Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial

Overview
NameHydroxyacyl-coenzyme A dehydrogenase, mitochondrial
Smed IDSMED30018385
Length (bp)289
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (SMED30018385) t-SNE clustered cells

Violin plots show distribution of expression levels for Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (SMED30018385) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (SMED30018385) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (SMED30018385) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 80.8777 bits (198), Expect = 2.235e-20
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 83.9593 bits (206), Expect = 4.359e-20
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   86 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 181          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 81.2629 bits (199), Expect = 1.113e-19
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 80.8777 bits (198), Expect = 3.460e-19
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Match: HADH (hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4799])

HSP 1 Score: 80.8777 bits (198), Expect = 3.528e-19
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: B0272.3 (Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 [Source:UniProtKB/Swiss-Prot;Acc:P41938])

HSP 1 Score: 82.8037 bits (203), Expect = 2.925e-20
Identity = 46/96 (47.92%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +  VT+IG GLMGSGIAQVSA +   V ++D  QS L+KA   I  +L+RVA KK AD  + Q   VS  L  I++ST+ +++ K +DL++EAI+E
Sbjct:   22 INNVTIIGAGLMGSGIAQVSANAKLNVTVVDSNQSALEKAQQGIANSLKRVAKKKHADDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: hacd-1 (Hydroxy-Acyl-CoA Dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O44608])

HSP 1 Score: 63.929 bits (154), Expect = 2.242e-13
Identity = 42/96 (43.75%), Postives = 54/96 (56.25%), Query Frame = 1
Query:   10 VTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQ---EKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            V + G G+MGSGIAQV  Q+GY VNL    +  L +A   IK NL RVA KK  D   E    E+     L L+QI TD   AA+ + + +EA+ E
Sbjct:   13 VAIFGAGMMGSGIAQVCLQAGYPVNLYGRSEKKLLEARETIKKNLIRVASKKKTDVPMEPAALEEIAQIQLDLLQIHTDIPSAAEDAAMAIEAVAE 108          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: F54C8.1 (Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 [Source:UniProtKB/Swiss-Prot;Acc:P34439])

HSP 1 Score: 62.3882 bits (150), Expect = 7.302e-13
Identity = 39/97 (40.21%), Postives = 59/97 (60.82%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVK-KFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            ++ V ++G G MGSGIAQV+A SG+ V L DV +  LD+AM  I  ++  ++ K K  DK  E+  FV+  +  I+   + + A   +DLI+EA IE
Sbjct:   11 IRNVAIVGSGQMGSGIAQVTASSGFNVMLADVNKKALDRAMKAISQSVTHLSKKQKGTDK--EKSDFVTLTMSRIKTCNNVSTAVADADLIIEAAIE 105          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: ech-1.1 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:O17612])

HSP 1 Score: 46.2098 bits (108), Expect = 5.511e-7
Identity = 27/93 (29.03%), Postives = 50/93 (53.76%), Query Frame = 1
Query:   10 VTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            + V+G G MG+GIA V+   G +  L+D  Q+ +++    +  +L R   ++   K+ E+EK  +  +  I  S     A K +D+++EA+ E
Sbjct:  355 IAVVGAGFMGAGIANVTINKGIRTVLLDANQAGVERGQNHVATHLNRQLKRQKISKL-EREKIYNHLVPTIDYS-----AMKNADVVIEAVFE 441          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Match: ech-1.2 (Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:Q9GYT0])

HSP 1 Score: 45.0542 bits (105), Expect = 1.371e-6
Identity = 26/93 (27.96%), Postives = 52/93 (55.91%), Query Frame = 1
Query:   10 VTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            + V+G GLMG+GIA V+   G +  L+D   + +++   +I  +L +   ++  +K+ E+E+  +  +  I  S     A K +D+++EA+ E
Sbjct:  381 IAVVGAGLMGAGIANVTIDKGIRTVLLDANPAGVERGQNQIATHLNKQVKRRKINKL-EKERIYNHLVPTIDYS-----AMKNADVVIEAVFE 467          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Mtpalpha (gene:FBgn0028479 transcript:FBtr0079858)

HSP 1 Score: 51.9878 bits (123), Expect = 5.348e-9
Identity = 35/96 (36.46%), Postives = 60/96 (62.50%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +KTV V+G GLMG+GI QVS   GY+V + D  ++ L + +G+++  L+  AVK+   +IS  E+     L  ++ + D ++  K +D+I+EA+ E
Sbjct:  373 VKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGLE-TAVKR--KRISALER--DQTLASLRPTLDYSD-FKNADIIIEAVFE 462          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Fly
Match: Mtpalpha (gene:FBgn0028479 transcript:FBtr0079857)

HSP 1 Score: 51.9878 bits (123), Expect = 5.384e-9
Identity = 35/96 (36.46%), Postives = 60/96 (62.50%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +KTV V+G GLMG+GI QVS   GY+V + D  ++ L + +G+++  L+  AVK+   +IS  E+     L  ++ + D ++  K +D+I+EA+ E
Sbjct:  334 VKTVGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGLE-TAVKR--KRISALER--DQTLASLRPTLDYSD-FKNADIIIEAVFE 423          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040801-261])

HSP 1 Score: 84.7297 bits (208), Expect = 7.041e-21
Identity = 46/96 (47.92%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D    +L+K+   I+ +L+RVA KKFA+K  + E FV   L  +  STD+      +DL+VEAI+E
Sbjct:   22 IKHVTVIGGGLMGAGIAQVAASTGHSVVLVDTSADILNKSAKGIENSLKRVAKKKFAEKPEDGEAFVQKVLKNVSTSTDAASVVHGTDLVVEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 76.6406 bits (187), Expect = 1.080e-17
Identity = 43/96 (44.79%), Postives = 59/96 (61.46%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D    +L K+   I+ +L+RV  K FADK     +F+   L     STD       +DL+VEAI+E
Sbjct:   28 IKHVTVIGGGLMGAGIAQVAASTGHTVVLVDQTDDILKKSRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVE 123          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Xenopus
Match: vps41 (VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB-GENE-999710])

HSP 1 Score: 76.2554 bits (186), Expect = 1.550e-17
Identity = 43/96 (44.79%), Postives = 59/96 (61.46%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D    +L K+   I+ +L+RV  K FADK     +F+   L     STD       +DL+VEAI+E
Sbjct:   26 IKHVTVIGGGLMGAGIAQVAASTGHTVVLVDQTDDILKKSRKTIEDSLKRVTKKMFADKPEAASQFIEKILANFTTSTDPAAVVHSTDLVVEAIVE 121          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Mouse
Match: Hadh (hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI Symbol;Acc:MGI:96009])

HSP 1 Score: 77.7962 bits (190), Expect = 3.880e-18
Identity = 42/96 (43.75%), Postives = 63/96 (65.62%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L+R+A KKF +     ++FV   L  +  STD+      +DL+VEAI+E
Sbjct:   27 IKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKKFTENPKAGDEFVEKTLSCLSTSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P41938|HCDH2_CAEEL (Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 OS=Caenorhabditis elegans OX=6239 GN=B0272.3 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.721e-19
Identity = 46/96 (47.92%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +  VT+IG GLMGSGIAQVSA +   V ++D  QS L+KA   I  +L+RVA KK AD  + Q   VS  L  I++ST+ +++ K +DL++EAI+E
Sbjct:   22 INNVTIIGAGLMGSGIAQVSANAKLNVTVVDSNQSALEKAQQGIANSLKRVAKKKHADDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q16836|HCDH_HUMAN (Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH PE=1 SV=3)

HSP 1 Score: 80.8777 bits (198), Expect = 1.662e-18
Identity = 44/96 (45.83%), Postives = 65/96 (67.71%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+ +   ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|P00348|HCDH_PIG (Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Sus scrofa OX=9823 GN=HADH PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 6.456e-18
Identity = 44/96 (45.83%), Postives = 64/96 (66.67%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L++VA KKFA+     ++FV   L  I  STD+      +DL+VEAI+E
Sbjct:   27 VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKTLSSISTSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q61425|HCDH_MOUSE (Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 2.714e-17
Identity = 42/96 (43.75%), Postives = 63/96 (65.62%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L+R+A KKF +     ++FV   L  +  STD+      +DL+VEAI+E
Sbjct:   27 IKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKKFTENPKAGDEFVEKTLSCLSTSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9WVK7|HCDH_RAT (Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hadh PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.037e-17
Identity = 42/96 (43.75%), Postives = 63/96 (65.62%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  + +L K+   I+ +L+R+A KKF +     ++FV   L  +  STD+      +DL+VEAI+E
Sbjct:   27 IKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLKRMAKKKFTENPKAADEFVEKTLSSLSTSTDAASVVHSTDLVVEAIVE 122          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A448WHE8 (3HCDH_N domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS5267 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.607e-26
Identity = 50/96 (52.08%), Postives = 72/96 (75.00%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +KT+TVIG GLMG+GI Q+SAQ+GY V L+D + +LL K++G ++ +L+RVA KKF+D +   +KFVSD L  + +STD   A   SDL++EAI+E
Sbjct:   21 IKTITVIGAGLMGAGITQISAQNGYSVRLVDRQDNLLQKSLGSLENSLKRVAKKKFSDDLPASKKFVSDILSNVTVSTDPKSAVVGSDLVIEAIVE 116          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Match: H9JD11 (3HCDH_N domain-containing protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.032e-25
Identity = 55/96 (57.29%), Postives = 66/96 (68.75%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMGSGIAQVSAQ+G  V L+DV    L KA   I  NL RVA K + D   E EKFV+D L  I  +TD+ EA+K +DL+VEAI+E
Sbjct:    5 IKNVTVIGGGLMGSGIAQVSAQAGQNVTLVDVSNDALAKAKKSIGTNLSRVAKKMYKDNPQEGEKFVNDSLGRINTATDAAEASKSADLVVEAIVE 100          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A2P6KS96 (Hadh OS=Nephila clavipes OX=2585209 GN=NCL1_30163 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.418e-24
Identity = 50/96 (52.08%), Postives = 72/96 (75.00%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMGSGIAQV+AQ+G+ V L++V + LL+KA   IK +L+RVA KKF DK  E EKF+ + L  ++ +T+  ++ K +DL++EAI+E
Sbjct:    5 LKNVTVIGGGLMGSGIAQVAAQTGHNVTLVEVSEPLLNKATANIKKSLERVAKKKFNDKSQESEKFMKETLDRLKTTTNPADSVKDADLVIEAIVE 100          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Match: A0A2H1VFH8 (SFRICE_013294 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_013294 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.796e-24
Identity = 55/96 (57.29%), Postives = 69/96 (71.88%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMGSGIAQVSAQ+G  V L+DV   +L K+   I  NL RVA K + DK  E EKFVS+ +  I+ STD +EA+K +DL+VEAI+E
Sbjct:   24 IKNVTVIGGGLMGSGIAQVSAQAGQNVILVDVSSDVLAKSQKSIGANLGRVAKKVYKDKPQEGEKFVSEAMARIKTSTDPSEASKSADLVVEAIVE 119          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Match: V4B5W7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203490 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.029e-23
Identity = 52/96 (54.17%), Postives = 71/96 (73.96%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTVIG GLMG+GIAQV+A +G+ V L+D  Q +LDK+MG ++ +LQRVA KK+AD  +  E FV D L  IQ  TDS ++  K+DL++EAI+E
Sbjct:   22 IKQVTVIGSGLMGAGIAQVAASTGHNVVLVDQNQDILDKSMGNLRKSLQRVAKKKYADDAAGGENFVKDVLGKIQTETDSAKSVLKADLVIEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Cavefish
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:103033308])

HSP 1 Score: 87.0409 bits (214), Expect = 1.001e-21
Identity = 45/96 (46.88%), Postives = 67/96 (69.79%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K +TVIG GLMG+GIAQV+A +G+ V L+D+ + +L K+   I+ +L+RV  KKFADK    E+F+   +  I  STD+    +K+DL+VEAI+E
Sbjct:   22 IKHITVIGGGLMGAGIAQVAATTGHSVVLVDMSEDILKKSAKSIEGSLKRVVKKKFADKPEAGEEFLQKAMKNISTSTDAAAVVQKTDLVVEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040801-261])

HSP 1 Score: 75.485 bits (184), Expect = 4.295e-18
Identity = 39/96 (40.62%), Postives = 61/96 (63.54%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            ++++ V+G G MG+GIAQV+A +G+KV ++D    +L KAM  I+ +L+RV  K F D      KF++D +  I  STD+       DL++EAI+E
Sbjct:   29 IQSLCVVGSGQMGAGIAQVAATTGHKVVIVDQTDDILQKAMKGIESSLKRVVKKTFGDNTEAGAKFMADTMSNISTSTDAAAVVHSCDLVLEAIVE 124          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Match: hadhab (hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit alpha b [Source:ZFIN;Acc:ZDB-GENE-041111-204])

HSP 1 Score: 43.1282 bits (100), Expect = 1.597e-6
Identity = 34/98 (34.69%), Postives = 49/98 (50.00%), Query Frame = 1
Query:    4 KTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQ--EKFVSDGLLL-IQISTDSNEAAKKSDLIVEAIIE 288
            KTV VIG GLMG+GIAQV+   G  V L D     L +   +I         K  +DK+ ++    F  D +L  +    D N   K +D+++EA+ E
Sbjct:  367 KTVAVIGAGLMGAGIAQVTIDKGVSVILKDTSMEGLGRGQQQI--------YKGLSDKVKKKTLSTFERDTVLSHLHPQLDLN-GFKTADMVIEAVFE 455          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Nematostella
Match: EDO46266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC1])

HSP 1 Score: 73.559 bits (179), Expect = 3.696e-17
Identity = 37/96 (38.54%), Postives = 63/96 (65.62%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VTV G GLMG+GIAQV+A + + V ++D   ++L K +  I+ ++QR+A K+F D +   + FV+  +  ++IS D   +   +DL++EAI+E
Sbjct:   43 IKNVTVFGGGLMGAGIAQVAAATDHNVTIVDQTNAILIKTLQSIERSMQRIAKKQFKDDVEAGKTFVAGTMSRLKISLDVPGSVADADLVIEAIVE 138          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Medaka
Match: hadh (hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Acc:101166688])

HSP 1 Score: 84.7297 bits (208), Expect = 6.646e-21
Identity = 43/96 (44.79%), Postives = 67/96 (69.79%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            +K VT+IG G MG+GIAQV+A +G+ V L+D  + +L K+   I+ +L+RV  KKFADK    E+F+ + L  + ISTD+  + + +DL++EAI+E
Sbjct:   22 IKNVTIIGGGQMGAGIAQVAASTGHTVTLVDTSEDILKKSRKGIEGSLKRVVKKKFADKPEAGEEFIQNVLQNVSISTDAGASVQAADLLLEAIVE 117          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000032777.1 (SMESG000032777.1)

HSP 1 Score: 169.474 bits (428), Expect = 8.458e-54
Identity = 86/89 (96.63%), Postives = 86/89 (96.63%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDL 267
            MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVA KKFADKISEQEKFVSD L LIQISTDSNEAAKKSDL
Sbjct:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVATKKFADKISEQEKFVSDSLQLIQISTDSNEAAKKSDL 89          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000032777.1 (SMESG000032777.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.391e-53
Identity = 86/89 (96.63%), Postives = 86/89 (96.63%), Query Frame = 1
Query:    1 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDL 267
            MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVA KKFADKISEQEKFVSD L LIQISTDSNEAAKKSDL
Sbjct:   21 MKTVTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVATKKFADKISEQEKFVSDSLQLIQISTDSNEAAKKSDL 109          
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Planmine SMEST
Match: SMESG000061749.1 (SMESG000061749.1)

HSP 1 Score: 44.2838 bits (103), Expect = 2.242e-6
Identity = 31/93 (33.33%), Postives = 50/93 (53.76%), Query Frame = 1
Query:   10 VTVIGCGLMGSGIAQVSAQSGYKVNLIDVEQSLLDKAMGKIKVNLQRVAVKKFADKISEQEKFVSDGLLLIQISTDSNEAAKKSDLIVEAIIE 288
            V+++G GLMGSGI +VS        L D+    L K   +I+ NL +++VKK      E ++  S     +  +TD  E  K +D+++EA+ E
Sbjct:  358 VSILGAGLMGSGITEVSIDKNIPTALKDINLEALGKGQDRIQKNL-KISVKKKKYTTFEADQIYSK----LHSTTDYAE-LKNTDIVIEAVFE 444          
The following BLAST results are available for this feature:
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HADH2.235e-2045.83hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH4.359e-2045.83hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH1.113e-1945.83hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH3.460e-1945.83hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
HADH3.528e-1945.83hydroxyacyl-CoA dehydrogenase [Source:HGNC Symbol;... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0272.32.925e-2047.92Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 ... [more]
hacd-12.242e-1343.75Hydroxy-Acyl-CoA Dehydrogenase [Source:UniProtKB/... [more]
F54C8.17.302e-1340.21Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1 ... [more]
ech-1.15.511e-729.03Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
ech-1.21.371e-627.96Enoyl-CoA Hydratase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mtpalpha5.348e-936.46gene:FBgn0028479 transcript:FBtr0079858[more]
Mtpalpha5.384e-936.46gene:FBgn0028479 transcript:FBtr0079857[more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hadh7.041e-2147.92hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps411.080e-1744.79VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
vps411.550e-1744.79VPS41, HOPS complex subunit [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hadh3.880e-1843.75hydroxyacyl-Coenzyme A dehydrogenase [Source:MGI S... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41938|HCDH2_CAEEL3.721e-1947.92Probable 3-hydroxyacyl-CoA dehydrogenase B0272.3 O... [more]
sp|Q16836|HCDH_HUMAN1.662e-1845.83Hydroxyacyl-coenzyme A dehydrogenase, mitochondria... [more]
sp|P00348|HCDH_PIG6.456e-1845.83Hydroxyacyl-coenzyme A dehydrogenase, mitochondria... [more]
sp|Q61425|HCDH_MOUSE2.714e-1743.75Hydroxyacyl-coenzyme A dehydrogenase, mitochondria... [more]
sp|Q9WVK7|HCDH_RAT3.037e-1743.75Hydroxyacyl-coenzyme A dehydrogenase, mitochondria... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448WHE81.607e-2652.083HCDH_N domain-containing protein OS=Protopolystom... [more]
H9JD111.032e-2557.293HCDH_N domain-containing protein OS=Bombyx mori O... [more]
A0A2P6KS962.418e-2452.08Hadh OS=Nephila clavipes OX=2585209 GN=NCL1_30163 ... [more]
A0A2H1VFH85.796e-2457.29SFRICE_013294 OS=Spodoptera frugiperda OX=7108 GN=... [more]
V4B5W71.029e-2354.17Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hadh1.001e-2146.88hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hadh4.295e-1840.63hydroxyacyl-CoA dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
hadhab1.597e-634.69hydroxyacyl-CoA dehydrogenase trifunctional multie... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462663.696e-1738.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hadh6.646e-2144.79hydroxyacyl-CoA dehydrogenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000032777.18.458e-5496.63SMESG000032777.1[more]
SMESG000032777.11.391e-5396.63SMESG000032777.1[more]
SMESG000061749.12.242e-633.33SMESG000061749.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018385 ID=SMED30018385|Name=Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=289bp
ATGAAAACTGTAACTGTTATTGGATGTGGATTGATGGGATCAGGAATTGC
GCAAGTTTCAGCTCAAAGTGGTTATAAAGTGAATTTGATAGACGTGGAAC
AGAGTCTTTTGGATAAAGCAATGGGAAAAATAAAAGTAAATTTACAGCGA
GTCGCAGTGAAAAAGTTTGCTGATAAAATTAGTGAACAAGAAAAATTCGT
TAGTGATGGCTTACTGTTAATTCAAATTTCAACCGATAGCAATGAAGCGG
CGAAAAAATCAGATTTAATAGTTGAAGCGATAATTGAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0070403NAD+ binding
GO:00038573-hydroxyacyl-CoA dehydrogenase activity
GO:0016491oxidoreductase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000240body wall musculature
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR016040NAD(P)-bd_dom
IPR0061763-OHacyl-CoA_DH_NAD-bd
Vocabulary: biological process
TermDefinition
GO:0006631fatty acid metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0061763-hydroxyacyl-CoA dehydrogenase, NAD bindingPFAMPF027373HCDH_Ncoord: 3..96
e-value: 1.6E-21
score: 77.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 1..96
e-value: 4.5E-25
score: 90.6
NoneNo IPR availablePANTHERPTHR43561FAMILY NOT NAMEDcoord: 2..96
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 1..96