G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30018368
Length (bp)1048
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30018368) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30018368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30018368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30018368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018368h1SMcG0021706 dd_Smed_v4_33283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018368h1SMcG0021706 dd_Smed_v4_33283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018368h1SMcG0021706 dd_Smed_v4_33283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4E0RDS9 (Rhodopsin orphan GPCR OS=Fasciola hepatica OX=6192 GN=D915_002290 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 3.323e-88
Identity = 164/391 (41.94%), Postives = 221/391 (56.52%), Query Frame = 1
Query:   61 YFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTL-LIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAI--------------------------------RQPIENNLKI---------KAVSINSLCADINIQNHHRSLGNIEIRRGMNTCDV----------------------QKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREF 1041
            YFL+WYL  V   G  GTVFCLVFL LS+LFP +MLLWLVSIC+GD +I++ E +WM+ KV+  +D+RD+N+V CVLHT  SNY +YWSAYMQ ++S+QR    I P+RAR   P  + L  +W ++++ +V P + Y +YWRV +GDCDPP    F +T+L D IIW +IPL  MT  TAIICW I                                R  + N + I          + S N +   ++ QN  +    +  R  MN  D                        +R+   + A H+T LLI MNIWY+I+TYPL+IY M LNF   ++ +    HKF YYL RS+C+LN+CSNWIFYCA+G++FR +    I QI R F
Sbjct:   58 YFLKWYLPFVVGVGSFGTVFCLVFLFLSRLFPANMLLWLVSICVGDFLILVMEGIWMLLKVWLNYDIRDINNVACVLHTSFSNYLYYWSAYMQCMLSMQRAYLIIRPLRARGSGPNMKWLAFVWTSISVLLVIPMLPYPLYWRVIDGDCDPPRESLFRITTLSDFIIWSLIPLIGMTSATAIICWNIFRIRRSFQSGGITAFAQNNSSHSTLTYVCPPTRSSLPNRMSILERDRLFIRSSRSQNRITNRVSQQN--KLAPAVNARNTMNRLDKTSIFTDNTVAFVRPVSFAHNNQGQRHGSTDNAGHVTRLLICMNIWYMISTYPLMIYLMFLNFI--TKDMDRDIHKFMYYLSRSLCFLNSCSNWIFYCASGRLFRQR----IKQICRRF 440          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267DN13 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001214g1 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 7.504e-86
Identity = 142/333 (42.64%), Postives = 210/333 (63.06%), Query Frame = 1
Query:   46 SYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRV-RNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHHRSLGNIEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQ---TISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIY 1032
            S L  YFL WYL ++ T G  G VFC++F+ +S++FPK + +WLVSIC GD MI+I + L +  K+ + +D  D   V+C L ++ S++FF+WSAY QA MSIQR +F   P+R+R +   KR +  W T+T  ++FP+I Y+IYW + R  DC+P    ++ VT+L  +I WGIIPL +M ++T  I + + +    N K  A + +   +D+         G +          +  R    +   H+T LL+ MN++Y+ TT+PLLIY M LNF  ++Q   +I+ S HKFYYYLFRSIC+LNA  NW+FYCAAGKVFR K M+I+++I+
Sbjct:   29 SGLTRYFLIWYLPLILTIGTFGAVFCMLFIFMSRMFPKIIQVWLVSICFGDFMILIWDVLRLFLKLAFGYDYIDQGVVICKLQSYFSSFFFHWSAYNQAAMSIQRLVFIASPLRSRTILNTKRVMTTWATMTFLLLFPNITYLIYWHIGRKSDCEPVDKWFYYVTTLVHLIAWGIIPLASMVVSTGCISYRLIRYRRGNFK-AAKTKDGRGSDVG--------GGVP-----QPAVIGGRRHGSDQNAHVTRLLVSMNLFYLFTTFPLLIYMMYLNFVKDNQVGKSIAKSLHKFYYYLFRSICFLNASLNWVFYCAAGKVFRQKAMQILYRIF 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267GDB7 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001214g3 PE=4 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.711e-83
Identity = 140/334 (41.92%), Postives = 203/334 (60.78%), Query Frame = 1
Query:   43 FSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRV-RNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHHRSLGNIEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQ---TISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIY 1032
             S L  YFL WYL ++ T G  G VFC++F+ +S++FPK + +WLVSIC GD MI+I + L +  K+ + +D  D   V+C L ++ S++FF+WSAY QA MSIQR +F   P+R+R +   KR +  W T+T  ++FP+I Y+IYW + R  DC+P    ++ VT+L  +I WGIIPL +M ++T  I + + +    N K                     +G               R    +   H+T LL+ MN++Y+ TT+PLLIY M LNF  ++Q   +I+ S HKFYYYLFRSIC+LNA  NW+FYCAAGKVFR K M+I+++I+
Sbjct:   84 LSGLTRYFLIWYLPLILTIGTFGAVFCMLFIFMSRMFPKIIQVWLVSICFGDFMILIWDVLRLFLKLAFGYDYIDQGVVICKLQSYFSSFFFHWSAYNQAAMSIQRLVFIASPLRSRTILNTKRVMTTWATMTFLLLFPNITYLIYWHIGRKSDCEPVDKWFYYVTTLVHLIAWGIIPLASMVVSTGCISYRLIRYRRGNFKAAKTKDGRGSDGGGGVPQPAVIGG--------------RRHGSDQNAHVTRLLVSMNLFYLFTTFPLLIYMMYLNFVKDNQVGKSIAKSLHKFYYYLFRSICFLNASLNWVFYCAAGKVFRQKAMQILYRIF 403          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183B2S4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13509 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 7.690e-83
Identity = 149/372 (40.05%), Postives = 210/372 (56.45%), Query Frame = 1
Query:   61 YFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLI-WFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIE--------------NNLKIKAVSINSLCADI-----------------NIQNHHRSLGNIEI--------RR-------GMNTCDVQKRNTKR--EAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQI 1029
            YFL+WYL +V T G  G+VFC+VFL  S++FPK+M +WL+SICIGD +I+  E +WM+ KV+Y FD+RDVND LC+LHT  SNY FYWSAY+Q  +S+QRC   + P+     F   R LLI  F  ++ ++ P + Y IYWRV +GDCDP +   F +T++CD++ WG+IP+  M  +T II   + Q  +              N L +   +   L   +                 +++N  +S+  I +        RR        M     Q  + +R  +  NH+T LLI MN  Y+ + YPL+IYF+ LNF  +S  +    H+F YYLFRS C+LNACSNWIFYC AG  FR +   +   I
Sbjct:   38 YFLQWYLPLVITLGFFGSVFCMVFLTRSQMFPKNMRIWLISICIGDFLILAMEGIWMLLKVWYSFDIRDVNDTLCILHTAFSNYLFYWSAYVQCFVSMQRCYLVLKPLHVNAQFLSARNLLICLFLTSVLLIVPILPYAIYWRVIDGDCDPVNDDIFRLTTVCDLVFWGLIPVVLMATSTVIIWRNLLQRRQMFDSLGNFKPGARINGLDLTGTNNGGLPKKVSRPKRHSVAVCRMQIHDDVKNRSKSVAKILVSTPNTSPSRRVSQFALPSMKIACGQGNSKRRGTDGNNHVTLLLICMNFVYMTSVYPLIIYFICLNFIFHS--LDKDIHRFIYYLFRSFCFLNACSNWIFYCVAGGTFRRRIKHLFRLI 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A504YFZ4 (Rhodopsin orphan GPCR OS=Fasciola gigantica OX=46835 GN=FGIG_04224 PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.187e-82
Identity = 158/391 (40.41%), Postives = 217/391 (55.50%), Query Frame = 1
Query:   61 YFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTL-LIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPL-GTMTITTAI-------------------------------ICWAIRQPIENNLKI---------KAVSINSLCADINIQNHHRSLGNIEIRRGMNTCD----------------------VQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREF 1041
            YFL+WYL  V   G  GTVFCLVFL LS+LFP +MLLWLVSIC+GD +I++ E +WM+ KV+  +D+RD+N+V CVLHT  SNY +YWSAYMQ ++S+QR    I P+RAR   P  + L  +W ++++ +V P + Y +YWRV +GDCDPP    F +T+L D IIW +IPL G  + T  I                               +C   R  + N +            + + N +   ++ QN       +  R+ MN  D                        +R+   + A H+T LLI MNIWY+I+TYPL+IY M LNF I  + +    HKF YYL RS+C+LN+CSNWIFYCA+G++FR +    I QI R F
Sbjct:   58 YFLKWYLPFVVGVGSFGTVFCLVFLFLSRLFPANMLLWLVSICVGDFLILVMEGIWMLLKVWLNYDIRDINNVACVLHTSFSNYLYYWSAYMQCMLSMQRAYLIIRPLRARGSGPNMKWLAFVWTSISVLLVIPMLPYPLYWRVIDGDCDPPRESLFRITTLSDFIIWSLIPLIGMTSATAIICWNIFRIRRSFQSGGITAFAQNNSSHSTLTYVCPPTRSSLPNRISTLERDRLFIRSSRTQNRITNRVSQQN--VLAPAVNARKTMNRLDKTSIFTDNTVAFVRPVSFAHNNQGQRHGSTDNAGHVTRLLICMNIWYMISTYPLMIYLMFLNFII--KDMDRDIHKFMYYLSRSLCFLNSCSNWIFYCASGRLFRQR----IKQICRRF 440          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000081941.1 (SMESG000081941.1)

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 347/349 (99.43%), Postives = 348/349 (99.71%), Query Frame = 1
Query:    1 NSPISFECQTESIPFSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHHRSLGNIEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREFQC 1047
            NSPISFECQTESIPFSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHH SLGN+EIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREFQC
Sbjct:   30 NSPISFECQTESIPFSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHHPSLGNVEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREFQC 378          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000058719.1 (SMESG000058719.1)

HSP 1 Score: 308.916 bits (790), Expect = 4.649e-103
Identity = 160/345 (46.38%), Postives = 225/345 (65.22%), Query Frame = 1
Query:   52 LCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICW-----------AIRQP--IENNLKIKAVSINSLCADINIQNH----HRSLGNIEIRRGMNTCDVQ-KRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIY 1032
            +C Y+L W L ++   G+LG++FCL+FL +SKLFP+++LLWL+SIC+GD MIII +TLWM+ K++   D+RDVND +C +H FLSNYFFYWSAYMQALMS+QR    + PI+AR      R  +IW  V++ +V PHI Y+ +WR+ +GDCDP  SK +  T+LCDMIIWGIIP  +M  +T++ICW           +I +P  I + ++ +  S ++     N QN      +S+ N  I     +   Q  R+     A H+T LL+ MNIWY+ITT+P LI+ M LNF   +  I   + KFYY+LFRS  +LNACSNW FYCA GK+FR+    +I +++
Sbjct:    1 MCKYYLSWILPLIMLVGVLGSIFCLLFLTMSKLFPRTLLLWLISICVGDFMIIILDTLWMLLKMWIGLDIRDVNDFICAVHKFLSNYFFYWSAYMQALMSLQRVYLILRPIQARSSLNMSRMTIIWGLVSIVLVLPHIIYLTHWRIIDGDCDPYDSKNYIFTTLCDMIIWGIIPFLSMVGSTSVICWNICKYQSNFYSSISKPSIIYSFVRSRTFSCSN-HETFNTQNDMELLEKSIDNASIWSSPGSLRQQSSRHGGNNVARHVTQLLVSMNIWYMITTFPFLIFLMYLNFV--NPKIDEWTRKFYYFLFRSFAFLNACSNWFFYCATGKLFRSTAKMVIMKLF 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000035253.1 (SMESG000035253.1)

HSP 1 Score: 272.707 bits (696), Expect = 1.423e-88
Identity = 149/357 (41.74%), Postives = 216/357 (60.50%), Query Frame = 1
Query:   37 IPFSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAII----CWAIRQPIENNLKIKAVSINSLCADINI-------------------------QNHHRSLGNIEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEII 1020
            + F  +C ++L W L ++   G++G+VFCL+FL  SKLFPK++LLWLVSIC+ D+MI++ + LWM+ K++  FD+RD+N+ LC+ H FLSNYFFYWSAYMQ ++SIQR    + P++AR      R +++W  +++ ++FPH+ Y++ WRVR GDCDP  S  F VTSLCD+IIWGIIP   M I+T II    C    +     L    V  + +  + +                          Q ++   G+ E     N     +++   + A H+T LLI MN+WY++TT+PLLI+ + +NF      I+S   KF YYL RS  + NACSNWIFYCAAGK+FR    +I+
Sbjct:   23 LQFRMMCKFYLSWVLPMIIIVGIVGSVFCLIFLLFSKLFPKNLLLWLVSICVADLMILLLDGLWMLLKMWIGFDIRDINNFLCISHKFLSNYFFYWSAYMQTMVSIQRAYLIMRPLQARTSLVLPRLVIVWIGLSVLLIFPHVIYVVKWRVRKGDCDPQDSSDFHVTSLCDLIIWGIIPFLAMVISTCIISINVCTFQSRTFAPRLSTPKVVYSFVRNNPSTFIGRTQTVNPSESSSNNSHSMKFIKQINYGHEGSPEF-LSQNYVSPGRKHGGVDTAKHVTQLLIGMNLWYLLTTFPLLIFLIYINFI--DPDINSWKRKFLYYLLRSFSFYNACSNWIFYCAAGKLFRTTAKQIL 376          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042257.1 (SMESG000042257.1)

HSP 1 Score: 216.083 bits (549), Expect = 2.928e-67
Identity = 130/335 (38.81%), Postives = 190/335 (56.72%), Query Frame = 1
Query:   61 YFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTFLSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSIVFPHIYYIIYWRV----RNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTAIICWAIRQPIENNLKIKAVSINSLCADINIQNHHRSLGNIEIRRGMNTCDVQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTIN--SQTISSSSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREFQC 1047
            Y+L WYL I    G++G + C  FL +SK+FPK++L+W++SICIGD+MI++ + L M+ KV+  FD+RD N+ +C +H F SNYF YWS YMQ  MSIQR I  + P++AR +F  K  L +W +V++ +  P + Y++YW+V    +  DC P +   + + ++ D+ IWGIIPL TM  +T  I + + +              S     + Q+    L N   RR              E A  +T LLI MNI Y I+ +PLLIY + LN   N   +++    HK  YY  RSICYL++  NW+FYC  G  FR + ++II    R F C
Sbjct:   27 YYLNWYLPITIFVGIIGGIVCATFLIISKIFPKNVLIWMLSICIGDLMILLLDALRMLLKVWIGFDIRDFNNTICKMHNFFSNYFIYWSGYMQTCMSIQRLISILNPLKARGMFTNKLVLSVWVSVSVLLTGPMVPYLLYWQVSEEKQGKDCSPVNKNLYTLITVLDITIWGIIPLLTMITSTIGISFVVFKS------------TSEVGTFSSQSQSVKLVNNSSRR--------HAQVNNERAWQVTRLLICMNILYFISNFPLLIYQIYLNAGGNKVDKSMPQQLHKTIYYTLRSICYLSSSWNWVFYCVGGHQFRTRALQII----RRFNC 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042263.1 (SMESG000042263.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.377e-12
Identity = 33/76 (43.42%), Postives = 59/76 (77.63%), Query Frame = 1
Query:   61 YFLRWYLIIVTTFGLLGTVFCLVFLHLSKLFPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCV 288
            Y+L WYL ++   G++G + C +FL +SK+FPK++L+W++SICIGD+MI++ + L M+ K++++FD+RD+    C+
Sbjct:   31 YYLSWYLPVIIFVGIIGGIVCGIFLIISKIFPKNVLIWMLSICIGDLMILLFDALRMLFKMWFRFDIRDLTLTSCL 106          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RDS93.323e-8841.94Rhodopsin orphan GPCR OS=Fasciola hepatica OX=6192... [more]
A0A267DN137.504e-8642.64G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A267GDB71.711e-8341.92G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A183B2S47.690e-8340.05G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A504YFZ41.187e-8240.41Rhodopsin orphan GPCR OS=Fasciola gigantica OX=468... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081941.10.000e+099.43SMESG000081941.1[more]
SMESG000058719.14.649e-10346.38SMESG000058719.1[more]
SMESG000035253.11.423e-8841.74SMESG000035253.1[more]
SMESG000042257.12.928e-6738.81SMESG000042257.1[more]
SMESG000042263.11.377e-1243.42SMESG000042263.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018368 ID=SMED30018368|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1048bp
AATTCACCAATTTCTTTTGAATGTCAGACAGAAAGTATTCCCTTCTCGTA
TCTTTGCTTTTACTTTTTACGATGGTATCTAATCATCGTGACAACGTTTG
GATTACTTGGTACAGTGTTTTGTTTAGTTTTCTTACATTTGTCAAAGTTG
TTTCCGAAATCAATGTTGCTGTGGTTAGTGAGCATATGTATAGGAGATAT
GATGATAATAATCAACGAGACCTTATGGATGATTGGTAAGGTTTTCTATA
AGTTTGACTTGCGAGATGTCAATGATGTGCTCTGTGTTTTGCACACGTTC
TTGTCAAATTATTTTTTTTATTGGTCAGCATATATGCAAGCATTAATGTC
AATACAAAGATGTATATTCACTATTTTACCAATACGAGCTCGTTTTCTCT
TTCCATATAAGAGAACATTATTAATTTGGTTTACTGTTACTATGTCAATC
GTATTTCCTCACATTTATTATATAATTTACTGGCGAGTAAGAAATGGAGA
TTGTGATCCCCCATCTAGTAAATATTTTGGTGTTACATCGCTGTGTGATA
TGATAATATGGGGTATAATTCCACTTGGAACGATGACTATAACCACGGCA
ATAATTTGCTGGGCAATCAGACAACCCATAGAAAATAACTTGAAAATAAA
AGCTGTCTCTATCAATAGTTTGTGTGCTGATATAAACATACAAAATCATC
ATCGATCTTTGGGAAATATAGAAATTCGGAGAGGAATGAATACGTGTGAC
GTCCAGAAAAGAAACACTAAGCGAGAAGCAGCTAATCATATTACTTACTT
ACTGATTTTTATGAATATTTGGTACATTATCACCACATATCCTTTACTTA
TTTATTTCATGATTCTCAATTTTACAATTAATTCACAAACTATTTCCAGT
TCAAGTCATAAATTCTATTATTATTTGTTTAGATCCATTTGTTATTTGAA
TGCATGTAGCAACTGGATTTTCTATTGTGCAGCGGGGAAAGTATTTCGAA
ATAAAACAATGGAAATAATTCACCAAATCTATCGTGAATTCCAATGCA
back to top

protein sequence of SMED30018368-orf-1

>SMED30018368-orf-1 ID=SMED30018368-orf-1|Name=SMED30018368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
NSPISFECQTESIPFSYLCFYFLRWYLIIVTTFGLLGTVFCLVFLHLSKL
FPKSMLLWLVSICIGDMMIIINETLWMIGKVFYKFDLRDVNDVLCVLHTF
LSNYFFYWSAYMQALMSIQRCIFTILPIRARFLFPYKRTLLIWFTVTMSI
VFPHIYYIIYWRVRNGDCDPPSSKYFGVTSLCDMIIWGIIPLGTMTITTA
IICWAIRQPIENNLKIKAVSINSLCADINIQNHHRSLGNIEIRRGMNTCD
VQKRNTKREAANHITYLLIFMNIWYIITTYPLLIYFMILNFTINSQTISS
SSHKFYYYLFRSICYLNACSNWIFYCAAGKVFRNKTMEIIHQIYREFQC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR24228B2 BRADYKININ RECEPTOR/ANGIOTENSIN II RECEPTORcoord: 21..339
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 27..327
e-value: 9.62513E-10
score: 56.517
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..342
NoneNo IPR availableTMHMMTMhelixcoord: 25..47
NoneNo IPR availableTMHMMTMhelixcoord: 184..206
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 37..325
score: 15.978