C2 domain-containing protein

Overview
NameC2 domain-containing protein
Smed IDSMED30018383
Length (bp)1213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2 domain-containing protein (SMED30018383) t-SNE clustered cells

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30018383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2 domain-containing protein (SMED30018383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30018383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018383h1SMcG0010502 SmedASXL_009480SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018383h1SMcG0010502 dd_Smed_v4_13340_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30018383h1SMcG0010502 dd_Smed_v6_13340_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018383h1SMcG0010502 dd_Smed_v4_13340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30018383h1SMcG0010502 dd_Smed_v4_13340_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: SYT9 (synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265])

HSP 1 Score: 54.6842 bits (130), Expect = 1.642e-7
Identity = 75/306 (24.51%), Postives = 135/306 (44.12%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISV---IGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFD-ENLNGNDYPMGDGELVLNKLPQENFVGFV-YPTYVILKAPTEVL-----GCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-----LC-IGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            NDD         G ++  + YD   ++L ++     N+      GT  P  ++KI+L      R  +  TK     LNP F E+F   V   +L+   ++F V+D +  + +D     G++V+     ++F+    +P   IL    E +       G++   L + P   +L I+I++A+N+     T    P  Y  V +  +G + K  K+ +  NT NP + E    ++  ++ +      ++H +IA     R+G      +C +GN+        LG  H   +L   +KP A WHSL++
Sbjct:  210 NDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDP--YVKIYLLPD---RKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLI---GQVVV-----DHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDP--YVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENID------QIHLSIAVMDYDRVGHNEIIGVCQVGNE-----AERLGRDHWSEMLSYPRKPIAHWHSLVE 489          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 53.1434 bits (126), Expect = 5.304e-7
Identity = 68/284 (23.94%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNISVI---GTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKA--PTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD +  +L +  L    +  +   GT   D ++K+FL     K+ + K+ +     LNP F E F+  V  + L  + +   ++D +       +G+ ++ +N +     +G     +  L+     E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+     T NPYF E+F+       FE+   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WHSL
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTS--DPYVKVFLLPDKKKKYETKVHRK---TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVD----LGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFS-------FEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 405          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 53.1434 bits (126), Expect = 5.304e-7
Identity = 68/284 (23.94%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNISVI---GTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKA--PTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD +  +L +  L    +  +   GT   D ++K+FL     K+ + K+ +     LNP F E F+  V  + L  + +   ++D +       +G+ ++ +N +     +G     +  L+     E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+     T NPYF E+F+       FE+   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WHSL
Sbjct:  140 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTS--DPYVKVFLLPDKKKKYETKVHRK---TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVD----LGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFS-------FEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 405          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 52.7582 bits (125), Expect = 6.831e-7
Identity = 61/247 (24.70%), Postives = 111/247 (44.94%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIF---SLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGC-GDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTK--NPYFMETFTMNMLSKDF-EVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            D F+KI+L      +L+ K+ +    NLNP + E F       E +   I+Y QV D +    + P+G+  + LNK+       F    +  LK  ++  G  G++ + L +NP    + ++I++A+N+          P     VKV++    K+  K ++V+  +  NP F E+F  ++ ++   E  +I   M +    R         IG  + +       V+H K ++   ++P A WH L
Sbjct:  216 DPFVKIYLLPDKKHKLETKVKRK---NLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKVDLTQMQTF----WKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDP----YVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDKLSR------NDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQL 445          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: FO681492.2 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 52.373 bits (124), Expect = 8.551e-7
Identity = 62/254 (24.41%), Postives = 116/254 (45.67%), Query Frame = 2
Query:  467 FIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVI--------LKAPTEVLGCGDVCVILTFNP--PKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKK--KTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELG--VQHHKTVLKDWKKPHAMWHSLIK 1180
             +K++L   + + LQ   +KT     NP F E  IF ++ + +   ++ F V+  +       +G    VL  L  E  VG      VI        L+ P+E    GD+   L++N    +L + +L AK +  Q      + SV+  VKV +  H K  K  K+ +V  + NP + ETF+    + + + A + + + + + G   +++G++ +G     P++   G  ++H   +L   K+    WH+L +
Sbjct:  207 LVKLYLLPDERRFLQ---SKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQ---VLFPLKNETLVGDC--RRVIWRDLEAESLEPPSEF---GDLQFCLSYNDYLSRLTVVVLRAKGLRLQ--EDRGIVSVF--VKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDKSQQLGRVVVG-----PYMYTRGRELEHWDEMLSKPKELVKRWHALCR 440          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 63.1586 bits (152), Expect = 1.043e-10
Identity = 71/282 (25.18%), Postives = 133/282 (47.16%), Query Frame = 2
Query:  359 GYIDMNVMYDXXXXXXXIQNLTVCNISVIG-TDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSL---NVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT-EVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDF---EVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            G I+ +V ++K+   L +  +   ++ V   T   D +++ FL    G   Q + +K    NLNPTF E  S    +++ L    +  QV D +   +D P+G+  L L  +  E+    VY  +  L+ PT     CG++ + L + P   K+ +SI++A+++  +  T+++    Y  + +   G+K +  K+    +T +P F E+F  ++  K     EV ++   M   + G   + IG + +G        +E G +H    +   ++P AMWH L
Sbjct:  103 GRINFSVAFEKECSTLHVHLMEAVDLPVKDFTGSSDPYVRAFLLQDPG---QSERSKVHRRNLNPTFNETLSFRGHSMKKLHDMTLVLQVMDYDRFSSDDPIGEILLPLKHVKFES--SPVYWKH--LQRPTVSKDACGEIMISLCYLPTSGKITVSIIKARDLHAKDRTRHY--DTYVKMWMVQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGS-NEEIGHVIVGG-----LGSEHGQRHWSECVNHPEQPVAMWHKL 369          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 55.8398 bits (133), Expect = 1.310e-8
Identity = 57/245 (23.27%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIA--GRIP--KRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLI 1177
            D ++K+FL     K+LQ K+ +    +LNP F E F+  +    +  + +   VFD +  G    +G   + L K+   +    +  T +I   P   LG  +VC+ L + P K K+S++  +  + +      L   Y  + + +   + +  K+     T NPY+ E+F+ ++ S+  +    +V +H T++   R+   +RIG++ IG          + ++    +L   ++  A WH+L+
Sbjct:   52 DPYVKLFLLPDKKKKLQTKVQRK---SLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKV---DLAATLERTDLIESPPENRLG--EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQ----RVHLHVTVSDYDRVGSNERIGQVIIGT-----CATGVALKQWNDMLATPRRSVAQWHTLV 279          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: snt-3 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5])

HSP 1 Score: 55.8398 bits (133), Expect = 1.310e-8
Identity = 57/245 (23.27%), Postives = 114/245 (46.53%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIA--GRIP--KRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLI 1177
            D ++K+FL     K+LQ K+ +    +LNP F E F+  +    +  + +   VFD +  G    +G   + L K+   +    +  T +I   P   LG  +VC+ L + P K K+S++  +  + +      L   Y  + + +   + +  K+     T NPY+ E+F+ ++ S+  +    +V +H T++   R+   +RIG++ IG          + ++    +L   ++  A WH+L+
Sbjct:   52 DPYVKLFLLPDKKKKLQTKVQRK---SLNPVFNESFTFKIPFNEIGGQTLVLNVFDFDRFGKHDQIGQISIPLGKV---DLAATLERTDLIESPPENRLG--EVCLALRYVPNKNKLSVVVMECKNLKKMDVLGLSDPYVKIYLMMGTKRLEKKKTTIKMKTLNPYYNESFSFDVTSEKMQ----RVHLHVTVSDYDRVGSNERIGQVIIGT-----CATGVALKQWNDMLATPRRSVAQWHTLV 279          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Syt12 (gene:FBgn0261085 transcript:FBtr0331598)

HSP 1 Score: 49.6766 bits (117), Expect = 3.862e-6
Identity = 66/307 (21.50%), Postives = 132/307 (43.00%), Query Frame = 2
Query:  335 FEKYDSPF----GYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIP------DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTE-IVYFQVFDENLNGNDYPM-GDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGC----GDVCVILTFNPP--KLKISILEAKNISF--QYGTKNHLPSVYCV-VKVFVNGHKKKTFKSRSVSNTKN--PYFMETFTMNMLSKDFEVAVIKVEMHE-TIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG 1183
             ++ D P+    GY+ + + YD+     +   LTV  +   G   P      D F++I+L       +Q   TK +   L P++ E F   +        ++F ++    NG  + + G+ E+ + ++P+         T++ L   ++   C    G++   L++ P   +L I +++A+N+    +        +V+ V VKV++    +K  K R+    K+  P F E+   ++         ++V +   T +G  P  +G +  G+          G++H   +L   +KP AMWH L + 
Sbjct:  471 LDQLDQPYTQITGYLCVGLNYDQMSISNEGMELTVSVLEAKGLICPFSVESLDTFVRIYLVPDHPGAMQ---TKVVKGTLTPSYNESFDFWLHKRQARHSLWFHLYH---NGPAHTLIGEAEMEIGEMPRP------ITTWIPL---SDSRKCNARWGELMFSLSYLPTAERLTIVVVKARNLKLDGEQPAPESAETVHSVFVKVYLMDKDRKVLKKRTSLKRKDRSPIFNESMIFSVPPPSLTTTQLRVTVFGVTTSGVTP--LGHIVAGSCAVGK-----GLRHWHQMLSSLRKPVAMWHVLRRA 755          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Syt12 (gene:FBgn0261085 transcript:FBtr0073767)

HSP 1 Score: 49.6766 bits (117), Expect = 3.862e-6
Identity = 66/307 (21.50%), Postives = 132/307 (43.00%), Query Frame = 2
Query:  335 FEKYDSPF----GYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIP------DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTE-IVYFQVFDENLNGNDYPM-GDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGC----GDVCVILTFNPP--KLKISILEAKNISF--QYGTKNHLPSVYCV-VKVFVNGHKKKTFKSRSVSNTKN--PYFMETFTMNMLSKDFEVAVIKVEMHE-TIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG 1183
             ++ D P+    GY+ + + YD+     +   LTV  +   G   P      D F++I+L       +Q   TK +   L P++ E F   +        ++F ++    NG  + + G+ E+ + ++P+         T++ L   ++   C    G++   L++ P   +L I +++A+N+    +        +V+ V VKV++    +K  K R+    K+  P F E+   ++         ++V +   T +G  P  +G +  G+          G++H   +L   +KP AMWH L + 
Sbjct:  471 LDQLDQPYTQITGYLCVGLNYDQMSISNEGMELTVSVLEAKGLICPFSVESLDTFVRIYLVPDHPGAMQ---TKVVKGTLTPSYNESFDFWLHKRQARHSLWFHLYH---NGPAHTLIGEAEMEIGEMPRP------ITTWIPL---SDSRKCNARWGELMFSLSYLPTAERLTIVVVKARNLKLDGEQPAPESAETVHSVFVKVYLMDKDRKVLKKRTSLKRKDRSPIFNESMIFSVPPPSLTTTQLRVTVFGVTTSGVTP--LGHIVAGSCAVGK-----GLRHWHQMLSSLRKPVAMWHVLRRA 755          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Syt1 (gene:FBgn0004242 transcript:FBtr0332218)

HSP 1 Score: 49.2914 bits (116), Expect = 4.593e-6
Identity = 67/294 (22.79%), Postives = 126/294 (42.86%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMYD---XXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIF---SLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE--VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             D++ ++ +   G ++  + YD          IQ   +  + + GT  P  ++K++L     K+ + K+ +     L+P F E F   SL   +   + + F +FD +       +G+ ++ L  +   +    +     ++    E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+     T NPY+ E+F+  +  +  +    V+ V  ++ I    P  IG+  +G         EL  +H   +L   ++P A WH+L
Sbjct:  182 GDEEDKQSEQKLGRLNFKLEYDFNSNSLAVTVIQAEELPALDMGGTSDP--YVKVYLLPDKKKKFETKVHRK---TLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVPLCTI---DLAQTIEEWRDLVSVEGEGGQLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIAIMQNGKRLKKKKTSIKKCTLNPYYNESFSFEVPFEQIQKICLVVTVVDYDRIGTSEP--IGRCILGCMGTG---TEL--RHWSDMLASPRRPIAQWHTL 458          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 61.6178 bits (148), Expect = 5.199e-10
Identity = 71/262 (27.10%), Postives = 123/262 (46.95%), Query Frame = 2
Query:  413 QNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY--VILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE--VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            Q+L   +I   GT  P  ++K+++     K+ + K+ +    NL P F E  IF +   +L  + +  QVFD +  G    +G+ ++ +N +     +G     Y  ++     E    GD+C+ L + P   KL + I+EAKN+          P V  V++   NG + K  K+    NT NPYF E+F+  +     +    +I V  ++ +    P  IGK  IG   F    + +G++H   +L + ++P A WH+L
Sbjct:  154 QDLPAMDIG--GTSDP--YVKVYMLPDKKKKFETKVQRK---NLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSID----LGQPIHEYKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQH--NGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDP--IGKCWIG---FGA--SGVGLRHWSDMLANPRRPVAQWHTL 395          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: syt9b (synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822-6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.350e-8
Identity = 64/252 (25.40%), Postives = 107/252 (42.46%), Query Frame = 2
Query:  449 TDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVE--NLDTEIVYFQVFDENLNGNDYPMG----DGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            T   D ++KI+L      R  +  TK     LNP F E+F   V    L T  ++F V+D +       +G    D  L L   PQE  +        IL    + +  GD+   L + P   +L I+I++A+N+     T    P  Y  V +  +G + K  K+ +  NT NP + E    ++  ++ +   + + + +       + IG   +GN+        LG  H   +L   +KP A WH L++
Sbjct:  258 TGTSDPYVKIYLLPD---RKTKHQTKVHRKTLNPIFDEVFLFPVAYGELPTRKLHFSVYDFDRFSRHDVIGQVVVDNFLDLPDFPQETRL-----CRDILYVSADNVDLGDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDP--YVKVSIMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGICHVGNR-----APSLGRDHWNEMLTYPRKPIARWHQLVE 494          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: syt12 (synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022-147])

HSP 1 Score: 55.0694 bits (131), Expect = 7.050e-8
Identity = 57/249 (22.89%), Postives = 108/249 (43.37%), Query Frame = 2
Query:  452 DIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVE--NLDTEIVYFQVFDENLNGNDYPMGDGELVLNKL--PQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNP--PKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            + P CFI + L  +   ++    T+   +     F E FS+ +E  NL+   + F  F  + +  +   G  EL L+ L  P   F  ++Y    +      V   G++ + L++ P   +L + I +AKN+ +  G     P  +  V +  +G K    K+    +  NP F E    ++ +   +   ++V + E+      + +G + IG     P  + +G+ H   +L   +KP +MWH L +
Sbjct:  185 NFPGCFITVTLVPQ---QINLGATQVQRNAFTVVFDERFSVPLESVNLEENSLRFSTFGVDSDERNITAGVAELKLSDLDLPYRPFNAWLY----LQDINKAVDAVGEILLSLSYLPTAERLTVVIAKAKNLVWTNGKTTADP--FVKVYLLQDGRKISKKKTSIKRDDTNPIFNEAMIFSVPAIVLQDLSLRVTVAESTEDGRGENVGHVIIG-----PEASGMGITHWNQMLATLRKPVSMWHPLRR 419          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 54.6842 bits (130), Expect = 9.307e-8
Identity = 65/261 (24.90%), Postives = 118/261 (45.21%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVA--VIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            +Q   +  + + GT  P  ++K++L     K+ + K+ +    NL P F E  IF +    L  + +  QVFD +  G    +G  ++ +N +   +    ++    +     E    GDVC+ L + P   KL ++I+EAKN+  +      L   Y  + +  NG + K  K+    NT NPYF E+F+  +  +  +    +I V  ++ +    P       IG  F       +G++H   +L + ++P A WH+L
Sbjct:  155 LQAQDLAAMDIGGTSDP--YVKVYLLPDKKKKFETKVQRK---NLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCV---DLAQPLHEWRELENGEKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNL--KKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDP-------IGKTFIGYGATGVGLRHWSDMLANPRRPVAQWHTL 398          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 54.6842 bits (130), Expect = 1.010e-7
Identity = 65/261 (24.90%), Postives = 118/261 (45.21%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVA--VIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            +Q   +  + + GT  P  ++K++L     K+ + K+ +    NL P F E  IF +    L  + +  QVFD +  G    +G  ++ +N +   +    ++    +     E    GDVC+ L + P   KL ++I+EAKN+  +      L   Y  + +  NG + K  K+    NT NPYF E+F+  +  +  +    +I V  ++ +    P       IG  F       +G++H   +L + ++P A WH+L
Sbjct:  188 LQAQDLAAMDIGGTSDP--YVKVYLLPDKKKKFETKVQRK---NLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCV---DLAQPLHEWRELENGEKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNL--KKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDP-------IGKTFIGYGATGVGLRHWSDMLANPRRPVAQWHTL 431          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: cdk7 (cyclin-dependent kinase 7 [Source:Xenbase;Acc:XB-GENE-485507])

HSP 1 Score: 63.929 bits (154), Expect = 1.338e-10
Identity = 81/284 (28.52%), Postives = 127/284 (44.72%), Query Frame = 2
Query:  353 PFGYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKM-----TKTIDDNLNPTFPEIFS--LNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIA-GRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            P G + +++ YDKKK  L I  +   ++     D P   IK+F K  D     Q +     TK + ++ NP F E F+  L    L +  + F+V D +       +G+    L  L     +      Y  L+  T+    G+V + L   P   K+++ IL+ K  S    ++     VY  + VF N HK+K  KS   + +K   F ETF   +        +I V ++ETIA GR  K IG+  +GNQ       E G  H + +++  ++P A WH L
Sbjct:  129 PRGKLKLSLYYDKKKMALLINVIEATDLPAHSHD-PFVRIKVFSKADDPHSSVQTIIHEWDTKVVKNSRNPVFVESFTCTLKESQLLSTSLKFEVKDFDKYSRHTLIGETRATLQGLKTSKTLEL----YEDLQEKTKD-AIGEVLISLKCLPTAQKIEVGILKFKTSSLSTISER---DVYARIDVFTNQHKQKHQKSSLRAKSKVTVFNETFLFGLPDPGKTHCLILVSLYETIASGR--KLIGQTSLGNQNTKA---EDG--HWELMMQTLRQPVAKWHPL 396          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 52.373 bits (124), Expect = 8.050e-7
Identity = 68/263 (25.86%), Postives = 117/263 (44.49%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY--VILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            IQ   +  + + GT  P  ++K+FL     K+ + K+ +     LNP F E F+  V    L  + +   V+D +       +GD ++ +N +      G V   +  ++     E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+       FEV   +++  + +   +   +IGK   IG  F         ++H   +L + ++P A WH+L
Sbjct:  167 IQAAELPALDMGGTSDP--YVKLFLMPDKKKKFETKVHRK---TLNPVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDVIGDVKVPMNTVD----FGHVTEEWRDLVSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 411          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: SYT9 (synaptotagmin 9 [Source:NCBI gene;Acc:100497543])

HSP 1 Score: 52.373 bits (124), Expect = 8.393e-7
Identity = 61/248 (24.60%), Postives = 105/248 (42.34%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMG----DGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            D ++KI+L      R  +  TK     LNP F E+F   V   +L T  ++F V+D +       +G    D  L L   P+E+ +        I     + +  GD+   L + P   +L I+I++A+N+     T    P  Y  V +   G + K  K+ +  NT NP + E    ++  ++ +   + + + +       + IG   +GN         LG +H   +L   +KP A WH L +
Sbjct:  255 DPYVKIYLLPD---RKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLPTRKLHFSVYDFDRFSRHDVIGQVIVDNFLDLADFPRESNIW-----RDIEHVTNDNVDLGDLMFSLCYLPTAGRLTITIIKARNLKAMDITGASDP--YVKVSIMCEGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENIDQISLLIAVMDYDRVGHNEVIGICQVGND-----AESLGREHWSEMLSYPRKPIAHWHPLTE 487          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 52.373 bits (124), Expect = 8.570e-7
Identity = 77/319 (24.14%), Postives = 140/319 (43.89%), Query Frame = 2
Query:  263 KKRGQIKKSWKYKKEPQIP------FNDDDFEKYDSPFGYIDMNVMYDXXXXXXX---IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            K+  ++ KS+  K +P +        +D   EK     G +  ++ YD +  +L    IQ   +  + + GT   D ++K++L     K+ + K+ +     LNPTF E F+  V    L  + +   V+D +       +G+  + +N +   + +          K   E LG  D+C  L + P   KL + +LEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+       FEV   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WH+L
Sbjct:   99 KEVKELGKSYIDKVQPDVEDLDPSLLDDVKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTS--DPYVKVYLLPDKKKKYETKVHRK---TLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQSAEKEEQEKLG--DICFSLRYVPTAGKLTVIVLEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTL 401          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 52.373 bits (124), Expect = 8.885e-7
Identity = 78/320 (24.38%), Postives = 140/320 (43.75%), Query Frame = 2
Query:  263 KKRGQIKKSWKYKKEPQIP------FNDDDFEKYDSPFGYIDMNVMYDXXXXXXX---IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNIS-FQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            K+  ++ KS+  K +P +        +D   EK     G +  ++ YD +  +L    IQ   +  + + GT  P  ++K++L     K+ + K+ +     LNPTF E F+  V    L  + +   V+D +       +G+  + +N +   + +          K   E LG  D+C  L + P   KL + +LEAKN+     G    L   Y  + +  NG + K  K+    NT NPY+ E+F+       FEV   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WH+L
Sbjct:  104 KEVKELGKSYIDKVQPDVEDLDPSLLDDVKDEKPQEKLGKLQYSLDYDFQTGQLVVGIIQAADLPALDIGGTSDP--YVKVYLLPDKKKKYETKVHRK---TLNPTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEEWQDLQSAEKEEQEKLG--DICFSLRYVPTAGKLTVIVLEAKNLKKMDVGG---LSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELRHWSDMLANPRRPIAQWHTL 406          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Syt9 (synaptotagmin IX [Source:MGI Symbol;Acc:MGI:1926373])

HSP 1 Score: 53.9138 bits (128), Expect = 2.261e-7
Identity = 75/305 (24.59%), Postives = 132/305 (43.28%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISV---IGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVE--NLDTEIVYFQVFD-ENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVL-----GCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-----LC-IGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            NDD         G ++  + YD   ++L ++     N+      GT  P  ++KI+L      R  +  TK     LNP F E+F   V   +L+   ++F V+D +  + +D     G++V++      F    +P   IL    E +       G++   L + P   +L I+I++A+N+     T    P  Y  V +  +G + K  K+ +  NT NP + E    ++  +  +      ++H +IA     R+G      +C +GN+        LG  H   +L   +KP A WHSL++
Sbjct:  210 NDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDP--YVKIYLLPD---RKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLI---GQVVVDHF----FDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDP--YVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESID------QIHLSIAVMDYDRVGHNEVIGVCQVGNE-----AERLGRDHWSEMLSYPRKPIAHWHSLME 489          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 53.1434 bits (126), Expect = 3.761e-7
Identity = 68/284 (23.94%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNISVI---GTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKA--PTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD +  +L +  L    +  +   GT   D ++K+FL     K+ + K+ +     LNP F E F+  V  + L  + +   ++D +       +G+ ++ +N +     +G     +  L+     E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+     T NPYF E+F+       FE+   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WHSL
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTS--DPYVKVFLLPDKKKKYETKVHRK---TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVD----LGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFS-------FEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 408          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 53.1434 bits (126), Expect = 3.761e-7
Identity = 68/284 (23.94%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNISVI---GTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKA--PTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD +  +L +  L    +  +   GT   D ++K+FL     K+ + K+ +     LNP F E F+  V  + L  + +   ++D +       +G+ ++ +N +     +G     +  L+     E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+     T NPYF E+F+       FE+   +++  + +   +   ++GK   IG  F         ++H   +L + ++P A WHSL
Sbjct:  143 LGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTS--DPYVKVFLLPDKKKKYETKVHRK---TLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVD----LGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFS-------FEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSL 408          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 51.2174 bits (121), Expect = 1.283e-6
Identity = 69/263 (26.24%), Postives = 120/263 (45.63%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT--EVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            IQ   +  + + GT  P  ++K+FL     K+ + K+ +     LNP F E F+  V    L  + +   V+D +       +G+ ++ +N +   +F G V   +  L++    E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+       FEV   +++  + +   +   +IGK   IG  F         ++H   +L + ++P A WH+L
Sbjct:  163 IQAAELPALDMGGTSDP--YVKVFLLPDKKKKFETKVHRK---TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTV---DF-GHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 407          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 51.2174 bits (121), Expect = 1.283e-6
Identity = 69/263 (26.24%), Postives = 120/263 (45.63%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT--EVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            IQ   +  + + GT  P  ++K+FL     K+ + K+ +     LNP F E F+  V    L  + +   V+D +       +G+ ++ +N +   +F G V   +  L++    E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+       FEV   +++  + +   +   +IGK   IG  F         ++H   +L + ++P A WH+L
Sbjct:  163 IQAAELPALDMGGTSDP--YVKVFLLPDKKKKFETKVHRK---TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTV---DF-GHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 407          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q925B4|SYT8_RAT (Synaptotagmin-8 OS=Rattus norvegicus OX=10116 GN=Syt8 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.618e-11
Identity = 69/284 (24.30%), Postives = 121/284 (42.61%), Query Frame = 2
Query:  347 DSPFGYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAP--TEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLC--IGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            D P+G + +++ YD   +++++      N+   GT  P  + ++ +  + G+R +   TK     L P F E   F +    L    +  Q+ D        P+G+ +L L  +  ++    V  ++  L  P  TE    G++C  L + P   +L + ILEA+      G    L   Y  V++ +N  K K  K+ S   T NPYF E F        F V V +++  + +     + +  L   +G     P  +   +QH   +L   ++P A WH L
Sbjct:  111 DQPWGQLLLSLEYDFGSQEIRVGLRQAKNLKAEGTADP--YARVSVSTQAGRRHE---TKVHRGTLCPMFEETCCFLVPPAELPKATLKVQLLDFKRFSEHEPLGELQLPLGTVDLQH----VLESWYQLGPPGSTESEQMGELCFSLRYVPSSGRLTVVILEAR------GLNPGLAEAYVKVQLILNQRKWKKNKTSSKKGTTNPYFNEAFV-------FLVPVSQLQSMDLVLAVWARGLQLLAEPVGKVLLGPRASGQPLQHWADMLAHARRPIAQWHHL 372          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P24507|SY63_DIPOM (Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN=P65-C PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.443e-8
Identity = 69/249 (27.71%), Postives = 113/249 (45.38%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFD-ENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYV---ILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE-VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            D ++KI+L     K+ Q K+ +     LNP F E F  NV    L    ++F V+D +  + +D     G++VL+ L +  F  F   T +   IL+A +E    G++   L + P   +L I+I++A N+     T    P  Y    +  +  + K  K+    NT NP + E    ++ +++ E V VI   M     G   + IG   +GN    P     G +H   +L + +KP   WH LI+
Sbjct:  273 DPYVKIYLLPDRKKKFQTKVHRK---TLNPIFNETFQFNVPFNELQNRKLHFSVYDFDRFSRHDLI---GQVVLDNLLE--FSDFSEDTTIWRDILEATSEKADLGEINFSLCYLPTAGRLTITIIKATNLKAMDLTGFSDP--YVKASLICDERRLKKRKTSIKKNTLNPVYNEALVFDIPNENMEHVNVIIAVMDYDCIGH-NEVIGMCRVGNATDGP-----GREHWNEMLANPRKPIEQWHQLIE 505          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R4J5|SYT1_PONAB (Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 8.608e-8
Identity = 67/263 (25.48%), Postives = 118/263 (44.87%), Query Frame = 2
Query:  410 IQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT--EVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            IQ   +  + + GT  P  ++K+FL     K+ + K+ +     LNP F E F+  V    L  + +   V+D +       +G+ ++ +N +      G V   +  L++    E    GD+C  L + P   KL + ILEAKN+  +      L   Y  + +  NG + K  ++    NT NPY+ E+F+       FEV   +++  + +   +   +IGK   IG  F         ++H   +L + ++P A WH+L
Sbjct:  161 IQAAELPALDMGGTSDP--YVKVFLLPDKKKKFETKVHRK---TLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVD----FGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTLNPYYNESFS-------FEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTL 405          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P41823|SY65_APLCA (Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 3.151e-7
Identity = 83/317 (26.18%), Postives = 143/317 (45.11%), Query Frame = 2
Query:  287 SWKYKKEP---QIPFNDDDFEKYDSP-----FGYIDMNVMYD---XXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAP-TEVLG---CGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE--VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            S+K K +P   ++P N +D E  +S       G +  ++ YD    +     IQ   +  + + GT  P  ++K++L     K+ + K+ +     LNP F E F+  V    + ++I+ F V+D +       +G  ++ LN +     +G V   +  L++P TE       GD+C  L + P   KL + ILEAKN+  +      L   Y  + +     + K  K+    NT NPYF E+F   +  +  +    +I V  ++ I    P  IG+  +G    N    EL  +H   +L + ++P A WH+L
Sbjct:  123 SYKEKVQPDLDELPVNMEDNEDAESTKSEVKLGKLQFSLDYDFQKGELSVNVIQAADLPGMDMSGTSDP--YVKVYLLPDKKKKYETKVHRK---TLNPVFNESFTFKVPYAEVGSKILTFAVYDFDRFSKHDQIGQVQVPLNSID----LGRVVEDWKDLQSPDTESEKENKLGDICFSLRYVPTAGKLTVVILEAKNL--KKMDVGGLSDPYVKIALLQGTKRLKKKKTTIKKNTLNPYFNESFGFEVPFEQIQKVTLIITVVDYDRIGTSEP--IGRCVLG---CNSSGTEL--RHWSDMLANPRRPIAQWHTL 421          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86SS6|SYT9_HUMAN (Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.884e-7
Identity = 75/306 (24.51%), Postives = 135/306 (44.12%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISV---IGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFD-ENLNGNDYPMGDGELVLNKLPQENFVGFV-YPTYVILKAPTEVL-----GCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-----LC-IGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            NDD         G ++  + YD   ++L ++     N+      GT  P  ++KI+L      R  +  TK     LNP F E+F   V   +L+   ++F V+D +  + +D     G++V+     ++F+    +P   IL    E +       G++   L + P   +L I+I++A+N+     T    P  Y  V +  +G + K  K+ +  NT NP + E    ++  ++ +      ++H +IA     R+G      +C +GN+        LG  H   +L   +KP A WHSL++
Sbjct:  210 NDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDP--YVKIYLLPD---RKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLI---GQVVV-----DHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDP--YVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPENID------QIHLSIAVMDYDRVGHNEIIGVCQVGNE-----AERLGRDHWSEMLSYPRKPIAHWHSLVE 489          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A183STS9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7627 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.854e-14
Identity = 85/325 (26.15%), Postives = 148/325 (45.54%), Query Frame = 2
Query:  263 KKRGQIKKSWKYKKEP-----QIPFN-DDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCN-ISVIGTDIPDCFIKIFLKGKDG-KRLQQKM--------TKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY-VILKAPTEVLGCGDVCVILTFNPPK--LKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            KKRG      +Y+K P     Q+P   DD   K+    G ++  + Y+ + K LK+  +   + I++ G+ + D F+K+ +KG    +R + K+        T  I D   P F   F  NV  E+L T +V+  V+D +       +G  ++ L+ LP E +VG  Y T   ++K        G +CV+LT +P +  L +++LE K +      + H P     V + +   K    K+   S T NPYF ET   ++  +   VA + +++     G + +  GK+ +G     P     G +    ++   K+P  MW ++
Sbjct:   82 KKRGP-----QYQKMPNVYKDQLPGALDDTISKH---LGTLEYALEYNMRSKTLKVGIIQATDLITLPGSGMTDSFVKVSIKGTPSLERPKSKVRVTKIFYTTDIIRDTTCPVFNSAFIFNVPYEDLKTAVVHIVVYDSDEPNQPSVIGGLDIQLSSLPMEYYVGKSYETTGYLMKTADFTDETGQICVVLTNDPVQNELSVNVLEVKQLDLPDFYRKHPPETQVSVTLHIGKKKLANKKTHIRSGTLNPYFGETLKFHVERQKLIVASLTLKVKYRGQGSVFRNAGKVKLGADVSEP----AGRKQWTDMIVYPKRPAGMWQAI 394          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A3P7LB34 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS4888 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.948e-12
Identity = 65/258 (25.19%), Postives = 113/258 (43.80%), Query Frame = 2
Query:  446 GTDIPDCFIKIFLKGKD------GKRLQQKMTKTID---DNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTE-VLGCGDVCVILTFNP--PKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLI 1177
            G+   D F+K+ +KG         K  + +   T D   D   P F   F+ NV  E+L T +V+F V+D +       +G  ++ L  +P EN+ G  Y T   LK   +       +C +LT +P   +L +++LEAK +      + + P     V + +   K    K++    T NPYF ET    +      VA + +++   + G   +  GK+ +G        +  G +  + +L + ++P  MW  LI
Sbjct:  146 GSGTVDPFVKVRIKGMSSLEKTRAKARKPRKVYTTDIQRDTTCPVFNSAFTFNVPYEDLKTAVVHFVVYDADEPNQPLVVGGLDVKLESIPLENYCGKSYETTGYLKKSVDHSDDSAQICTVLTHDPVASELSVNVLEAKQLDLPDYYRKNPPETMVSVTLHIGDKKLANKKTQVRRGTLNPYFGETLKFQVEKHKLIVASLTLKVKYRVHGVRWRNAGKVVLGADAS----DSSGRKQWEEMLANPRRPVGMWQPLI 399          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A0X3PI47 (Synaptotagmin-1 OS=Schistocephalus solidus OX=70667 GN=SY65 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.584e-12
Identity = 83/322 (25.78%), Postives = 142/322 (44.10%), Query Frame = 2
Query:  269 RGQIKKSWKYKKEP-----QIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCN-ISVIGTDIPDCFIKIFLKG-------KDGKRLQQKM--TKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYP-TYVILKAPTEVLGCGDVCVILTFNPPK--LKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            R   K+  +Y+K P     QIP   DD        G ++ ++ Y+ K K LK+  +   + ++  G+   D F+K+ LKG       K   R+ +K+  T    D   P F   F  NV  E+L T ++ F V+D +       +G   + L+ L  EN+VG  Y  T  + K        G +CV+LT +P +  L +++LEAK +      + + P     V + +   K    K++    T++PYF ET   ++      VA + +++     G   K  GK+ +G        +  G +  + +L   ++P  MW  L
Sbjct:   79 RKAHKRGPQYQKMPSVYKDQIPGATDDAA--GETLGALEYSLEYNMKTKTLKVGVIQATDLVTPPGSGTVDPFVKVSLKGMPSLEKSKAKVRMPRKVYTTDIKRDTACPVFNSSFVFNVPYEDLKTAVLNFVVYDADEPNQPLLVGGLNVQLSSLSMENYVGKSYEMTGYLTKMAGITDDTGQICVVLTQDPVQNELSVNVLEAKQLDLPDFYRRNPPETLVSVTLHIGKKKLANKKTQVRRGTRDPYFGETLKFHVERHKLIVASLTLKVKYKGQGLAYKNAGKVVLGADAS----DSSGRKQWEEMLAQPRRPVGMWQPL 394          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A3P6U2I2 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS4325 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.583e-11
Identity = 58/218 (26.61%), Postives = 99/218 (45.41%), Query Frame = 2
Query:  536 DNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTE-VLGCGDVCVILTFNPPK--LKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            D   P F   F  N+   +L T I++  V+D +       +G   + L  LP EN+VG  Y     L+   + V   G +CV+LT++P +  L +++LEAK +      + H P     V +     K    K+   S T +PYF ET   + + +   VA + +++     G++ K  GK+ +G       +   G +  + +L + K+P  MW  L
Sbjct:   89 DTTCPIFNSAFDFNLPYADLKTAILHMVVYDSDEPNQPVLVGGLNVQLYSLPLENYVGKTYEATGYLRKTADFVEQTGQLCVVLTYDPDEAVLSVNVLEAKQLDLPEFYRKHPPETMVSVTLHTGKKKFANKKTHIRSGTLDPYFGETLKFHAVKQKLIVASLTLKVK--YRGQVFKNAGKVILGPD----ALQASGRRQWREMLANPKRPAGMWQIL 300          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A3P6U0B4 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2387 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.207e-11
Identity = 81/303 (26.73%), Postives = 140/303 (46.20%), Query Frame = 2
Query:  311 QIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCN-ISVIGTDIPDCFIKIFLKG-------KDGKRLQQK-MTKTIDDNLN-PTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYP-TYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            Q+P  DDD +      G ++ ++ Y+ K K +K+  +   + I+  G+   D F+K+ +KG       K   R+ +K  T  I  N   P F   F  NV  E+L T +V+F V+D +       +G+ ++ L+ L  +N+VG  Y  T  ++K        G +CVILT +P   +L ++IL+AK +      + + P       + V   K    K+     T +PYF ET    +  +   VA + +++     G   K  GK+ +G    +P  +  G +  K +L + ++P  MW  L
Sbjct:    8 QLPGLDDDAQ--GDTMGTLEYSLEYNMKTKTMKVGIIQAMDLITPPGSGTVDPFVKVNIKGLLSLENPKSKVRVPKKGYTTDIKRNTTCPVFNSSFLFNVPYEDLKTAVVHFVVYDSDEPNQPLVVGEFDVQLSSLSMDNYVGKPYEMTGYLMKTVETHDDTGQICVILTDDPSANELSVNILDAKQLDLPDFYRKNPPKTMVSATLHVGNKKLANKKTEVREGTLDPYFGETLKFQVERQKLVVASLTLKIKYKGQGVRWKNAGKVELGA--LSPDFS--GRKQWKVMLTNPRRPVGMWQPL 304          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 63.1586 bits (152), Expect = 1.415e-10
Identity = 68/284 (23.94%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  356 FGYIDMNVMY---DXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY----VILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            FG ++ ++ Y   D +     +Q   +  + + GT  P  ++K+++     K+ + K+ +    NL P F E  IF +   +L  + +  QVFD +  G    +G+ ++ +N       +    P +    ++     E    GD+C+ L + P   KL + I+EAKN+          P V  V++   NG + K  K+    NT NPYF E+F+  +     +   + + +++         IGK  IG        + +G++H   +L + ++P A WH+L
Sbjct:  124 FGKLEYSLDYNFTDNQLIVGILQAQDLPAMDIGGTSDP--YVKVYMLPDKKKKFETKVQRK---NLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIAMNS------IDLGQPIHEWKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKVVLQH--NGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYG-----ASGVGLRHWSDMLANPRRPVAQWHTL 389          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 63.1586 bits (152), Expect = 1.462e-10
Identity = 68/284 (23.94%), Postives = 128/284 (45.07%), Query Frame = 2
Query:  356 FGYIDMNVMY---DXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPE--IFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY----VILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            FG ++ ++ Y   D +     +Q   +  + + GT  P  ++K+++     K+ + K+ +    NL P F E  IF +   +L  + +  QVFD +  G    +G+ ++ +N       +    P +    ++     E    GD+C+ L + P   KL + I+EAKN+          P V  V++   NG + K  K+    NT NPYF E+F+  +     +   + + +++         IGK  IG        + +G++H   +L + ++P A WH+L
Sbjct:  129 FGKLEYSLDYNFTDNQLIVGILQAQDLPAMDIGGTSDP--YVKVYMLPDKKKKFETKVQRK---NLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIAMNS------IDLGQPIHEWKDLVGGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKVVLQH--NGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYG-----ASGVGLRHWSDMLANPRRPVAQWHTL 394          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 61.2326 bits (147), Expect = 6.929e-10
Identity = 75/293 (25.60%), Postives = 132/293 (45.05%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMY---DXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVL-GCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            N ++  K +   G +  ++ Y   D       IQ   +  + + GT  P  ++K++L     K+ + K+ +     LNPTF E F+  V    L  + +   V+D +       +GD  + +NK+   +F        V+ KA  E     GD+C+ L + P   KL + +LEAKN+  +      L   Y  + +  NG + K  K+    +T NPY+ E+F+  + S+  +    KV++  T+      +IGK   IG  F     +    +H   +L + ++P A WH+L
Sbjct:  130 NKEEGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDP--YVKLYLLPDKKKKFETKVHRK---TLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKV---DFSQVTEEWRVLQKAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNL--KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQ----KVQVVVTVLDY--DKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL 406          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 61.2326 bits (147), Expect = 7.318e-10
Identity = 76/294 (25.85%), Postives = 132/294 (44.90%), Query Frame = 2
Query:  323 NDDDFEKYDSPFGYIDMNVMY---DXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVL-GCGDVCVILTFNPP--KLKISILEAKNIS-FQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            N ++  K +   G +  ++ Y   D       IQ   +  + + GT  P  ++K++L     K+ + K+ +     LNPTF E F+  V    L  + +   V+D +       +GD  + +NK+   +F        V+ KA  E     GD+C+ L + P   KL + +LEAKN+     G    L   Y  + +  NG + K  K+    +T NPY+ E+F+  + S+  +    KV++  T+      +IGK   IG  F     +    +H   +L + ++P A WH+L
Sbjct:  127 NKEEGPKEEQKLGKLQFSLDYHFTDGSLIVGIIQAEDLAAMDMSGTSDP--YVKLYLLPDKKKKFETKVHRK---TLNPTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKV---DFSQVTEEWRVLQKAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGG---LSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQ----KVQVVVTVLDY--DKIGKNDAIGKVFMGLHSSGTEQRHWADMLANPRRPIAQWHAL 403          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000017640.2 (synaptotagmin-1-like [Source:NCBI gene;Acc:103035847])

HSP 1 Score: 54.6842 bits (130), Expect = 8.775e-8
Identity = 66/250 (26.40%), Postives = 114/250 (45.60%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT--EVLGCGDVCVILTFNP--PKLKISILEAKNIS-FQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVA--VIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG 1183
            D ++K+++     K  +   TK     LNP F E F   +  + L    +  QV+D N       +G+  L L+ +   +    V   +  L  P+  E    G++C  L + P   KL + ILEAKN+    +G  +     Y  V++ ++  K K  K+     T NPYF E+FT ++  +  +    VI V  H+ ++      IGK+ +G    +   N+L  +H   +L + ++P A WH+L+  
Sbjct:  172 DPYVKVYVLPSKSKTFE---TKVFRKTLNPVFNESFKYQISQKELGESTLVIQVYDFNRFSKHDVIGELRLELSAVDWNH----VIEEWRDLSKPSKHEQEHLGEICFSLRYVPTASKLTVVILEAKNLKKMDHGGYS---DPYVKVQLILDKRKWKKKKTSVKKQTLNPYFNESFTFDVSFEQIQKVQLVISVWDHDKMSRN--DAIGKIFLG---CDATGNQL--RHWADMLSNPRRPVAQWHTLLSA 404          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 53.9138 bits (128), Expect = 4.586e-8
Identity = 84/328 (25.61%), Postives = 133/328 (40.55%), Query Frame = 2
Query:  275 QIKKSWKYKKEPQIPFNDDDFEKYDSPF------GYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIP--------DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIF---SLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCG-------DVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIP-KRIGKL-CIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            QI  S++ K +P +   D + E Y S        G I+  + Y           LTV  I     DIP        D ++KI L     K+ + K+ +     LNP F E F   ++    +   I+  ++FD +       +G+  L L  +   + +      + +L  P+   G G       D+C  L + P   KL+I+I+EAK++     T    P  Y  + +   G K K  K+     T NPY+ ETFT       F VA  K+E    I   +   R+GK   IG        +   ++H   +L   ++  A WH+L
Sbjct:   51 QIGASYQEKVQPSMDELDYNSEDYHSDLSSGVKIGRINFTLDYSFTD-----NTLTVGIIR--AEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRK---TLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNIN----EWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDP--YVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFT-------FTVAFEKIEQTSLIISVLDYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTL 355          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 47.3654 bits (111), Expect = 4.675e-6
Identity = 61/250 (24.40%), Postives = 113/250 (45.20%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV---ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENF-VGFVYPTYV--ILKAPTEVLGCGDVCVILTFNPPKLKISILEAKNISFQY----GTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNM-LSKDFEVA-VIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            D F+KI L      +L+ ++ +    NLNP + E+F+        L  + +Y QV D +    + P+G+ E+     P EN  +G V  T+   +L    + +  GD+ V L + P   +I ++  K    +     G+ +    +Y + K      KK T K R    T++P + E+F  ++ L K  ++  V  V  ++ I     + IG++ +G +          ++H   ++ + +KP A WH L
Sbjct:   39 DPFVKIMLLPDKKHKLETRVKRK---NLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEI-----PLENIDLGPVTLTFTKDLLPCKKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRR----TRDPVWNESFIFDVPLDKIRDLTFVFNVMDYDRITQN--ELIGQVILGYR-----TTGSSLRHWTEMMNNPRKPVAQWHRL 269          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: syt5a (synaptotagmin-1 [Source:NCBI gene;Acc:101166053])

HSP 1 Score: 63.929 bits (154), Expect = 7.998e-11
Identity = 66/249 (26.51%), Postives = 118/249 (47.39%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTY----VILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNM-LSKDFEVAV-IKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLI 1177
            D ++K+++     K+ + K+ +    NL P F E F+  +    L  + +  QVFD +  G    +G+ ++ +N       +    P +    ++     E    GD+C+ L + P   KL ++I+EAKN+          P V  V++   NG + K  K+    NT NPYF E+F+  +  S+  +V V I V  ++ +    P  IGK  IG        + +G++H   +L + ++P A WH+L+
Sbjct:  152 DPYVKVYMLPDKKKKFETKVQRK---NLCPVFNETFTFKIPYSELGGQTLVLQVFDFDRFGKHDVIGEIKIPMNS------IDLGQPIHEWKDLVGGEKEEQEKLGDICISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPFVKVVLQH--NGKRLKKKKTSVKQNTLNPYFNESFSFEIPFSQIQKVQVLITVYDYDKLGSNDP--IGKCWIGYG-----ASGVGLRHWSDMLANPRRPVAQWHTLL 382          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042397.1 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 58.5362 bits (140), Expect = 4.793e-9
Identity = 70/281 (24.91%), Postives = 124/281 (44.13%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNI-SVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAP--TEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD +  KL +  L   ++ S+      D ++++ L     K+   K+ K     LNP F E F   V  E L  + +   V+D +       +G+ +L +N +     +G     +  L++    E    GD+C+ L + P   KL + ILEAKN+         L   Y  +++   G + K  K+    NT NPY+ E+F+  +  +  +  ++ V + +        +IGK   IG  F       LG++H   +L + ++P A WH L
Sbjct:  148 LGKLQYSIEYDFENTKLTVGILQAADLMSMDSGGTSDPYVRVLLLPDKKKKFDTKVHKK---TLNPVFNETFVFKVPYEELGGKTLCLSVYDYDRFSKHDVIGEVKLAMNTID----LGRPIEEWRDLESADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDAC--GLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKILVAVTVFDY------DKIGKNDAIGKIFVGSKATGLGLKHWSDMLANPRRPIAQWHVL 413          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000008980.2 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 56.9954 bits (136), Expect = 1.660e-8
Identity = 63/245 (25.71%), Postives = 109/245 (44.49%), Query Frame = 2
Query:  461 DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAP--TEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGK-LCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            D ++++ L     K+   K+ K     LNP F E F   V  E L  + +   V+D +       +G+ +L +N +     +G     +  L++    E    GD+C+ L + P   KL + ILEAKN+         L   Y  +++   G + K  K+    NT NPY+ E+F+  +  +  +  ++ V + +        +IGK   IG  F       LG++H   +L + ++P A WH L
Sbjct:  160 DPYVRVLLLPDKKKKFDTKVHKK---TLNPVFNETFVFKVPYEELGGKTLCLSVYDYDRFSKHDVIGEVKLAMNTID----LGRPIEEWRDLESADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKKMDAC--GLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKILVAVTVFDY------DKIGKNDAIGKIFVGSKATGLGLKHWSDMLANPRRPIAQWHVL 389          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 55.4546 bits (132), Expect = 4.875e-8
Identity = 71/284 (25.00%), Postives = 127/284 (44.72%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNI-SVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKL----PQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE--VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD ++ KL +  L   ++ S+      D ++K+F+     K+   K+ K     LNP F E F+  +  + +  + +   V+D +       +G+ ++ +N L    P E +               E    GD+C+ L + P   KL I ILEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+  +  +  +   AVI V  ++ I       IGK+ +G++         G++H   +L + ++P A WH L
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKK---TLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLDSADQ------EEPEKLGDICISLRYVPTAGKLTICILEAKNL--KKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKN--DAIGKIWVGSKSTG-----AGLKHWSDMLANPRRPIAQWHPL 415          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 55.4546 bits (132), Expect = 4.875e-8
Identity = 71/284 (25.00%), Postives = 127/284 (44.72%), Query Frame = 2
Query:  356 FGYIDMNVMYDXXXXXXXIQNLTVCNI-SVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKL----PQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPP--KLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFE--VAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
             G +  ++ YD ++ KL +  L   ++ S+      D ++K+F+     K+   K+ K     LNP F E F+  +  + +  + +   V+D +       +G+ ++ +N L    P E +               E    GD+C+ L + P   KL I ILEAKN+  +      L   Y  + +  NG + K  K+    NT NPY+ E+F+  +  +  +   AVI V  ++ I       IGK+ +G++         G++H   +L + ++P A WH L
Sbjct:  150 LGKLQYSIDYDFQENKLTVGILQAADLLSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKK---TLNPVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVIGEIKIPMNTLDLAKPIEEWRDLDSADQ------EEPEKLGDICISLRYVPTAGKLTICILEAKNL--KKMDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLDYDKIGKN--DAIGKIWVGSKSTG-----AGLKHWSDMLANPRRPIAQWHPL 415          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000002888.1 (SMESG000002888.1)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 371/374 (99.20%), Postives = 372/374 (99.47%), Query Frame = 2
Query:   62 MNXXXXXXXXXXXXXQPFNVTASSSILGYLGSIAKYWNISVRTXXXXXXXXXXXXXXXXXXXXXXXQKKRGQIKKSWKYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG 1183
            MNSETSTERFSFSTSQPFNVTASSSILGYLGSIAKYWNISVRTLVIILVALGLVIIIIIFALIFWIQKKRGQ KKSWKYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDKKKKKLKIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTF+PPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPY METFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG
Sbjct:    1 MNSETSTERFSFSTSQPFNVTASSSILGYLGSIAKYWNISVRTLVIILVALGLVIIIIIFALIFWIQKKRGQTKKSWKYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDKKKKKLKIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFSPPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYLMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIKG 374          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000002889.1 (SMESG000002889.1)

HSP 1 Score: 186.037 bits (471), Expect = 1.394e-54
Identity = 123/358 (34.36%), Postives = 201/358 (56.15%), Query Frame = 2
Query:  116 NVTASSSILGYLGSIAKYWNIS-VRTXXXXXXXXXXXXXXXXXXXXXXXQKKRGQ-IKKSWKYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPPKLKISILEAKNISFQYG-TKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 1180
            NV  +S +  Y  SI K WNIS ++ + I +  L  V++ +   +    +   G+  K+S     +  +P N    E  D+P GYI+ +V Y KK+K+++IQ++ +  +       PDC++ +F++    +    + TKT  ++L P F E F   + N++  I+ F+++DENL+GND  +  GE++L  + ++ F  +     + L  P+E+ G GDV VILT NPP L+I+ILEAK ++ +     N L S +  VKVFVN H  K FK++ + +  NPYF ETF++ + SK +E  +IK+E+  +      +RIGK  IG +  N  +N LG  H +    D K   A+WH+L+K
Sbjct:   42 NVNQTSVLGTYFNSILKLWNISPLQGMFISVGLLLAVVLTVAIIIYCVRKSVEGEDTKRSRLSNLKKHLPVNSSSSE-IDTPHGYIEASVKYKKKQKEIEIQDIQIYKLEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNINNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIRLDKPSELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVFSKMWEKILIKIELFRSGF----RRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK 394          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000011583.1 (SMESG000011583.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.536e-11
Identity = 80/302 (26.49%), Postives = 134/302 (44.37%), Query Frame = 2
Query:  302 KEPQIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV---ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVL-GCGDVCVILTFN-PPKLKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKN------PYFMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            KE    F D+    ++  FG I   + Y   K+ L ++ + V N+     D  D ++ + +K K     ++K TK    +++P F E F+  +   E  D+EI +F+VFD +  G D  +G   L    L   + +  +      LK   +   G G VC+IL  N    L ++ILEAKN+  +         ++  VK+    H  K FK+ S   TK+      PYF ETF            ++ V++  +   ++P  IG + +G++         G  H +++L   + P A WH L
Sbjct:   83 KEIDKIFRDELNLGFNESFGKIYFALKYLLVKELLIVKVIKVENLPTPIDDCLDPYVVVQVKSKS--LTEEKKTKIKYKHIDPVFNEKFTFKILHPELNDSEI-FFKVFDYDKFGADSLLGQLALNFKDLNPSSIINMLSEFSKDLKEGEDTSEGMGQVCIILNSNGQAGLLVTILEAKNLRVKENMS--YSHIFVTVKIKSRKHGNK-FKTHSKKRTKDAHCGPFPYFNETFLFPKPHGTISDCLVSVKIWISRMFKMPICIGYVSLGSEMN----MTSGAIHWQSMLDSPRHPVAKWHVL 374          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000041533.1 (SMESG000041533.1)

HSP 1 Score: 63.929 bits (154), Expect = 5.629e-11
Identity = 80/311 (25.72%), Postives = 142/311 (45.66%), Query Frame = 2
Query:  293 KYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNI-SVIGTDIP-----DCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGN-DYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVL-GCGDVCVILTFNPPK--LKISILEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNM--LSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKK-PHAMWHSLIK 1180
            ++ K   + F DD  E   S  G I   + Y         +N+ V N+  V G   P     D ++K+ ++  +   ++ + TK      NPTF + F   +    L+  +V  +VFD ++ G  D  +G     ++ +  E F        + L  PTE   G G++C++L   P +  LK+++LE K + F+  TK  +  +Y  V+ +      +T  + +  NT++PYF ETF  ++  +   +   + KV    TI   + K +GKL IG+   +P    L  Q+H   +  + +   + WH+L K
Sbjct:   62 RFTKITDMHFEDDVGEYKPSKLGDISFAIDYLFG------KNILVVNVMQVFGLTSPSNVEIDSYVKVRIE-PESWNIKPRKTKIQHQTNNPTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFKSKTK--ILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKVFQKPTIG--LKKCLGKLEIGSN--SP---TLSAQNHWMDMVAYPRVAKSCWHALSK 356          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000025329.1 (SMESG000025329.1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.407e-8
Identity = 73/291 (25.09%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  338 EKYDSPFGYIDMNVMYDXXXXXXXIQNLTVCNISVIG-TDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNV--ENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPT----EVLGCGDVCVILTFNPP--KLKISILEAKNIS-FQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFMETFTMNMLSKDFEVA--VIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSL 1174
            EK D   G +  ++ YD +K +L +  +   ++  +  +   D ++K++L     K+ + K+ + I   LNP F E F   V    + ++ + F V+D +       +G  ++ L  +     +G V   +  L++P     +    GD+C  L + P   KL I ILEAKN+     G    L   Y  + + +NG + K  K+     T NPY+ E+F+  +  +  +    ++ V  ++ I    P  IG++ +G    N    EL  +H   +L + ++P A WH+L
Sbjct:  115 EKEDVHLGKLQYSLDYDFQKGELTVGVIQATDLPAMDMSGTSDPYVKLYLLPDKKKKFETKVHRKI---LNPVFNETFVFKVPFNEVASKTLIFNVYDFDRFSKHDQIGQIKVPLGAID----LGRVIEEWKELESPENDGEKENRLGDICFSLRYVPTSGKLTIVILEAKNLKKMDVGG---LSDPYVKLSLMLNGKRVKKKKTTIKKYTLNPYYNESFSFEVPFEQIQKVNLIVTVVDYDRIGTSEP--IGRIVLG---CNATGAEL--RHWSDMLANPRRPIAQWHTL 388          
The following BLAST results are available for this feature:
BLAST of C2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT91.642e-724.51synaptotagmin 9 [Source:HGNC Symbol;Acc:HGNC:19265... [more]
SYT25.304e-723.94synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
SYT25.304e-723.94synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
SYT76.831e-724.70synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
FO681492.28.551e-724.41synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snt-61.043e-1025.18SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
snt-31.310e-823.27SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
snt-31.310e-823.27SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:Q965S5... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Syt123.862e-621.50gene:FBgn0261085 transcript:FBtr0331598[more]
Syt123.862e-621.50gene:FBgn0261085 transcript:FBtr0073767[more]
Syt14.593e-622.79gene:FBgn0004242 transcript:FBtr0332218[more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a5.199e-1027.10synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt9b2.350e-825.40synaptotagmin IXb [Source:ZFIN;Acc:ZDB-GENE-040822... [more]
syt127.050e-822.89synaptotagmin XII [Source:ZFIN;Acc:ZDB-GENE-081022... [more]
syt5b9.307e-824.90synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
syt5b1.010e-724.90synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk71.338e-1028.52cyclin-dependent kinase 7 [Source:Xenbase;Acc:XB-G... [more]
e2f48.050e-725.86E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
SYT98.393e-724.60synaptotagmin 9 [Source:NCBI gene;Acc:100497543][more]
SYT58.570e-724.14synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
SYT58.885e-724.38synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt92.261e-724.59synaptotagmin IX [Source:MGI Symbol;Acc:MGI:192637... [more]
Syt23.761e-723.94synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt23.761e-723.94synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt11.283e-626.24synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt11.283e-626.24synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
back to top
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q925B4|SYT8_RAT9.618e-1124.30Synaptotagmin-8 OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|P24507|SY63_DIPOM1.443e-827.71Synaptotagmin-C OS=Diplobatis ommata OX=1870830 GN... [more]
sp|Q5R4J5|SYT1_PONAB8.608e-825.48Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE... [more]
sp|P41823|SY65_APLCA3.151e-726.18Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=... [more]
sp|Q86SS6|SYT9_HUMAN7.884e-724.51Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE... [more]
back to top
BLAST of C2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183STS91.854e-1426.15Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7LB342.948e-1225.19Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A0X3PI475.584e-1225.78Synaptotagmin-1 OS=Schistocephalus solidus OX=7066... [more]
A0A3P6U2I21.583e-1126.61Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A3P6U0B43.207e-1126.73Uncharacterized protein OS=Dibothriocephalus latus... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a1.415e-1023.94synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt5a1.462e-1023.94synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt1b6.929e-1025.60synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
syt1b7.318e-1025.85synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
ENSAMXT00000017640.28.775e-826.40synaptotagmin-1-like [Source:NCBI gene;Acc:1030358... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO317464.586e-825.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437044.675e-624.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a7.998e-1126.51synaptotagmin-1 [Source:NCBI gene;Acc:101166053][more]
ENSORLT00000042397.14.793e-924.91synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
ENSORLT00000008980.21.660e-825.71synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
syt2a4.875e-825.00synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt2a4.875e-825.00synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
back to top
BLAST of C2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002888.10.000e+099.20SMESG000002888.1[more]
SMESG000002889.11.394e-5434.36SMESG000002889.1[more]
SMESG000011583.13.536e-1126.49SMESG000011583.1[more]
SMESG000041533.15.629e-1125.72SMESG000041533.1[more]
SMESG000025329.13.407e-825.09SMESG000025329.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018383 ID=SMED30018383|Name=C2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1213bp
TTAGTCGATGCTTAATAAGTCAGATTTTATTAATTTATATGGTTAAAAAA
ATTGAAAAAAAATGAATTCTGAAACAAGTACAGAACGGTTTAGTTTTAGT
ACATCTCAACCATTCAATGTGACAGCTTCAAGCTCAATTTTAGGATATTT
GGGCAGCATCGCAAAATATTGGAATATATCCGTTCGGACATTGGTCATAA
TTCTTGTTGCACTGGGATTGGTTATAATTATTATTATATTCGCGTTAATT
TTTTGGATTCAAAAGAAAAGAGGTCAAATTAAAAAGTCGTGGAAATACAA
AAAAGAACCCCAAATCCCGTTTAATGATGATGATTTTGAAAAGTATGATT
CCCCATTTGGTTACATTGATATGAATGTGATGTATGATAAGAAAAAGAAA
AAACTGAAGATTCAGAACTTAACTGTATGTAACATTTCAGTCATCGGAAC
AGATATTCCTGATTGTTTTATCAAAATCTTTCTGAAAGGTAAAGATGGAA
AAAGACTCCAGCAAAAAATGACAAAAACTATTGACGATAATCTCAATCCG
ACTTTTCCAGAAATTTTCAGCTTAAATGTGGAAAATCTGGATACCGAAAT
AGTATATTTTCAAGTATTTGATGAAAATCTCAACGGAAATGACTATCCGA
TGGGAGATGGAGAATTGGTGCTGAATAAGCTACCTCAAGAGAATTTTGTA
GGTTTTGTGTATCCGACATATGTCATCCTCAAAGCTCCTACAGAAGTGCT
GGGCTGTGGGGATGTATGTGTCATCTTAACATTTAACCCGCCAAAATTAA
AGATAAGTATTTTGGAAGCGAAAAATATATCATTTCAGTATGGAACCAAA
AACCATTTACCCTCCGTTTACTGTGTAGTAAAAGTTTTTGTGAATGGACA
CAAAAAGAAAACATTTAAATCAAGGTCAGTAAGCAACACGAAAAATCCTT
ACTTCATGGAAACGTTTACCATGAATATGCTTTCAAAAGACTTTGAGGTA
GCAGTTATAAAGGTTGAAATGCACGAGACCATAGCAGGAAGAATTCCTAA
GAGAATTGGTAAATTGTGCATTGGAAACCAATTTTTTAATCCATTTATTA
ACGAATTGGGAGTTCAACATCACAAAACAGTGCTGAAAGACTGGAAAAAA
CCTCATGCTATGTGGCACTCACTTATTAAAGGATGAGTTTTCCATGAAAT
TATATATTTTTAC
back to top

protein sequence of SMED30018383-orf-1

>SMED30018383-orf-1 ID=SMED30018383-orf-1|Name=SMED30018383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=375bp
MNSETSTERFSFSTSQPFNVTASSSILGYLGSIAKYWNISVRTLVIILVA
LGLVIIIIIFALIFWIQKKRGQIKKSWKYKKEPQIPFNDDDFEKYDSPFG
YIDMNVMYDKKKKKLKIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQ
QKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDG
ELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFNPPKLKISI
LEAKNISFQYGTKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYFME
TFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELG
VQHHKTVLKDWKKPHAMWHSLIKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR030539SYT15
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 119..216
e-value: 0.0017
score: 27.6
coord: 245..354
e-value: 0.0018
score: 27.5
IPR000008C2 domainPFAMPF00168C2coord: 245..337
e-value: 9.4E-7
score: 29.1
coord: 119..207
e-value: 2.1E-7
score: 31.2
IPR000008C2 domainPROSITEPS50004C2coord: 114..201
score: 9.731
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 91..213
e-value: 7.4E-14
score: 53.6
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 231..373
e-value: 6.1E-13
score: 50.8
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 95..190
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 106..372
NoneNo IPR availableCDDcd00030C2coord: 133..211
e-value: 1.07111E-10
score: 55.9211
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 231..319
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 93..218
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
IPR030539Synaptotagmin-15PANTHERPTHR10024:SF234SYNAPTOTAGMIN-15coord: 106..372
IPR030539Synaptotagmin-15PANTHERPTHR10024:SF234SYNAPTOTAGMIN-15coord: 95..190