            N F  +K+SL R++ +++ + CK   +   LP+ S+II F++  W +L++T   +L RSP  LI EI+++DD +D   ++S++  Y++ NF  V++V   KREGLI+ R+LGA +A G+VL F+DSHC   V WLPPLL+P+ +NYKTV CP ID+ D+D   Y    G   RGAFDW   Y R+P      K DP DPFD+P+M G +FAI R+WFW+LGGYD GLEIWGGEQ+E+SFK+WMCGGRMV+ PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   +Y     GD++ QK+L++KL C+ F WFM  +A+D+   YPP+ +       I     D +CV  K+   G  + ++ CN+ GR+      R  FT  +  +IRPG  Q  +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  111 NIFVSDKISLNRSLPDIRHSNCKNKFYFSKLPNTSVIIPFHNEGWSSLLRTVHSVLNRSPPELIAEIVLVDDYSDKAHLKSRLEKYMA-NFPKVKIVRTKKREGLIRTRMLGATVASGEVLTFLDSHCEANVNWLPPLLDPLVQNYKTVVCPMIDVIDSDNFGYVTQAGDAMRGAFDWEMFYKRIPIPPELQKGDPSDPFDSPVMAGGLFAINREWFWQLGGYDPGLEIWGGEQYEISFKVWMCGGRMVDSPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PDYRHLSVGDVAAQKELRRKLQCRDFKWFMNEIAWDLPKYYPPVELPPAAWGEIRNVRMD-MCVGVKHVTSGTEIRLEACNK-GRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTLFDCHGMKGNQLWKY 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 290.426 bits (742), Expect = 1.041e-89
Identity = 195/493 (39.55%), Postives = 274/493 (55.58%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSE------KLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            N F   K++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI+E++++DD +D   +R K+  Y++  +  VR+V   KREGLI+ RLLGA +AKG+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      +TDP +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+ELSFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L++ L CK F W+M  VA+D+   YPP+          K+NC                                         F+F    +IRPG+    R  CFD  + S  + L  C  M  NQ+W Y    +  H +TN     CI  N     L +N C   S  Q+WI +  N
Sbjct:  108 NIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRR-PEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKINC----------------------------------------LFTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSYRKDKTLFHPVTN----SCIDCNPAEKKLFMNRCDPLSETQQWIFEHVN 553          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: GALNTL6 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:100487935])

HSP 1 Score: 288.5 bits (737), Expect = 4.765e-89
Identity = 181/445 (40.67%), Postives = 255/445 (57.30%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLPRLHN-NKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSE------KLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            N F   K++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI+E++++DD +D   +R K+  Y++  +  VR+V   KREGLI+ RLLGA +AKG+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      +TDP +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+ELSFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L++ L CK F W+M  VA+D+   YPP+          K+NC                                         F+F    +IRPG+    R  CFD  + S  + L  C  M  NQ+W Y
Sbjct:  108 NIFVSNKIALARSLPDIRHPNCKHKLYLERLPNTSIIIPFHNEGWTSLLRTIHSVINRTPDSLIEEMILVDDFSDREHLREKLEEYMA-YYPKVRIVRTKKREGLIRTRLLGASMAKGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRTDPSEPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYELSFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPTGTSLARNLKRVAETWMDEYAEYIYQRR-PEYRHLSTGDISSQKELRKHLKCKDFKWYMSEVAWDVPKFYPPVEPPPASWGEVKINC----------------------------------------LFTFGWREDIRPGEPLHTRKFCFDSISHSSPVTLYDCHGMKGNQQWSY 509          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:MGI Symbol;Acc:MGI:1890480])

HSP 1 Score: 313.538 bits (802), Expect = 3.098e-98
Identity = 189/453 (41.72%), Postives = 272/453 (60.04%), Query Frame = 1
Query:  265 KRMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            +R++   R N  N +  +K+SL R++ +++   C    + +TLP+ SIII F++  W +L++T   +L RSP  L+ EI+++DD +D   ++  +  Y++  F +VR++   KREGLI+ R+LGA  A G V+ F+DSHC   V WLPPLL+ I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD+  QKKL+  LNCKSF WFM  +A+D+   YPP+         I       +C D+K    G  + ++ C + GR E   N  Q F+FT   +IRPG     +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  102 ERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMAL-FPSVRILRTKKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVVAQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIR-NVGTGLCTDTKLGTLGSPLRLETCIR-GRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKY 549          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 312.768 bits (800), Expect = 6.867e-98
Identity = 200/476 (42.02%), Postives = 287/476 (60.29%), Query Frame = 1
Query:  268 RMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNI-----PSQKCI 1638
            R +S  R N  N F    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI EI+++DD +D   ++ K+  Y+++ F+ VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      + DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L+++L CK F WFM  VA+D+   YPP+         I   + + +CVDSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  C D  + S  + L  C  M  NQ W Y    +  H ++N      PS+K I
Sbjct:   98 RDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDDFSDREHLKDKLEDYMAR-FSKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN-LCVDSKHGATGTELRLDVCVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISHSSPVTLYDCHGMKGNQLWGYREDRTLFHPVSNSCMDCNPSEKKI 568          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galntl6 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 6 [Source:MGI Symbol;Acc:MGI:1913581])

HSP 1 Score: 286.574 bits (732), Expect = 4.599e-90
Identity = 171/387 (44.19%), Postives = 235/387 (60.72%), Query Frame = 1
Query:  529 MRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNI-----PSQKCI 1638
            ++ K+  Y+++ F+ VR+V   KREGLI+ RLLGA +A+G+VL F+DSHC V V WLPPLL  I  N+KT+ CP ID+ D +   Y    G   RGAFDW   Y R+P      + DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GDIS QK+L+++L CK F WFM  VA+D+   YPP+         I   + + +CVDSK+   G  + +D C + G SE+  + EQ F+F    +IRPG+    R  C D  + S  + L  C  M  NQ W Y    +  H ++N      PS+K I
Sbjct:    3 LKDKLEDYMAR-FSKVRIVRTKKREGLIRTRLLGASVARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDISAQKELRKRLKCKDFKWFMAAVAWDVPKYYPPVEPLPAAWGEIRSVAAN-LCVDSKHGATGTELRLDVCVKDG-SERTWSHEQLFTFGWREDIRPGEPLHTRKFCLDAISHSSPVTLYDCHGMKGNQLWGYREDRTLFHPVSNSCMDCNPSEKKI 384          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt7 (polypeptide N-acetylgalactosaminyltransferase 7 [Source:MGI Symbol;Acc:MGI:1349449])

HSP 1 Score: 240.35 bits (612), Expect = 5.301e-70
Identity = 167/485 (34.43%), Postives = 269/485 (55.46%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXX-XXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFID-INDTDTSLYSQDEG-----ARGAFDWNFNYTRLPRLHNNKTDPE---DPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFK----DIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKW 1707
            N    + +SL R++N+L+  +CK+  +++ L + S++I F++  W TLM+T   ++ R+PR+ + EI++IDD ++   ++ K++ YI      V+V    +REGLI+AR     K   G+VL+++D+HC V V W  PL+ PI ++  T T P ID I+  D S+  Q  G     ARGA+DW+  + R+P  H  K   +   +P+ +P M G +FAI + +F+ELG YD GL+IWGGE FE+S+KIW CGG+++ VPCSR+  I++                   KNY R+ E+W D +K + Y     E  +   GDIS+ KK ++  NCKSF WFME +AYDI   YP    + +      LE+  + C+DS  +  G  V +  C+++G +     Q F      ++   Q + C         +M++ C+L N  ++W+Y  + H+ T+I S KC+  +     + ++ C  S   QKW
Sbjct:  176 NMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWSTLMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRATCTVPLIDYIDGNDYSIEPQQGGDEDGFARGAWDWSMLWKRIPLSHKEKAKRKHKTEPYRSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPLYVGSSPTLKNYVRVVEVWWDEYKDYFYASR-PESKALPYGDISELKKFREDHNCKSFKWFMEEIAYDITAHYPLPPRNVEWGEIRGLET--AYCIDSMGKTNGGFVELGPCHRMGGN-----QLFRINEANQLM--QYDQCLTKGPDGSKVMITHCNL-NEFKEWQYFKSLHRFTHITSGKCLDRSEVLHQVFISTCDSSKMTQKW 649          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 235.728 bits (600), Expect = 3.220e-69
Identity = 157/465 (33.76%), Postives = 259/465 (55.70%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP+ S++I F++  W TL++T   ++ RSPR +I+EI+++DD ++ + ++  + +Y+ K    V V+   +R GLI+ARL GA +++G+V+ F+D+HC     WL PLL  IK + +TV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDIS +  L++KL CK F W++EN+  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G +     Q FS+T++ EIR    +LC D    +  + + +C  +  NQ WEY+     + ++ S +C+
Sbjct:   75 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMGGN-----QVFSYTANKEIR--TDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCL 524          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|A8Y236|GLT10_CAEBR (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis briggsae OX=6238 GN=gly-10 PE=3 SV=2)

HSP 1 Score: 322.398 bits (825), Expect = 2.060e-100
Identity = 182/454 (40.09%), Postives = 287/454 (63.22%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN--VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDT-SLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYS-FDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSE--TLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N++  + +SL R+I +++  +CK + ++  LP+VS+I  F++    TL+++   ++ RSP  L+KEI+++DD ++   +R  +  ++ KN  +  V+++   KREGLI+ R LGA+ A G++L+F+D+H      WLPPLL+PI ++Y+TV CPF+D+ D +T  +  QDEGARG+FDW FNY RLP    ++ +P  PFD+P+M G  FAI+ KWFWELGGYDEGL+IWGGEQ+ELSFK+W C G+MV+ PCSR+  I++  Y+ F        + +NYKR+AE+WMD +K+ +Y +H     + D GD+   K +++KL CKSFDWFM+ +A+D    YP I         I   + + +C+D+++++Q  R G+ +C    + +   EQ    T   +IRP  R +CFD   S +   ++L  C  M  NQ ++Y     QI +  S +C+
Sbjct:  133 NAYISDMISLNRSIKDIRHKECKKMTYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKILRTKKREGLIRGRQLGAQEATGEILIFLDAHSECNYNWLPPLLDPIADDYRTVVCPFVDVIDCETYEIRPQDEGARGSFDWAFNYKRLPLTKKDRENPTKPFDSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGKMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDEYKETLY-KHRPGIGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAIEPKASAEGEIRHVASN-LCIDTQFKEQNQRFGLRKCASEDK-DGGGEQDLRLTRWHDIRPKGRKICFDVSTSVDKAPIILFDCHSMKGNQLFKYRMPQKQIYHPVSGQCL 583          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O45947|GLT10_CAEEL (Putative polypeptide N-acetylgalactosaminyltransferase 10 OS=Caenorhabditis elegans OX=6239 GN=gly-10 PE=1 SV=3)

HSP 1 Score: 321.627 bits (823), Expect = 1.690e-99
Identity = 183/454 (40.31%), Postives = 285/454 (62.78%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN--VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDT-SLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYS-FDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSE--TLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N++  + +SL R+I +++  +CK + ++  LP+VS+I  F++    TL+++   ++ RSP  L+KEI+++DD ++   +R  +  ++ KN  +  V+V+   KREGLI+ R LGA+ A G++L+F+D+H      WLPPLL+PI E+Y+TV CPF+D+ D +T  +  QDEGARG+FDW FNY RLP    ++  P  PF++P+M G  FAI+ KWFWELGGYDEGL+IWGGEQ+ELSFK+W C GRMV+ PCSR+  I++  Y+ F        + +NYKR+AE+WMD++K+ +Y +H     + D GD+   K +++KL CKSFDWFM+ +A+D    YP +         I      + C+D+++++Q  R G+ +C    + +   EQ    T   +IRP  R +CFD   S +   ++L  C  M  NQ ++Y     QI +  S +C+
Sbjct:  188 NAYISDMISLNRSIKDIRHKECKNMMYSAKLPTVSVIFPFHEEHNSTLLRSVYSVINRSPPELLKEIILVDDFSEKPALRQPLEDFLKKNKIDHIVKVLRTKKREGLIRGRQLGAQDATGEILIFLDAHSEANYNWLPPLLDPIAEDYRTVVCPFVDVIDCETYEVRPQDEGARGSFDWAFNYKRLPLTKKDRESPTKPFNSPVMAGGYFAISAKWFWELGGYDEGLDIWGGEQYELSFKVWQCHGRMVDAPCSRVAHIYRCKYAPFKNAGMGDFVSRNYKRVAEVWMDDYKETLY-KHRPGVGNADAGDLKLMKGIREKLQCKSFDWFMKEIAFDQDKYYPAVEPKASAEGEIR-NVGTNFCIDTQFKEQNQRFGLRKCTSDDK-DGGGEQDLRLTRWHDIRPKGRKICFDCSTSVDKAPVILFDCHSMKGNQLFKYRVAQKQIYHPISGQCL 638          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q86SR1|GLT10_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Homo sapiens OX=9606 GN=GALNT10 PE=1 SV=2)

HSP 1 Score: 318.546 bits (815), Expect = 3.072e-99
Identity = 190/453 (41.94%), Postives = 276/453 (60.93%), Query Frame = 1
Query:  265 KRMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            +R++   R N  N +  +K+SL R++ +++   C   R+ +TLP+ SIII F++  W +L++T   +L RSP  L+ EI+++DD +D   ++  +  Y++  F +VR++   KREGLI+ R+LGA +A G V+ F+DSHC   V WLPPLL+ I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD++ QKKL+  LNCKSF WFM  +A+D+   YPP+         I       +C D+K+   G  + ++ C + GR E   N  Q F+FT   +IRPG     +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  102 ERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMAL-FPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIR-NVGTGLCADTKHGALGSPLRLEGCVR-GRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKY 549          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q6WV16|GALT6_DROME (N-acetylgalactosaminyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=Pgant6 PE=1 SV=2)

HSP 1 Score: 316.62 bits (810), Expect = 8.808e-98
Identity = 194/477 (40.67%), Postives = 291/477 (61.01%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDIND-TDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-------DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQC-NQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYR--NSSETLMLSQCDLMNPNQKWEYNSTSHQITN 1617
            D E+ R+L       KRM+    FN +   + +S+ R++ +++   C+   +   LP+VS+II FY+     LM++   L+ RSP  L+KEI+++DD++D   +  ++  YI+++F  VRVV   +R GLI AR  GA+ A  +VL+F+DSH      WLPPLLEPI  N +T  CPFID+ D T+    +QDEGARGAFDW F Y RLP L  +   P DPF +PIM G +FAI+R++FWELGGYDEGL+IWGGEQ+ELSFKIWMCGG M + PCSRI  I++   +        D++H      KNYKR+AE+WMD +K ++Y      Y S D GD+++QK ++ KLNCKSF WFME VA+D++  YPP+        ++    + ++C+D+  RK+ +++G+  C + I   ++ +    S+  D  +R  ++  C D +  +++  + L  C     NQ W Y+    Q+ +
Sbjct:  153 DDESQRDLE------KRMSLENGFN-ALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLH------KNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLR--RKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKH 614          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q925R7|GLT10_RAT (Polypeptide N-acetylgalactosaminyltransferase 10 OS=Rattus norvegicus OX=10116 GN=Galnt10 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 9.473e-98
Identity = 189/453 (41.72%), Postives = 273/453 (60.26%), Query Frame = 1
Query:  265 KRMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY 1590
            +R++   R N  N +  +K+SL R++ +++   C    + +TLP+ SIII F++  W +L++T   +L RSP  L+ EI+++DD +D   ++  +  Y++  F +VR++   KREGLI+ R+LGA  A G V+ F+DSHC   V WLPPLL+ I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP DPF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD+  QKKL+  LNCKSF WFM  +A+D+   YPP+         I       +C D+K+   G  + ++ C + GR E   N  Q F+FT   +IRPG     +  CFD  + +  + L  C  M  NQ W+Y
Sbjct:  102 ERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMAL-FPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPAGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVVAQKKLRGSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIR-NVGTGLCTDTKHGTLGSPLRLETCIR-GRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKY 549          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A1I8GGZ3 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011947g5 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 5.601e-118
Identity = 196/451 (43.46%), Postives = 290/451 (64.30%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSS--ETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N+   +K+SL+R++ +++ + C+  R+ + LP+ SIII F++  W TL++T    + R+PR L+KE++++DD +  + +   +  Y+S +FTNVRV+   KREGLI+ R+ GA+ A G VL+F+DSHC   + WLPPLL PI  NYKTV CPFID+ D +T  Y +QDEGARGAFDW F Y RLP L  +   P  PFD+P+M G +FAI+ KWFWELGGYD GL+IWGGEQ+ELSFKIW CGGRMV+  CSRI  +++    F        I +NY+R+AE+WMD + ++IY R    Y S   GD++ Q++++++L+CK F WFM NVA+D+   YPP+      +  I   +D S+C+D++++      G+ +C + G    + EQ F FT   +I P  R  CFD    +    ++L QC     NQ W+ N  + Q+ ++ S+ C+
Sbjct:  116 NALVSDKMSLFRSLADIRHSACQGERYRRGLPTASIIIPFHEEHWSTLLRTVVSCIHRAPRHLVKEVILVDDFSKKSFLGDPLEKYVSAHFTNVRVLRNAKREGLIRTRIFGARNATGDVLIFLDSHCECNINWLPPLLHPIANNYKTVVCPFIDVIDFNTFAYRAQDEGARGAFDWEFYYKRLPLLPEDLKHPSKPFDSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGRMVDTGCSRIGHVYRKYAPFPNPGVGDFIGRNYRRVAEVWMDEYAEYIYNRR-PHYKSIPAGDLTSQREIRERLHCKPFKWFMTNVAFDLPLRYPPVEPPSAASGEIRSAADASLCIDTRFKGGMQSFGLAKCIK-GGGGLSGEQNFIFTFRKDIHPADRAFCFDVSQHAVKAPVILYQCHYQKGNQHWKINPNTGQLYHVASRLCL 564          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A267EH10 (Polypeptide N-acetylgalactosaminyltransferase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011947g1 PE=3 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 6.438e-118
Identity = 196/451 (43.46%), Postives = 290/451 (64.30%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSS--ETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N+   +K+SL+R++ +++ + C+  R+ + LP+ SIII F++  W TL++T    + R+PR L+KE++++DD +  + +   +  Y+S +FTNVRV+   KREGLI+ R+ GA+ A G VL+F+DSHC   + WLPPLL PI  NYKTV CPFID+ D +T  Y +QDEGARGAFDW F Y RLP L  +   P  PFD+P+M G +FAI+ KWFWELGGYD GL+IWGGEQ+ELSFKIW CGGRMV+  CSRI  +++    F        I +NY+R+AE+WMD + ++IY R    Y S   GD++ Q++++++L+CK F WFM NVA+D+   YPP+      +  I   +D S+C+D++++      G+ +C + G    + EQ F FT   +I P  R  CFD    +    ++L QC     NQ W+ N  + Q+ ++ S+ C+
Sbjct:  116 NALVSDKMSLFRSLADIRHSACQGERYRRGLPTASIIIPFHEEHWSTLLRTVVSCIHRAPRHLVKEVILVDDFSKKSFLGDPLEKYVSAHFTNVRVLRNAKREGLIRTRIFGARNATGDVLIFLDSHCECNINWLPPLLHPIANNYKTVVCPFIDVIDFNTFAYRAQDEGARGAFDWEFYYKRLPLLPEDLKHPSKPFDSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGRMVDTGCSRIGHVYRKYAPFPNPGVGDFIGRNYRRVAEVWMDEYAEYIYNRR-PHYKSIPAGDLTSQREIRERLHCKPFKWFMTNVAFDLPLRYPPVEPPSAASGEIRSAADASLCIDTRFKGGMQSFGLAKCIK-GGGGLSGEQNFIFTFRKDIHPADRAFCFDVSQHAVKAPVILYQCHYQKGNQHWKINPNTGQLYHVASRLCL 564          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A210PT88 (Polypeptide N-acetylgalactosaminyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12281 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.859e-117
Identity = 207/481 (43.04%), Postives = 311/481 (64.66%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCND 1728
            N+F  +K+SL R++ +++   CK  ++   LP+ S+I+ F++  W TL++    +L R+P+ ++ EI++ DD ++    +  ++ Y+ ++F NVRVV   +REGLI+ R++GAK A G+VL+F+DSH    + WLPPLLEPI E+YKTV CPFID+ D +T  Y +QDEGARGAFDW F Y RLP L  +   P +PF++P+M G +FAI+ KWFWELGGYD GL+IWGGEQ+ELSFK+W CGG+MV+ PCSRI  I++    F        + +NY+R+AE+WMD + +++Y  H   Y + D GDIS QK ++ KLNCK F WFME VA+D+   YPP+         I    D ++C+D++Y+ Q +R  ++ C + G+     EQ F F+   +IRPG+R++CFD   S     ++L  C  M  NQ+++YN  + QI ++ S +C+  ++ S  L  N C  +   Q+W IQ  N+
Sbjct:  115 NAFASDKISLQRSLKDIRHADCKSKKYLNHLPNASVIVPFHNEHWTTLLRLCYSVLNRAPKGMVHEIILADDFSNKEHCKKPLDDYLKEHFDNVRVVRAKQREGLIRTRIMGAKAATGQVLIFLDSHVEANINWLPPLLEPIAEDYKTVVCPFIDVIDFETFAYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPAEPFNSPVMAGGLFAISTKWFWELGGYDPGLDIWGGEQYELSFKLWQCGGKMVDAPCSRIGHIYRKFAPFPNPGVGDFVGRNYRRVAEVWMDEYAEYLYN-HRPHYRNIDTGDISAQKAIRTKLNCKPFKWFMEKVAFDLPKFYPPVEPPPFAKGEIR-NVDANLCIDTRYKGQNERFQLEPCLKDGKG--GGEQEFQFSWHKDIRPGKRSVCFDVSQSIKKSPIILFNCHGMGGNQRFKYNLDTSQIYHVISNQCLDCDAGSHELFTNPCDKNLKSQQWKIQTVNE 591          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2C9JLV6 (Polypeptide N-acetylgalactosaminyltransferase OS=Biomphalaria glabrata OX=6526 GN=106059417 PE=3 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 8.524e-117
Identity = 209/486 (43.00%), Postives = 314/486 (64.61%), Query Frame = 1
Query:  190 EHKLENHGLSDQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSE--TLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            E +L+  G  +Q +   LS  + + K +       N+   +K+SL R+I +++   CK  ++ K LP+ S I+ F++    TL+++   ++ R+P+ L+KEI++ DD+++ ++ +  ++ Y+ ++FTNV++V   KREGLI+ RLLGA+ A G+VL+F+DSH    + +LPPLLEPI +NY+TV CPFID+ D +   Y +QDEGARGAFDW F Y RLP L  +K  P +PF NP+M G +FAI+++WFWELGGYD GL+IWGGEQ+ELSFKIW CGG MV+ PCSRI  I++    F        + +NYKR+AE+WMD + ++IY  H   Y S D GD++ QK ++QKLNCK F WFME VA+D++  YPP+        +I   + D +C+D+K++ QGD   ++ C     + + KEQ+F  T   +IRP  R LCFD   S    +++L  C  M  NQ+++YN  ++QI +  S  C+
Sbjct:   76 EEELKRQGPGEQGSAFKLSPEDELQKNLLYRSNGFNALVSDKISLQRSIKDIRHPHCKSKQYVKFLPTASFILPFHNEHLSTLLRSVYSIINRAPKELVKEIILTDDHSNKDECKKPLDDYVKEHFTNVKIVRAEKREGLIRTRLLGARHATGEVLIFLDSHIECNINFLPPLLEPIAQNYRTVVCPFIDVIDYENFEYRAQDEGARGAFDWEFYYKRLPLLEEDKKKPSEPFANPVMAGGLFAISKEWFWELGGYDPGLDIWGGEQYELSFKIWQCGGTMVDAPCSRIGHIYRKFAPFSNPGVGDFLGRNYKRVAEVWMDEYAEYIYS-HRPHYRSLDAGDLTSQKAIRQKLNCKPFKWFMEEVAFDLVKFYPPVEPPAMAKGTIRNMAID-LCIDTKFKSQGDTFSVETCAD--STARAKEQQFELTWHKDIRPQGRLLCFDVSESKPRTSVILFSCHGMQGNQRFKYNVDTNQIFHPISGLCM 557          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: K1PQC0 (Polypeptide N-acetylgalactosaminyltransferase OS=Crassostrea gigas OX=29159 GN=CGI_10011801 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 3.859e-116
Identity = 197/451 (43.68%), Postives = 301/451 (66.74%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N++  +K+SL+R++ +++ + CK  ++   L + S+I+ F++  W TL++T   +L RSP+ LI E++++DD +     +  ++ Y+ ++FTNV+VV   KREGLI+ RLLGA+ A G+VL+F+DSHC   + WLPPLLEPI E+YKTV CPFID+ D +   Y +QDEGARGAFDW F Y RLP L  +   P +PF +P+M G +FAI+ KWFWE+GGYD GL+IWGGEQ+ELSFK+W CGG MV+ PCSRI  I++    F        + +NY+R+AE+WMD + +++Y+R    Y + D GD+S+QK ++ KL+CK F WFME VA+D+   YPP+      +  +  ++ + +C+D++Y+ Q +R  +  C + G+     EQ+F FT   +IRPG+R +CFD   S     ++L  C  M  NQ+++YN  + QI ++ S +C+
Sbjct:   40 NAYASDKISLHRSLKDIRHSDCKKKKYLNHLMNASVIVPFHNEHWSTLLRTAWSVLNRSPKHLIHEVILVDDYSSKEHCKQPLDDYVKEHFTNVKVVRAKKREGLIRTRLLGARAATGQVLIFLDSHCEANINWLPPLLEPIAEDYKTVVCPFIDVIDFENFAYRAQDEGARGAFDWEFFYKRLPLLEEDLKHPAEPFKSPVMAGGLFAISAKWFWEMGGYDPGLDIWGGEQYELSFKLWQCGGMMVDAPCSRIGHIYRKFAPFPNPGVGDFVGRNYRRVAEVWMDEYAEYLYKRR-PHYRNIDPGDVSEQKAIRDKLHCKPFKWFMEEVAFDLPKFYPPVEPPPFASGEVRNKAAN-MCLDTRYKGQNERFDLQPCLKDGKG--GGEQQFEFTWHKDIRPGKRTVCFDVSQSIKKAPVILFNCHGMGGNQRFKYNIDTQQIYHVISNQCL 486          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:HGNC Symbol;Acc:HGNC:19873])

HSP 1 Score: 301.597 bits (771), Expect = 7.249e-95
Identity = 195/500 (39.00%), Postives = 295/500 (59.00%), Query Frame = 1
Query:  268 RMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            R++   R N  N +   ++SL R++ +++   CK   +++ LP+ SIII F++  W +L++T   +L RSP  LI EI+++DD +D   +++ +  Y+ +    VR++   KREGLI+ RLLGA  AKG+V+ F+DSHC   V WLPPLL+ I +N K + CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + ++IYQR   EY     GD++ QK+L+ +LNCK+F WFM +VA+D+   YPP+         +       +C++SK+   G  + ++ C + GR E   +  Q F+F    +IR G     + +CFD  + +  + L  C  M  NQ W Y    +  H I+N     CI  N     + +N+C  S   Q+W+ +  N
Sbjct:    6 RVDQAYRENGFNIYVSNRISLNRSLPDIRHPNCKLKLYSERLPNTSIIIPFHNEGWSSLLRTVHSILNRSPPELIAEIILVDDFSDREHLKASLEDYMVR-MPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANVNWLPPLLDRIAQNRKAIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKDDPSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPGGVSLARNLKRVAEVWMDEYAEYIYQRR-PEYRHLSAGDVTTQKELRARLNCKNFKWFMTDVAWDLPKHYPPVEPPAAAWGELR-NVGSGLCMESKHFSSGTPLRMEVCVK-GRGETAWSHGQVFTFGWREDIRVGDPLHTKKVCFDAISHNSPVTLYDCHGMKGNQLWRYRKDKTLYHPISN----SCIDHNPNEKRVFMNSCDASIATQQWVFERTN 496          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: si:ch211-15e22.3 (polypeptide N-acetylgalactosaminyltransferase like 6 [Source:NCBI gene;Acc:103040570])

HSP 1 Score: 303.908 bits (777), Expect = 9.933e-95
Identity = 190/485 (39.18%), Postives = 286/485 (58.97%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK-NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            N +    ++L R++ +++   CK   + + LP+ SIII F++  W +L++T   ++ R+P  LI EI+++DD +D + + +++  Y+S+ F  VR+V   KREGLI+ RLLGA +AKG+VL F+DSHC   + WLPPLL+ I +N +T+ CP ID+ D +   Y    G   RGAFDW   Y R+P  L    +DP +P+++P+M G +FA+ R+WFWELGGYD GLEIWGGEQ+E+SFK+WMCGG M +VPCSR+  I++    +  +     + +N KR+AE WMD + ++IYQR   EY     GD++ QK+L++ L CK F W+M  VA+D+   YPP+         I   +   +CVDSK+   G  + +D C + G       EQ F+F    +IRPG     R  CFD  + S  + L  C  M  NQ W Y      + ++ S  C+  +     + +N C+  S  Q+W+ Q  N
Sbjct:  108 NIYVSNNIALDRSLPDIRHPNCKQKLYLENLPNTSIIIPFHNEGWSSLLRTIHSIVNRTPDHLIAEIILVDDYSDRDHLGARLEDYMSR-FPKVRIVRTKKREGLIRTRLLGASVAKGEVLTFLDSHCETNINWLPPLLDQIAQNPRTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPLELQGSDPSNPYESPVMAGGLFAVRRQWFWELGGYDTGLEIWGGEQYEISFKVWMCGGSMYDVPCSRVGHIYRKYVPYK-VPSGTSLARNLKRVAETWMDEFAEYIYQRR-PEYRHLSTGDLTAQKELRKHLKCKDFKWYMNTVAWDLPKYYPPVEPLPAAWGEIR-NAASGLCVDSKHGSTGTELRLDTCLKEGAERTWAHEQIFTFGWREDIRPGDPLHTRKFCFDAISQSSPVTLYDCHGMRGNQHWSYRKDK-SLYHLVSSGCMDCSPADKRIFMNKCNPQSETQQWLFQRVN 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 239.195 bits (609), Expect = 1.380e-70
Identity = 161/465 (34.62%), Postives = 261/465 (56.13%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP  S++I F++  W TL++T   ++ RSPR L++E++++DD ++ + ++ K+  Y+ K    VR+V   +R GLI+ARL GA L+ G+V+ F+D+HC   + WL PLL  IK++ KTV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDI+ +  L+QKL CK F W++ENV  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G +     Q FS+T++ EIR    +LC D    +  +M+ +C  +  NQ W+Y+     + ++ S +C+
Sbjct:   73 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKNKVYPDDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMGGN-----QVFSYTANKEIR--TDDLCLDVSKLNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCL 522          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 233.032 bits (593), Expect = 3.211e-68
Identity = 162/479 (33.82%), Postives = 258/479 (53.86%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            DQE ++ L  IN             N    + ++L R++ ++++  CK   +   LP+ SI+I F++  W TL++T   ++ RSPR L+ EIL++DD ++ + ++ K+  Y+      VR++   +R GLI+ARL GA   +G+V+ F+D+HC   V WL PLL  IKE+ K V CP ID+   +T  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y          D GD+S +K L++ L CK F W++EN+  D        ++ E  N       + + CVD+  RK+ ++VG   C+ +G       Q FS+T+D EIR    +LC D    +  +++ +C  M  NQ +EY++      +I +Q C+
Sbjct:   70 DQEKMKELFKINQF-----------NLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIIS-PGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNV------ETNQCVDNMGRKENEKVGFFNCHGMG-----GNQVFSYTADKEIR--TDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCL 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 232.261 bits (591), Expect = 4.385e-68
Identity = 161/479 (33.61%), Postives = 259/479 (54.07%), Query Frame = 1
Query:  220 DQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            DQE ++ L  IN             N    + ++L R++ ++++  CK   +   LP+ SI+I F++  W TL++T   ++ RSPR L+ EIL++DD ++ + ++ K+  Y+      VR++   +R GLI+ARL GA   +G+V+ F+D+HC   V WL PLL  IKE+ K V CP ID+   +T  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y          D GD+S +K L++ L CK F W++EN+  D        ++ E  N       + + CVD+  RK+ ++VG   C+ +G       Q FS+T+D EIR    +LC D    +  +++ +C  M  NQ +EY++    + ++ S +C+
Sbjct:   70 DQEKMKELFKINQF-----------NLMASDMIALNRSLPDVRLDGCKTKVYPDDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIIS-PGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNV------ETNQCVDNMGRKENEKVGFFNCHGMG-----GNQVFSYTADKEIR--TDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCL 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 1.662e-64
Identity = 149/427 (34.89%), Postives = 238/427 (55.74%), Query Frame = 1
Query:  358 CKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSE---KLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQI 1611
            CK   +   LP  S++I F++  W TL++T   ++ RSPR +++EI+++DD ++ + ++S +  Y SK    V +V    R GLI+ARL GA +++G+V+ F+D+HC     WL PLL  IK + K V CP ID+   +T  Y +  +   G F+W  N+   P     +   K D   P  +P M G +FAI R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMDN+K F Y       +  + GD+S++K L+ +L CK F WF+ENV       YP   +      L     +E++   C+D+  RK+ +++GI  C+ +G       Q FS+T+D E+R    +LC D    +  +++ +C  M  NQ W+Y+    ++
Sbjct:    1 CKTKVYPDGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIIS-PGVTKVEYGDVSQRKALRDRLKCKPFSWFLENV-------YPNSQIPRHYYSLGEVRNVETNQ--CLDNMGRKENEKIGIFNCHSMG-----GNQVFSYTADKELR--TDDLCLDVSRMNGPVLMLKCHHMKGNQLWDYDQQMQKL 410          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010805.1 (pep scaffold:Pmarinus_7.0:GL478309:9001:42806:-1 gene:ENSPMAG00000009786.1 transcript:ENSPMAT00000010805.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 2.603e-58
Identity = 130/376 (34.57%), Postives = 205/376 (54.52%), Query Frame = 1
Query:  529 MRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            ++  +  Y+ K  T VR++   +R GLI+ARL GA  A+G+V+ F+D+HC     WL PLL  IKE+ + V CP ID+   +T  Y +  +   G F+W  N+   P     +   K D   P   P M G +FAI R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  + GD+S +K L+++L C  F W++ENV  D        ++ E  N    +E++   C+D+  RK+ ++VGI  C+ +G       Q FS+T++ E+R    +LC D    S  +M+ +C  +  NQ W Y+     + ++ S +C+
Sbjct:    7 LKKPLEDYVRKLETPVRLLRMAQRSGLIRARLRGAAAAQGQVITFLDAHCEATTGWLEPLLARIKEDRRAVVCPVIDVISDETFEYLTGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFAIDRDYFQEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDEFKGFFYVIS-PGVTKVEYGDVSARKALRERLKCMPFSWYLENVYPDSQIPRHYYSLGEIRN----METNQ--CLDNMGRKENEKVGIFNCHGMG-----GNQVFSYTAEQELR--SDDLCLDVSRLSGPVMMLKCHHLKGNQLWHYDREKMTLRHVNSNQCL 368          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt12 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 12 [Source:ZFIN;Acc:ZDB-GENE-060503-704])

HSP 1 Score: 201.445 bits (511), Expect = 1.522e-57
Identity = 160/467 (34.26%), Postives = 246/467 (52.68%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHN-KTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGAR--GAFDWN--FNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSI---CVD----SKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRN--LCFDYRNSSETLMLSQCDLMNP----NQKWEYNSTSHQITNIPSQKCI 1638
            N +  +++SL+R + E     C+  ++N + LP+ S++I FY+  W TL++T   +L  SP  L+ EI+++DD +D   +R ++  YI+     VR+V   KREGL++ARLLGA +A G VL F+D HC   V WL PLLE I E    V CP ID+ + +T  Y  + G    G FDW   F +  +P      +  P D   +P M G +FA+++K+F  LG YD G+E+WGGE  E SF+IW CGG +   PCS +  +F     +       K   N  R AE+WMD +K+  Y R+         GD+++++ L+++L CK+F WF+ENV       YP I V E       +  +  +   C D     + +  G R+ +  C+ +G++     Q F +TS+ EIR   R    C    N  + L +  C   N     NQK+++      I +I +QKC+
Sbjct:   56 NIYVSDRISLHRQLPEKWNPLCREKKYNYRQLPTTSVVIAFYNEAWSTLLRTVHSVLETSPDALLNEIILVDDYSDREHLRDRLEQYIA-TLRKVRLVRARKREGLVRARLLGAGVATGDVLTFLDCHCECHVGWLEPLLERIAEEESAVVCPVIDVIEWNTFEYMGNAGEPQIGGFDWRLVFTWHTVPGHEQKRRKSPIDVIRSPTMAGGLFAVSKKYFDYLGTYDTGMEVWGGENLEFSFRIWQCGGTLEVHPCSHVGHVFPKQAPY----SRSKALANSVRAAEVWMDGYKELYYHRNPHARME-PFGDVTERRNLRERLQCKTFKWFLENV-------YPDIHVPEDRPGKFGMLKNRGLSNYCFDYNPPDENQVTGQRIILYGCHGMGQN-----QFFEYTSEQEIRYNTRQPEACAAVDNGMDYLTMYYCHSKNSPVTENQKFDFREDG-SIFHILTQKCL 503          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 198.749 bits (504), Expect = 1.030e-56
Identity = 130/347 (37.46%), Postives = 202/347 (58.21%), Query Frame = 1
Query:  313 KVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN-VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPED---PFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYP--PITVSEKLN 1335
            ++  +RTI + +  +C    +   LP+ S++I FY+     L++T   +  R+P  L+ E+L++DD +D  D+R  +   + + F   V++V   KREGLI+ R++GA  A G VLVF+DSHC V V WL PLL  + EN  TV CP IDI + DT LYS     RG F+W  ++   P   +  + P+    P  +P M G +FA+ RK+F +LG YD G++IWGGE  E+SF+IWMCGG +  +PCSRI  IF+    +        + +N  R+A +W+D +K+  Y     E    + GD+S++K L+++L C+ F W+++NV  +I    P  P  V  K++
Sbjct:   28 RLDPHRTIPDTRHPRCATKSYPAQLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKVKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLYSASPLVRGGFNWGLHFRWDPVPSSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAGADTMSRNSLRLAHVWLDEYKEQ-YLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPEIEVGRPQLPQAVLSKMH 373          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 189.889 bits (481), Expect = 5.913e-53
Identity = 148/438 (33.79%), Postives = 240/438 (54.79%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHN-KTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDT-SLYSQ-DEGARGAFDW--NFNYTRLPRLHNNKTDPE-DPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHL----EEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSE---KLNCSITLESDDSICVD---SKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIR-PGQRNLCFDYRNSSETLMLSQC 1557
            N +  +++SL+R I + ++ +CK  + + + LP+ S++I FY+  W TL++T   +L  SP  L++EI+++DD +D   ++S +  YIS     VR+V  T+REGL++ARLLGA  A G+VL F+D HC     W+ PLL+ I E    V CP ID  D +T   Y Q  E A G FDW   F +  +P    ++     +P  +P M G +FA+++K+F  +G YD+G+E+WGGE  ELSF++W CGG +   PCS +  +F     +       +  +N  R AE+WMD++K+  Y R+     E+Y     GD+S++K L++KL CKSF+W+++N+       YP + V E     + +I  +   S C+D         G  + +  C+  G       Q F +T+  ++R      LC + R+    + +  C
Sbjct:  108 NIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYIS-TLERVRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRASRIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPY----PRPRFLQNTVRAAEVWMDSYKEHFYNRNPPGRKEKY-----GDLSERKTLREKLGCKSFEWYLKNI-------YPDLHVPEDRPGFHGAIQNKGIQSECIDYNAPDNNPTGAMLSLYPCHGQG-----GNQFFEYTTRKDLRFNSATELCAEVRDGKPQVAMRHC 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO31035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ28])

HSP 1 Score: 242.276 bits (617), Expect = 2.196e-73
Identity = 165/445 (37.08%), Postives = 255/445 (57.30%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYS-QDEGARGAFDWNFNYTRL---PRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKL-NCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQ 1608
            N F  +++SL RTI++ +   CK   +   LP  S++I F++  W TLM+T   +LLRSP  +++EI+++DD ++ + ++ K++ Y +K    +++V   +R GLIKAR++GA  A G+V++F+D+HC     WLPPLLE I  N +T  CP ID  D  T  Y   D   RG F+W F+Y      P     + DP     +P+M G +FAI R++F ELG YD G+ IWGGEQ+E+SFK+W CGG++ N+PCSR+  +++    + +   D  +  N++R+AE+WMD +K ++Y +   E  S D GDIS +  L+++L CKSF W++ENVA D        TV  KL  C        ++C+DS  RK G  VG+  C+ +G +     Q F +T   E+R  +   CFD   S     +    C  M  NQ++ +     +
Sbjct:   29 NQFVSDQISLERTISDTRHQACKQRSYPINLPKASVVIVFHNEGWSTLMRTVHTVLLRSPPHMLQEIVMVDDFSNKDFLKQKLDDY-TKKLGKIKIVRTKERVGLIKARVIGANNAVGEVVIFLDAHCECNKGWLPPLLERIALNRRTAVCPTIDFIDHKTFQYKPMDPYIRGTFNWRFDYKERAVRPEEMAKRRDPTQEVKSPVMAGGLFAINREFFSELGQYDPGMFIWGGEQYEISFKLWQCGGQLENIPCSRVGHVYRHHVPYTYPKHDATL-VNFRRVAEVWMDEYKDWLYDKR-PEIKSVDYGDISDRIALRKRLKCKSFKWYLENVAND--------TVKTKLCACFQVRNQGKNMCLDSMGRKDG-HVGLASCHNMGGN-----QAFQYTYIRELRTDE--TCFDVHESFPGAKVHFFPCHEMKGNQEFLFTEVGRR 454          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO34355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN9])

HSP 1 Score: 233.032 bits (593), Expect = 3.291e-69
Identity = 160/471 (33.97%), Postives = 260/471 (55.20%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPED---PFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQ-RHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENV-------------AYDILYLYPPITVSEKLNCSITLES--DDSICVDSKYRKQGDRVG--IDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRN--SSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N     ++SL+RTI + +   C+   + K LP  SI+I FY+  W  L++T   +L R+P + + EI+++DD ++  +++SK++ Y+S     +R+V   KREGLI+ R++GA+ A G+VLVF+DSHC V + WL PLL+ I ++ K V CP ID+  +DT  YS     RG F+W  ++T  P   +    PED   P  +P M G +FA+ R++F +LG YD G++IWG E  E+SF+IWMCGG +  +PCSR+  +F+    +        + +N  R+AE+W+D +KK+ YQ RH  E   F  GDIS++ KL++ L CKSF+W+++N+             A+  +   P + + +     I L++  DD  C+DS       +    I QC      E  K + +S   D E++  +  LC +     S   L L +C      Q+W++ +    + +  +  C+
Sbjct:   24 NLLISNRLSLHRTIKDTRHELCRGKTYPKNLPVASIVICFYNEAWTILLRTIHSVLDRTPHQFLHEIILVDDFSNMLELKSKLDRYLS-TMPKIRIVRNNKREGLIRGRIIGAEAATGQVLVFLDSHCEVNINWLQPLLQHIHDDQKAVACPVIDVISSDTFEYSSSPMVRGGFNWGLHFTWEPIPPSLLVKPEDYVKPIRSPTMAGGLFAVDREYFTQLGKYDSGMDIWGAENLEISFRIWMCGGSLDILPCSRVGHLFRRFRPYGSDSKGDTMSRNSMRLAEVWLDGYKKYFYQIRHDLEGKKF--GDISQRIKLRKSLQCKSFEWYLKNIYPELKPPGQPGGGAFYPIDRRPQVVIWKGKVICIQLQTSFDDGYCLDSPGHPSEKKASAVIHQC------ESTKSRFWSLNEDGELKI-ESLLCLEASGYQSKLGLRLMKCHAQGGGQQWKFLNKKSVLYHPATGLCL 484          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 217.238 bits (552), Expect = 2.045e-63
Identity = 153/459 (33.33%), Postives = 254/459 (55.34%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLR--HNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDE--GARGAFDWN--FNYTRLPRLHNNK-TDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYS-FDFIHD-DIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N    +++SL R + +++  KCK     + + LP+ S+II F++     L++T   +L  SP RLI +I+++DD ++ +D++  +  +IS     V+++    R+GL+ ARL GA+ A+G+VL F+DSHC     WL PLL  I E+ + V CP I++ + D   Y   +    RG F W+  F +  +P     +  D  D   +P M G +FAI +K+F++LG YD  +EIWGGE  E+SF+IWMCGG++  VPCSR+  +F+   S + F       + +N+ R+AE+WMD +K   Y++  EE  + D GDIS +  L+++L CKSF W+++N+  D+    PP +    L        + S+C+D+   K   RVG+  C+ +G +     Q F+ T   EI     + C D  N      + +  C  +  NQ+W++N     I ++ ++ C+
Sbjct:   29 NVMLSDRISLDRRLKDVRGPKCKRKHKLYPRALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISM-LNKVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRYQASDVIHERGGFTWDLFFTWKAIPEAEKKRRKDETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSY---LYSHQIRNKESSLCLDTLGEKNIKRVGLYTCHGMGGN-----QFFTLTKSNEILFND-DKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCL 477          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 212.231 bits (539), Expect = 1.722e-61
Identity = 168/508 (33.07%), Postives = 272/508 (53.54%), Query Frame = 1
Query:  184 KNEHKLENHG----LSDQENIRNLSNINLMMKRMNSTRRFNNSFE---EEKVSLYRTINELKITKCKWLRHN---KTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGA--RGAFDWN--FNYTRLPRLHNN-KTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK--IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILY--LYPPITVSEKLNCSITLESDDSICVDSKYRK--QGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            +N H+L   G    L  +EN           K++      N+SF     +K+SL RT+++++  +CK  +HN     LP+ S+II F+      L++T   ++ R+P  L+ E++++DD + +  +   ++ ++++ FT V+V+   KREGL++ARL GA  AKG VL F+DSHC     W  PLL  I  + + V CP I++ + DT  Y     A  RG F W+  F +  +P      + D  DP   P M G +F+I R++F+++G YDE ++IWGGE  ELSF++WMCGGR+  V CSR+  +F+   S     D ++  + KN+ R+AE+WMD +K   Y +  +  +S D GDISK+ +L+++L CKSF W++ N+  D+    L PP    E  N S       + C+DS   K     RVGI  C+  G ++ +K        + E        CFD   +     + L +C  M  NQ+W+++     + +  +Q+C+
Sbjct:    2 RNTHQLGGGGKPAFLESEEN-----------KKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCK-AKHNTYPAKLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQ-FTKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDDSDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNS-DYGDISKRLELRKRLKCKSFKWYINNIYPDVQMPELDPPAR-GEVRNPS------SNQCLDSLGAKPEHNARVGIYTCHGQGGNQVSKYMPRELIFEEEN-------CFDVSKTHPGAPVELMKCHGMRGNQEWKHDREKGTLMHFTTQQCL 481          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 204.912 bits (520), Expect = 7.556e-60
Identity = 145/394 (36.80%), Postives = 227/394 (57.61%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXX---XXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGA--RGAFDW--NFNYTRLPRLHNNKTDPE-DPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILY--LYPPITVSEKLNCSITLESDDSICVDSKYRKQ-GDRVGIDQCNQIGRSE 1443
            N     KV+L R+I + +   C  L +   LP+ S+II F++  W TL++T   +L RSP  L++EI+++           + SK+ +YIS+ FT V+++   KREGLI+ARL+GAK AKG+VLVF+DSHC   + WL PLL  I EN   V  P I++ D  T  Y+ + GA  RG F+W   F +  +P     +   + DP  +P M G +FAI + +F+E+G YD  +  WGGE  E+SF+IWMCGG +  +PCS++  +F++   +     +  I +N  R+AE+WMD++KK  Y     +    D GD+S +K L+++L CKSF W+++NV  ++    LY PI   E  N         + C+D+  + + G   G+  C+ +G ++
Sbjct:   16 NELASSKVALDRSIPDNRPQSCLSLSYPTKLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYISQ-FTKVQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGANNRGIFNWELTFKWRGIPEYERRRRKSDSDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHVFRESQPYKI--GEGAIDRNNMRLAEVWMDDYKKIFYAMR-PQLKGKDYGDVSGRKALRERLMCKSFKWYLDNVISELAIPDLY-PIGRGEIRNLGT------NTCLDTLAKNEAGGEPGMYMCHGMGNNQ 398          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101171188])

HSP 1 Score: 306.605 bits (784), Expect = 1.033e-95
Identity = 194/500 (38.80%), Postives = 298/500 (59.60%), Query Frame = 1
Query:  268 RMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLP-RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKN--KEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            R++   R N  N F  +++SL R++ +++   CK   + + LP+ SIII F++  W +L++T   +L RSP +LI EI+++DD +D + ++  +  Y+ +    VR++   KREGLI+ RLLGA  AKG+V+ F+DSHC   + WLPPLL+ I  N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P      K DP +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   + + +N KR+AE+WMD + +++YQR   EY     GD++ QK+L+  LNCKSF WFM+ VA+D+   YPP+         +   +   +C++SK+   G  + ++ C + GR++ +    Q F+F    +IR G     + +CFD  +    + L  C  M  NQ W Y    S  H ++N     C+  N+    + +N C+ +S  Q+W+ +  N
Sbjct:  102 RVDQAYRENGFNIFVSDRISLNRSVPDIRHPNCKQKLYAERLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPQLIAEIILVDDFSDKDHLKGALEEYMVR-LPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANINWLPPLLDRIALNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPAELQKNDPSEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPGGVSLARNLKRVAEVWMDEYAEYVYQRR-PEYRHLSAGDVAAQKELRSTLNCKSFKWFMKEVAWDLPKHYPPVEPPAAAWGEVR-SAASGLCLESKHFVSGTPIRLESCVK-GRADVSWGHGQVFTFGWREDIRVGDPMHTKKVCFDAVSHHSPVTLYDCHGMRGNQLWRYRKDKSLYHPVSN----SCVDSNASERRVFMNVCNPASASQQWLFEKTN 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: GALNT10 (polypeptide N-acetylgalactosaminyltransferase 10 [Source:NCBI gene;Acc:101160340])

HSP 1 Score: 305.834 bits (782), Expect = 2.112e-95
Identity = 197/502 (39.24%), Postives = 295/502 (58.76%), Query Frame = 1
Query:  268 RMNSTRRFN--NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEG--ARGAFDWNFNYTRLPRLHNNKTD-PEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEK--NKEQRFSFTSDFEIRPGQ----RNLCFDYRNSSETLMLSQCDLMNPNQKWEY---NSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCNDN 1731
            R++   R N  N +   ++SL R++ +++   C+   + + LP+ +III F++  W +L++T   ++ RSP RL+ EI+++DD +D   ++  +  Y+ K F  VR++   KREGLI+ RLLGA  AKG+V+ F+DSHC   V WLPPLL+ I +N KT+ CP ID+ D D   Y    G   RGAFDW   Y R+P     +TD P +PF++P+M G +FA+ RKWFWELGGYD GLEIWGGEQ+E+SFK+WMCGGRM ++PCSR+  I++    +  +   I + KN KR+AE+WMD + +++YQR   EY     GD+S QK+L+  LNCK+F WFME VA+D+   YPP+         I       +C++ K+   G  + ++ C + GR +   +  Q  +F    +IR G     R +CFD  +    + L  C  M  NQ W Y    S  H ++N     CI  ++    + +N C  +S  Q+W+ +  ND 
Sbjct:  101 RVDQAYRENGFNIYVSNRISLNRSLPDIRHENCRQKLYAEKLPNTTIIIPFHNEGWSSLLRTVHSVINRSPPRLVAEIILVDDFSDKEHLKVALEEYM-KRFPKVRILRTKKREGLIRTRLLGAGAAKGEVITFLDSHCEANVNWLPPLLDRIVQNRKTIVCPMIDVIDHDNFGYDTQAGDAMRGAFDWEMYYKRIPIPAEMRTDDPTEPFESPVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYK-VPGGISLAKNLKRVAEVWMDEYAEYVYQRR-PEYRHLSAGDMSAQKELRSHLNCKNFRWFMEEVAWDLPKHYPPVEPPAAAWGEIR-SVGSGMCMEIKHFVSGSPIRLESCVK-GRGDVSWSHGQVLTFGWREDIRVGDPMHTRKVCFDAVSHHSPVTLYDCHGMKGNQLWRYRKDKSLFHPVSN----SCIDSSASERRVFMNTCDPTSLSQQWLFERTNDT 593          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 238.424 bits (607), Expect = 2.282e-70
Identity = 160/465 (34.41%), Postives = 260/465 (55.91%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP  S++I F++  W TL++T   ++ RSPR L++EI+++DD ++ + ++ ++  Y+ +    VRVV   +R GLI+ARL GA ++ G+V+ F+D+HC   + WL PLL  IK++ +TV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDIS +  L+QKL CK F W++EN+  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G       Q FS+T++ EIR    +LC D    +  +M+ +C  +  NQ WEY+     + ++ S +C+
Sbjct:   73 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMG-----GNQVFSYTANKEIR--TDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCL 522          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 238.424 bits (607), Expect = 2.282e-70
Identity = 160/465 (34.41%), Postives = 260/465 (55.91%), Query Frame = 1
Query:  262 MKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            MK M    +FN     E ++L R++ ++++  CK   +   LP  S++I F++  W TL++T   ++ RSPR L++EI+++DD ++ + ++ ++  Y+ +    VRVV   +R GLI+ARL GA ++ G+V+ F+D+HC   + WL PLL  IK++ +TV CP ID+   DT  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I R +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y       +  D GDIS +  L+QKL CK F W++EN+  D        ++ E  N       + + C+D+  RK+ ++VGI  C+ +G       Q FS+T++ EIR    +LC D    +  +M+ +C  +  NQ WEY+     + ++ S +C+
Sbjct:   73 MKEMFKINQFN-LMASEMIALNRSLPDVRLEGCKNKLYPDDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIIS-PGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSLGEIRNV------ETNQCLDNMARKENEKVGIFNCHGMG-----GNQVFSYTANKEIR--TDDLCLDVSKLNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCL 522          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 231.876 bits (590), Expect = 8.427e-68
Identity = 159/488 (32.58%), Postives = 259/488 (53.07%), Query Frame = 1
Query:  196 KLENHGLSDQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLP----RLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK-IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLES-DDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            K  N    DQE ++ L  IN             N    + ++L R++ ++++  CK   +   LP+ SI+I F++  W TL++T   ++ RSPR L+ EI+++DD ++ + ++ K+  Y+      V+++   +R GLI+ARL GA    G+V+ F+D+HC     WL PLL  IKE+   V CP ID+   +T  Y +  +   G F+W  N+   P     +   K D   P   P M G +F+I + +F E+G YD G++IWGGE  E+SF+IW CGG +  V CS +  +F+    + F     + I KN +R+AE+WMD +K F Y          D GD+S +K L++ L CK F W++EN+       YP   +  +      + + + + CVD+  RK+ ++VG   C+ +G       Q FS+T+D EIR    +LC D    +  +++ +C  M  NQ +EY++  H   +I +Q C+
Sbjct:   62 KAVNIAKDDQEKMKELFKINQF-----------NLMASDMIALNRSLPDVRLDGCKTKVYADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIIS-PGVMRVDYGDVSSRKALREALKCKPFAWYLENI-------YPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMG-----GNQVFSYTADKEIR--TDDLCLDVSRLNGPVVMLKCHHMKGNQMFEYDAEKHSFLHIITQSCL 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 539/543 (99.26%), Postives = 542/543 (99.82%), Query Frame = 1
Query:   88 MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQ 1716
            MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRM+STRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAY+SK+FTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITR WFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQ
Sbjct:    1 MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRMHSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQ 543          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000021519.1 (SMESG000021519.1)

HSP 1 Score: 920.613 bits (2378), Expect = 0.000e+0
Identity = 521/543 (95.95%), Postives = 524/543 (96.50%), Query Frame = 1
Query:   88 MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQ 1716
            MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRM+STRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAY+SK+FTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKT                  DEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITR WFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQ
Sbjct:    1 MNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLENHGLSDQENIRNLSNINLMMKRMHSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIIDDNADNNDMRSKMNAYVSKHFTNVRVVHKTKREGLIKARLLGAKLAKGKVLVFMDSHCTVGVKWLPPLLEPIKENYKT------------------DEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRNWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKWIIQ 525          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000027520.1 (SMESG000027520.1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.424e-142
Identity = 247/540 (45.74%), Postives = 350/540 (64.81%), Query Frame = 1
Query:  154 SSFQIQSALSKNEHKLE--NHGLSDQENIRN-----------LSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFID-INDTDTSLYSQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLN-CSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXX-XXXTMQKWIIQGCN 1725
            +S +I    S ++ K++  NH   D+EN R             +N N   K++  T  +N +   +K+S++R+I +L+I KCKWL+++  LP  SIII F++  W TL++T   +L RSP +L+KEI+++DDN+    +  K+  Y+S++FT VR++   KREGLI+ARLLGA  A G VL+F+DSHC VG+ WLPPLL+PI+++YKT++CPFID I+  D SL  QDEG RGAFDWNF+Y RLPRL  +   PE PF NPIM G +FAI++ WF ELGGYD GL++WGGEQ+ELSFK+WMCGG+MV+VPCSR+  +++    F  +     + +N+KRIAE+WMD+WK++IYQ+H + YSS D GD+++QKKL++ LNC SFDWFM+ +AYD+L  YP     E L+   I  E +  +C D      GD   I  C  +     + EQ  +FT + EI+P +R++C DY    E L +  C  M  NQKW YN  SHQI ++ S+KCI        L +N       + QKWI++  N
Sbjct:   48 TSDEINEVSSDSQIKIDWANHDTIDEENARVGPGEQGIGVYLTANENEKAKQLMETNGYN-ALASDKISVHRSIKDLRINKCKWLKYDNFLPPASIIIPFHNEHWSTLLRTVHSILHRSPDKLVKEIILVDDNSTKEFLGEKLEQYVSEHFTKVRILRTGKREGLIRARLLGANEANGTVLIFIDSHCEVGINWLPPLLQPIRDHYKTISCPFIDVISYNDFSLRPQDEGGRGAFDWNFDYKRLPRLSKDNAHPEKPFYNPIMAGGLFAISKLWFNELGGYDYGLDVWGGEQYELSFKVWMCGGKMVDVPCSRVGHVYRKFNPFAVVGLGNYLARNHKRIAEVWMDDWKQYIYQKHQKVYSSLDPGDLTEQKKLRKALNCTSFDWFMKQIAYDLLEKYPIQKQPENLSQGKIKSEINPHLCFDFNLGNPGDPFRISNCTDV-----SNEQNLAFTWEMEIKPQKRDICLDYPRKGEELTMFSCHGMGGNQKWIYNQNSHQIVHVVSKKCIDYRYNPESLEINIQKCSRKSSQKWILENMN 581          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000077709.1 (SMESG000077709.1)

HSP 1 Score: 347.821 bits (891), Expect = 1.012e-111
Identity = 196/457 (42.89%), Postives = 294/457 (64.33%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTN-VRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSF-DFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLY----PPITVSEKLNCSITLESDDSICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNS--SETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCI 1638
            N    +K++L R++ +++   CK + + K+LPSVSIII FY+  W TL++T    L+R+P+ L+KEI+++DD +    ++ K++ YI  NF   VRV+ + KREGLI+ RL GAK A G VL+F+DSHC   + WLPPLL+PI ++Y+TVTCPFID+ D DT  Y +QDEGARGAFDW F Y RLP L  +   P  PF +P+M G +FAI+RKWFWELGGYD GL+IWGGEQ+ELSFKIW CGG+M++ PCSRI  +++    F   ++    I +NYKR+AE+WMD ++K++Y+R    +   + GD++ Q  ++++L CKSF WFM  +A+D+   Y    PP +   ++   +     +S+C+D+K+ K   ++ +  C +   S    EQ+F  T   ++R   R+ C D   +     ++L  C     NQ W+Y   S Q+ ++ +QKC+
Sbjct:  102 NGLASDKMALNRSVKDIRHPDCKKMLYQKSLPSVSIIIPFYEEHWSTLLRTFISALIRAPKGLVKEIILVDDCSTKEFLKDKLDQYIENNFKGIVRVLRQDKREGLIRTRLKGAKNATGDVLIFLDSHCEANINWLPPLLDPIAQDYRTVTCPFIDVLDHDTFEYRAQDEGARGAFDWEFYYKRLPLLPEDLKYPARPFKSPVMAGGLFAISRKWFWELGGYDPGLDIWGGEQYELSFKIWQCGGQMLDTPCSRIAHVYRKYAPFPSVVNIGNFIARNYKRVAEVWMDEYRKYLYRRQ-PSWERENAGDLTAQFAIRERLKCKSFKWFMTEIAFDLEKHYPSVEPPNSADGEVRSKVFNSDGNSLCLDAKFAKSESQIRLAPCVK-DNSRLTGEQKFLLTWHEDLRLKSRDECLDVPQNMFKSPVILYSCHGQKGNQLWKYKLDSKQLYHVVTQKCL 556          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000070134.1 (SMESG000070134.1)

HSP 1 Score: 345.51 bits (885), Expect = 9.249e-111
Identity = 198/482 (41.08%), Postives = 311/482 (64.52%), Query Frame = 1
Query:  295 NSFEEEKVSLYRTINELKITKCKWLRHNKTLPSVSIIITFYDSDWEXXXXXXXXXXXXSPRRLIKEXXXXXXXXXXXXMRSKMNAYISKNFTNVRVVHKTKREXXXXXXXXXXXXXXXXVLVFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLY-SQDEGARGAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYDEGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIKIRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISXXXXXXXXXNCKSFDWFMENVAYDILYLYPPITVSEKLNCSITLESDD--SICVDSKYRKQGDRVGIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRN--SSETLMLSQCDLMNPNQKWEYNSTSHQITNIPSQKCIXXXXXXXXXXXXXXXXXXTMQKWIIQGCN 1725
            + +  +K+S+ R++ +++   CK L++ K+LPSVS+II F+   W  L++T   ++ R+P  LIKE++++DD +    ++  +  ++ +++   +V+    R+GLI+ R+LGAK A G VL+F+DSH    V WLPPLLEPI +NYKTVTCPFID+ + DT  Y SQDEGARG FDWNF+Y R+PR  ++++ P DPF++P+M G +FAI+RKWFWELGGYDEGL+IWGGEQ+E+SFK+W CGG+M++VPCSRI  +++    F        I +N+KR+AE+WMD +K+++Y R      + D  +++ Q  +++KL+CK+F WFM+ VA+D++  YP I  +   +  I L + +  S+C+D K+R  G  VG+  C  +   E   EQ F  +   EI+P  R++C D  +     +++L +C     NQ ++Y   S QI  + S  C++ +  S  + +  C+ + T QKWI    N
Sbjct:  110 DGYASDKISIQRSLRDIRHPACKTLKYLKSLPSVSVIIPFHQEHWSPLIRTVDSVIRRAPLGLIKEVILVDDASRKPFLQKTLEIFLKEHYPIAKVLRTNGRQGLIRTRVLGAKEAIGDVLIFLDSHSEANVNWLPPLLEPIAKNYKTVTCPFIDVINYDTFEYLSQDEGARGIFDWNFDYKRIPRFKSDESHPADPFESPVMAGGLFAISRKWFWELGGYDEGLDIWGGEQYEISFKLWQCGGKMLDVPCSRIGHVYRKYSPFPNNAKGNFISRNFKRVAEVWMDEFKEYLYLRR-PTIRNEDPLNLTNQFAIREKLHCKNFSWFMKEVAFDLVNNYPLIEPNPVCSGEIKLSNPNNVSVCIDFKFRDSGYVVGLSPCLSVNHKE-GGEQNFILSWKGEIKPKDRDMCMDSSDHIPGGSVLLFKCHGGRGNQFFKYKLESQQILFVNSGFCLEGDPASKHIALQTCNETITDQKWIWTSVN 589          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT106.397e-10041.94polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL66.509e-9842.16polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL67.200e-9842.16polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL63.611e-9044.53polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNT103.990e-7443.33polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-104.923e-10140.31Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-101.443e-10040.31Putative polypeptide N-acetylgalactosaminyltransfe... [more]
gly-51.119e-7035.90Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-51.119e-7035.90Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-51.119e-7035.90Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant68.787e-9940.67gene:FBgn0035375 transcript:FBtr0072973[more]
Pgant68.787e-9940.67gene:FBgn0035375 transcript:FBtr0333442[more]
Pgant68.787e-9940.67gene:FBgn0035375 transcript:FBtr0072972[more]
Pgant41.042e-7935.71gene:FBgn0051956 transcript:FBtr0333248[more]
Pgant41.042e-7935.71gene:FBgn0051956 transcript:FBtr0114524[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL64.766e-9539.38si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNTL64.766e-9539.38si:ch211-15e22.3 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
GALNT101.420e-8841.75polypeptide N-acetylgalactosaminyltransferase 10-l... [more]
galnt11.484e-7034.84UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt11.484e-7034.84UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNTL69.502e-10041.92polypeptide N-acetylgalactosaminyltransferase like... [more]
galnt101.573e-9942.86polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt101.573e-9942.86polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNTL61.041e-8939.55polypeptide N-acetylgalactosaminyltransferase like... [more]
GALNTL64.765e-8940.67polypeptide N-acetylgalactosaminyltransferase like... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt103.098e-9841.72polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
Galntl66.867e-9842.02UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galntl64.599e-9044.19UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
Galnt75.301e-7034.43polypeptide N-acetylgalactosaminyltransferase 7 [S... [more]
Galnt13.220e-6933.76polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8Y236|GLT10_CAEBR2.060e-10040.09Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|O45947|GLT10_CAEEL1.690e-9940.31Putative polypeptide N-acetylgalactosaminyltransfe... [more]
sp|Q86SR1|GLT10_HUMAN3.072e-9941.94Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
sp|Q6WV16|GALT6_DROME8.808e-9840.67N-acetylgalactosaminyltransferase 6 OS=Drosophila ... [more]
sp|Q925R7|GLT10_RAT9.473e-9841.72Polypeptide N-acetylgalactosaminyltransferase 10 O... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GGZ35.601e-11843.46Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A267EH106.438e-11843.46Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A210PT881.859e-11743.04Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
A0A2C9JLV68.524e-11743.00Polypeptide N-acetylgalactosaminyltransferase OS=B... [more]
K1PQC03.859e-11643.68Polypeptide N-acetylgalactosaminyltransferase OS=C... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT107.249e-9539.00polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
si:ch211-15e22.39.933e-9539.18polypeptide N-acetylgalactosaminyltransferase like... [more]
galnt11.380e-7034.62polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt133.211e-6833.82polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt134.385e-6833.61polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000477.11.662e-6434.89pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
ENSPMAT00000010805.12.603e-5834.57pep scaffold:Pmarinus_7.0:GL478309:9001:42806:-1 g... [more]
galnt121.522e-5734.26UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt111.030e-5637.46UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
poc1bl5.913e-5333.79POC1 centriolar protein homolog B (Chlamydomonas),... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310352.196e-7337.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343553.291e-6933.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372662.045e-6333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458291.722e-6133.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458307.556e-6036.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT101.033e-9538.80polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
GALNT102.112e-9539.24polypeptide N-acetylgalactosaminyltransferase 10 [... [more]
galnt12.282e-7034.41polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt12.282e-7034.41polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt138.427e-6832.58polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021519.10.000e+099.26SMESG000021519.1[more]
SMESG000021519.10.000e+095.95SMESG000021519.1[more]
SMESG000027520.13.424e-14245.74SMESG000027520.1[more]
SMESG000077709.11.012e-11142.89SMESG000077709.1[more]
SMESG000070134.19.249e-11141.08SMESG000070134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018393 ID=SMED30018393|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1879bp
AAACCTCTCTTTGCAACATCTGGAGCAAGAAAACCTGAATAAATCTCCCT
AAAATCAATGAAATCCCATTATTTTTCTTTCAGAGAAATGAATAGTCGTT
TGGTGATTTCAATTTTTGTATGGGGACTTTTTCCATGGAGACACAATTTC
ATCTCATCTTTTCAAATTCAAAGCGCTTTATCCAAAAATGAACACAAGCT
TGAAAATCATGGCTTATCTGACCAAGAAAATATAAGGAATTTATCGAATA
TTAATCTTATGATGAAGAGAATGAACTCAACTCGCCGTTTCAACAATTCA
TTCGAAGAAGAGAAAGTGTCCCTTTATCGTACAATAAACGAACTGAAAAT
AACAAAATGCAAATGGCTGAGGCACAATAAAACTTTACCTTCAGTATCAA
TTATCATAACATTTTACGATAGTGATTGGGAAACTCTCATGCAAACAACT
CGTATGTTATTACTGAGATCGCCTCGGCGGTTAATCAAAGAAATATTAAT
AATAGATGACAATGCAGACAATAATGATATGAGATCAAAAATGAATGCGT
ATATTTCTAAGAATTTTACAAATGTTCGAGTGGTACACAAAACAAAGCGA
GAAGGCCTTATTAAAGCGAGATTATTAGGAGCAAAACTTGCTAAAGGAAA
GGTATTAGTCTTTATGGATTCTCATTGTACAGTGGGAGTTAAATGGTTAC
CTCCATTATTAGAGCCTATCAAAGAAAACTATAAAACTGTAACTTGCCCC
TTTATTGATATAAATGATACTGATACCTCTCTTTATTCTCAGGACGAGGG
AGCGAGAGGAGCATTTGATTGGAATTTCAATTATACAAGACTGCCTCGAT
TGCATAATAATAAGACAGACCCAGAGGATCCATTTGATAATCCAATAATG
CAGGGAAGAATTTTTGCTATTACCAGAAAGTGGTTTTGGGAACTTGGAGG
GTATGATGAAGGCTTAGAAATTTGGGGAGGTGAACAGTTTGAATTGTCAT
TTAAAATTTGGATGTGTGGTGGACGAATGGTGAATGTTCCGTGTTCTAGG
ATCAGATGTATATTCAAGGATATTTATTCTTTCGATTTTATTCATGATGA
TATAAAGATAAGGAAAAACTATAAGAGAATAGCAGAAATTTGGATGGATA
ATTGGAAGAAATTTATCTATCAAAGACATTTAGAGGAGTATTCTTCATTT
GATTGTGGAGATATAAGCAAACAAAAGAAATTACAGCAAAAACTCAATTG
CAAGTCTTTTGATTGGTTCATGGAAAATGTCGCATACGATATTCTTTATT
TGTACCCCCCTATAACGGTTTCGGAGAAGCTCAATTGTTCCATCACACTG
GAATCTGATGACAGCATTTGTGTGGACTCAAAATACAGAAAACAAGGAGA
TCGTGTTGGAATCGACCAGTGCAATCAAATCGGGAGATCTGAGAAGAATA
AAGAACAAAGATTCTCCTTTACATCCGATTTTGAGATTCGGCCAGGTCAA
AGAAATTTGTGCTTTGATTATAGAAACTCCAGTGAAACTCTAATGCTGAG
TCAGTGCGATCTGATGAATCCAAACCAGAAATGGGAATACAATTCCACTT
CTCATCAGATTACCAACATTCCTTCTCAGAAATGCATCAAGGTCAATTCA
AAGTCTTTGTTGTTGCTTGTGAATAACTGCTCTTTGTCCAGTACAATGCA
GAAATGGATCATCCAGGGATGCAATGATAATCCAGAAAATTCGACGAAAC
GAACAAAATAATGAGAGCAAAACTGAATCTTACTAAAACAAATGAATTTA
TTTTATTTTATAATAGGCTTGAGCTATTATTATAATTTAATAACTTTTAC
AATTAAGTATTATTATTATTATTATTATT
back to top

protein sequence of SMED30018393-orf-1

>SMED30018393-orf-1 ID=SMED30018393-orf-1|Name=SMED30018393-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=568bp
MKSHYFSFREMNSRLVISIFVWGLFPWRHNFISSFQIQSALSKNEHKLEN
HGLSDQENIRNLSNINLMMKRMNSTRRFNNSFEEEKVSLYRTINELKITK
CKWLRHNKTLPSVSIIITFYDSDWETLMQTTRMLLLRSPRRLIKEILIID
DNADNNDMRSKMNAYISKNFTNVRVVHKTKREGLIKARLLGAKLAKGKVL
VFMDSHCTVGVKWLPPLLEPIKENYKTVTCPFIDINDTDTSLYSQDEGAR
GAFDWNFNYTRLPRLHNNKTDPEDPFDNPIMQGRIFAITRKWFWELGGYD
EGLEIWGGEQFELSFKIWMCGGRMVNVPCSRIRCIFKDIYSFDFIHDDIK
IRKNYKRIAEIWMDNWKKFIYQRHLEEYSSFDCGDISKQKKLQQKLNCKS
FDWFMENVAYDILYLYPPITVSEKLNCSITLESDDSICVDSKYRKQGDRV
GIDQCNQIGRSEKNKEQRFSFTSDFEIRPGQRNLCFDYRNSSETLMLSQC
DLMNPNQKWEYNSTSHQITNIPSQKCIKVNSKSLLLLVNNCSLSSTMQKW
IIQGCNDNPENSTKRTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000419prepharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR001173Glyco_trans_2-like
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 426..553
e-value: 4.2E-18
score: 76.1
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 435..550
e-value: 2.1E-18
score: 66.8
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 429..553
score: 20.949
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 427..552
e-value: 4.49234E-18
score: 78.3162
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 114..296
e-value: 3.0E-24
score: 85.7
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 428..562
e-value: 5.2E-25
score: 90.0
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 61..556
NoneNo IPR availablePANTHERPTHR11675:SF23N-ACETYLGALACTOSAMINYLTRANSFERASE 4-RELATEDcoord: 61..556
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 114..409
e-value: 2.77951E-135
score: 393.493
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 36..419
e-value: 8.1E-129
score: 431.7
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 91..411
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 434..553