6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase

Overview
Name6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase
Smed IDSMED30018359
Length (bp)1759
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (SMED30018359) t-SNE clustered cells

Violin plots show distribution of expression levels for 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (SMED30018359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (SMED30018359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (SMED30018359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018359SMESG000067029.1 Contig4668GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018359SMESG000015713.1 Contig4668GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30018359SMESG000015713.1 dd_Smed_v4_3959_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:HGNC Symbol;Acc:HGNC:8872])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 275/481 (57.17%), Postives = 350/481 (72.77%), Query Frame = 2
Query:  107 SPKIGRIKRITSVDVSPCSIPYTCNN---RVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            SP++G +   T   +    IP++  +   + R+ S  P     +F N     +++M+GLPARGKTYIS K+TRY NW+G  T+VFN+G YRR+    YK ++FF P N+EA  IR   A  AL D+ ++L + EG +AVFDATNTTRERRS+IL+     G +V F+ES+C+DP +I  NI +VK+ SPDY+  ++++ +EDF  RI  YE  YQPLDEE D   S+I+I++ G +Y+VN+V  ++QSR VYY+MNI    R+IY+CRHGESELN+ GRIGG+S LS RG ++A  LA FI +Q I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N+D  R   EAL TVP H
Sbjct:    2 SPEMGEL---TQTRLQKIWIPHSSGSSRLQRRRGSSIP-----QFTN--SPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVS-YKNYEFFLPDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGESELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAH 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Match: PFKFB4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:HGNC Symbol;Acc:HGNC:8875])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 269/429 (62.70%), Postives = 324/429 (75.52%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IVM+GLPARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+ I       G +  F+ES+C DPEVI ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDE+ D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EFA+ LA FI++Q I +LKVWTS MKRT +TA+ +     EQWK LNEIDAG CEEMTYEEIQ N+P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ ++LPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RP  EAL TVP H
Sbjct:   41 LIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVP-YEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAH 468          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Match: PFKFB4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:HGNC Symbol;Acc:HGNC:8875])

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 263/429 (61.31%), Postives = 318/429 (74.13%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IVM+GLPARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+ I       G +  F+ES+C DPEVI ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDE+ D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EFA+ LA FI++Q I +LKVWTS MKRT +TA+ +     EQWK       G CEEMTYEEIQ N+P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ ++LPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RP  EAL TVP H
Sbjct:   41 LIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSEEGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVWTSQMKRTIQTAEALGVP-YEQWK-------GVCEEMTYEEIQDNYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAH 461          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Match: PFKFB2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 [Source:HGNC Symbol;Acc:HGNC:8873])

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 257/413 (62.23%), Postives = 311/413 (75.30%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLD-EEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTN 1486
            +IVMIGLPARGKTY+SKK+TRY NW+GV T+VFN+G YRR+  + YK +DFF   N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERR MIL        +V F+ES+CDDP+VI ANILEVKV SPDY   N++  +EDF  RI  Y+  Y+PLD + +DKD SFI++ N G ++LVN+V   +QS+IVYY+MNI    RTIY+CRHGESE NL G+IGG+S LS RG +FA+ L  F+  QEI +LKVWTS +KRT +TA+ +     EQWK LNEIDAG CEEMTY EI+  +P EFA RDQ+K+ +RYP GESYQDLV RLEPVIMELERQ NVLVI HQAV RCLLAYFLD+  DELPYLR PLHT+ KLTP AY C VE I L+++AV+THR KPTN
Sbjct:   40 LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVP-YEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTN 451          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Match: PFKFB2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 [Source:HGNC Symbol;Acc:HGNC:8873])

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 260/429 (60.61%), Postives = 316/429 (73.66%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLD-EEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDED-----RPSFEAL 1519
            +IVMIGLPARGKTY+SKK+TRY NW+GV T+VFN+G YRR+  + YK +DFF   N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERR MIL        +V F+ES+CDDP+VI ANILEVKV SPDY   N++  +EDF  RI  Y+  Y+PLD + +DKD SFI++ N G ++LVN+V   +QS+IVYY+MNI    RTIY+CRHGESE NL G+IGG+S LS RG +FA+ L  F+  QEI +LKVWTS +KRT +TA+ +     EQWK LNEIDAG CEEMTY EI+  +P EFA RDQ+K+ +RYP GESYQDLV RLEPVIMELERQ NVLVI HQAV RCLLAYFLD+  DELPYLR PLHT+ KLTP AY C VE I L+++AV+THR KPT  +       RPS  +L
Sbjct:   40 LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVP-YEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTAAETTLAVRRRPSAASL 467          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Match: pfkb-1.1 (pep chromosome:WBcel235:I:5131460:5134101:1 gene:WBGene00022456.1 transcript:Y110A7A.6a.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pfkb-1.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.787e-157
Identity = 220/428 (51.40%), Postives = 314/428 (73.36%), Query Frame = 2
Query:  233 NNEQKKI--VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLT--QQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIE----VIFLESLCDDPEVIKANILEVKVDSPDYVG-MNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP 1480
            +NEQ ++  VI ++GLPARGKTYIS K+ RY NW+G+ T+ FNVG+YRR+    ++   ++FF P+N   Q IR   A+ A+ D+  +L N EGE+A+ DATNTTR+RR +++E C N   E    V F+ES+CDDP++I +NI EVK++SPDY G M+++EA EDF  RI +Y   Y+PLDE+ D++ S+I++ N G  + V+ V+G++QSR+VY++MNI  + R+IY+ RHGESE N  GR+GG+S LS  G  +A KL  +   +++ + +VW+S   R  +TA  +       E WK L+EIDAG CE +TYE+ ++ +P +FA+RD+DK+++RYP GESY+DLV+RLEPVIMELERQ+NVLVI HQAV RC+LAYF ++++D+LPYL+VPLHTV+KLTP AY C +E    DI+AV+T+R KP
Sbjct:   22 SNEQVRVPNVIALVGLPARGKTYISHKLCRYLNWIGIKTKAFNVGEYRRRACNLEEEGENEFFSPNNARGQKIRDECAKLAIEDMGRYLDNKEGEVAILDATNTTRDRRKLLMEFCRNMMHEPPFRVFFVESVCDDPDIINSNITEVKINSPDYKGIMSQEEAKEDFLKRIENYRMQYEPLDEDHDEELSYIKVINAGKSFYVHNVNGHVQSRVVYFLMNIHLLPRSIYLSRHGESEYNRIGRLGGDSPLSENGLNYAGKLREYFEKEDLDDFRVWSSQKIRAAQTASHLKDLAGHTEFWKCLDEIDAGICEGLTYEDFEARYPKQFAERDKDKYHYRYPSGESYEDLVARLEPVIMELERQSNVLVISHQAVLRCILAYFTNKNRDDLPYLKVPLHTVIKLTPKAYSCEIELFKFDIEAVNTYREKP 449          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Match: pfkb-1.1 (pep chromosome:WBcel235:I:5131288:5134099:1 gene:WBGene00022456.1 transcript:Y110A7A.6a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pfkb-1.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.787e-157
Identity = 220/428 (51.40%), Postives = 314/428 (73.36%), Query Frame = 2
Query:  233 NNEQKKI--VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLT--QQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIE----VIFLESLCDDPEVIKANILEVKVDSPDYVG-MNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP 1480
            +NEQ ++  VI ++GLPARGKTYIS K+ RY NW+G+ T+ FNVG+YRR+    ++   ++FF P+N   Q IR   A+ A+ D+  +L N EGE+A+ DATNTTR+RR +++E C N   E    V F+ES+CDDP++I +NI EVK++SPDY G M+++EA EDF  RI +Y   Y+PLDE+ D++ S+I++ N G  + V+ V+G++QSR+VY++MNI  + R+IY+ RHGESE N  GR+GG+S LS  G  +A KL  +   +++ + +VW+S   R  +TA  +       E WK L+EIDAG CE +TYE+ ++ +P +FA+RD+DK+++RYP GESY+DLV+RLEPVIMELERQ+NVLVI HQAV RC+LAYF ++++D+LPYL+VPLHTV+KLTP AY C +E    DI+AV+T+R KP
Sbjct:   22 SNEQVRVPNVIALVGLPARGKTYISHKLCRYLNWIGIKTKAFNVGEYRRRACNLEEEGENEFFSPNNARGQKIRDECAKLAIEDMGRYLDNKEGEVAILDATNTTRDRRKLLMEFCRNMMHEPPFRVFFVESVCDDPDIINSNITEVKINSPDYKGIMSQEEAKEDFLKRIENYRMQYEPLDEDHDEELSYIKVINAGKSFYVHNVNGHVQSRVVYFLMNIHLLPRSIYLSRHGESEYNRIGRLGGDSPLSENGLNYAGKLREYFEKEDLDDFRVWSSQKIRAAQTASHLKDLAGHTEFWKCLDEIDAGICEGLTYEDFEARYPKQFAERDKDKYHYRYPSGESYEDLVARLEPVIMELERQSNVLVISHQAVLRCILAYFTNKNRDDLPYLKVPLHTVIKLTPKAYSCEIELFKFDIEAVNTYREKP 449          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Match: pfkb-1.1 (pep chromosome:WBcel235:I:5131531:5134099:1 gene:WBGene00022456.1 transcript:Y110A7A.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pfkb-1.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.787e-157
Identity = 220/428 (51.40%), Postives = 314/428 (73.36%), Query Frame = 2
Query:  233 NNEQKKI--VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLT--QQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIE----VIFLESLCDDPEVIKANILEVKVDSPDYVG-MNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP 1480
            +NEQ ++  VI ++GLPARGKTYIS K+ RY NW+G+ T+ FNVG+YRR+    ++   ++FF P+N   Q IR   A+ A+ D+  +L N EGE+A+ DATNTTR+RR +++E C N   E    V F+ES+CDDP++I +NI EVK++SPDY G M+++EA EDF  RI +Y   Y+PLDE+ D++ S+I++ N G  + V+ V+G++QSR+VY++MNI  + R+IY+ RHGESE N  GR+GG+S LS  G  +A KL  +   +++ + +VW+S   R  +TA  +       E WK L+EIDAG CE +TYE+ ++ +P +FA+RD+DK+++RYP GESY+DLV+RLEPVIMELERQ+NVLVI HQAV RC+LAYF ++++D+LPYL+VPLHTV+KLTP AY C +E    DI+AV+T+R KP
Sbjct:   22 SNEQVRVPNVIALVGLPARGKTYISHKLCRYLNWIGIKTKAFNVGEYRRRACNLEEEGENEFFSPNNARGQKIRDECAKLAIEDMGRYLDNKEGEVAILDATNTTRDRRKLLMEFCRNMMHEPPFRVFFVESVCDDPDIINSNITEVKINSPDYKGIMSQEEAKEDFLKRIENYRMQYEPLDEDHDEELSYIKVINAGKSFYVHNVNGHVQSRVVYFLMNIHLLPRSIYLSRHGESEYNRIGRLGGDSPLSENGLNYAGKLREYFEKEDLDDFRVWSSQKIRAAQTASHLKDLAGHTEFWKCLDEIDAGICEGLTYEDFEARYPKQFAERDKDKYHYRYPSGESYEDLVARLEPVIMELERQSNVLVISHQAVLRCILAYFTNKNRDDLPYLKVPLHTVIKLTPKAYSCEIELFKFDIEAVNTYREKP 449          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Match: pfkb-1.1 (pep chromosome:WBcel235:I:5131520:5134099:1 gene:WBGene00022456.1 transcript:Y110A7A.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pfkb-1.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.787e-157
Identity = 220/428 (51.40%), Postives = 314/428 (73.36%), Query Frame = 2
Query:  233 NNEQKKI--VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLT--QQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIE----VIFLESLCDDPEVIKANILEVKVDSPDYVG-MNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP 1480
            +NEQ ++  VI ++GLPARGKTYIS K+ RY NW+G+ T+ FNVG+YRR+    ++   ++FF P+N   Q IR   A+ A+ D+  +L N EGE+A+ DATNTTR+RR +++E C N   E    V F+ES+CDDP++I +NI EVK++SPDY G M+++EA EDF  RI +Y   Y+PLDE+ D++ S+I++ N G  + V+ V+G++QSR+VY++MNI  + R+IY+ RHGESE N  GR+GG+S LS  G  +A KL  +   +++ + +VW+S   R  +TA  +       E WK L+EIDAG CE +TYE+ ++ +P +FA+RD+DK+++RYP GESY+DLV+RLEPVIMELERQ+NVLVI HQAV RC+LAYF ++++D+LPYL+VPLHTV+KLTP AY C +E    DI+AV+T+R KP
Sbjct:   22 SNEQVRVPNVIALVGLPARGKTYISHKLCRYLNWIGIKTKAFNVGEYRRRACNLEEEGENEFFSPNNARGQKIRDECAKLAIEDMGRYLDNKEGEVAILDATNTTRDRRKLLMEFCRNMMHEPPFRVFFVESVCDDPDIINSNITEVKINSPDYKGIMSQEEAKEDFLKRIENYRMQYEPLDEDHDEELSYIKVINAGKSFYVHNVNGHVQSRVVYFLMNIHLLPRSIYLSRHGESEYNRIGRLGGDSPLSENGLNYAGKLREYFEKEDLDDFRVWSSQKIRAAQTASHLKDLAGHTEFWKCLDEIDAGICEGLTYEDFEARYPKQFAERDKDKYHYRYPSGESYEDLVARLEPVIMELERQSNVLVISHQAVLRCILAYFTNKNRDDLPYLKVPLHTVIKLTPKAYSCEIELFKFDIEAVNTYREKP 449          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Match: pfkb-1.1 (pep chromosome:WBcel235:I:5131288:5134032:1 gene:WBGene00022456.1 transcript:Y110A7A.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pfkb-1.1)

HSP 1 Score: 437.958 bits (1125), Expect = 1.747e-149
Identity = 210/407 (51.60%), Postives = 300/407 (73.71%), Query Frame = 2
Query:  233 NNEQKKI--VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKL--TQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICFNCGIE----VIFLESLCDDPEVIKANILEVKVDSPDYVG-MNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAY 1417
            +NEQ ++  VI ++GLPARGKTYIS K+ RY NW+G+ T+ FNVG+YRR+    ++   ++FF P+N   Q IR   A+ A+ D+  +L N EGE+A+ DATNTTR+RR +++E C N   E    V F+ES+CDDP++I +NI EVK++SPDY G M+++EA EDF  RI +Y   Y+PLDE+ D++ S+I++ N G  + V+ V+G++QSR+VY++MNI  + R+IY+ RHGESE N  GR+GG+S LS  G  +A KL  +   +++ + +VW+S   R  +TA  +       E WK L+EIDAG CE +TYE+ ++ +P +FA+RD+DK+++RYP GESY+DLV+RLEPVIMELERQ+NVLVI HQAV RC+LAYF ++++D+LPYL+VPLHTV+KLTP AY
Sbjct:   28 SNEQVRVPNVIALVGLPARGKTYISHKLCRYLNWIGIKTKAFNVGEYRRRACNLEEEGENEFFSPNNARGQKIRDECAKLAIEDMGRYLDNKEGEVAILDATNTTRDRRKLLMEFCRNMMHEPPFRVFFVESVCDDPDIINSNITEVKINSPDYKGIMSQEEAKEDFLKRIENYRMQYEPLDEDHDEELSYIKVINAGKSFYVHNVNGHVQSRVVYFLMNIHLLPRSIYLSRHGESEYNRIGRLGGDSPLSENGLNYAGKLREYFEKEDLDDFRVWSSQKIRAAQTASHLKDLAGHTEFWKCLDEIDAGICEGLTYEDFEARYPKQFAERDKDKYHYRYPSGESYEDLVARLEPVIMELERQSNVLVISHQAVLRCILAYFTNKNRDDLPYLKVPLHTVIKLTPKAY 434          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Match: Pfrx (gene:FBgn0027621 transcript:FBtr0307193)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 313/425 (73.65%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICF-NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP-TNIDEDRPSFEAL 1519
            VI M+GLPARGKT+ISKK+ RY NW+G++TRVFN+G+YRR  T  YK H+FF   N EA  IR+  A +AL+D  DWL + +G +AVFDATN+TR+RR +I +I     G  + F+ES+CDDP++I+ NILEVKV SPDY+ MN +  V DF  RI HYE  YQP+DE  +   SF+++YN G K +V    G+++SRIVYY+MNI    RTIY+ RHGESE NL+G IGG+S+LS+RGH++A  L+ FI  Q+I  L+VWTS MKR  +T   +   + E+WKALNEIDAG CEEMTYE+I+  FP EF  RD +KF +RYP GESY+DLV+RLEPVIMELERQ NVLV+ HQAV RCL AYFLD+S DELPYL VPLHTV+KLTP AY C VE I L IDAVDTHR KP    D   P  + L
Sbjct:   76 VIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQ-ERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGL 499          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Match: Pfrx (gene:FBgn0027621 transcript:FBtr0074715)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 313/425 (73.65%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICF-NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP-TNIDEDRPSFEAL 1519
            VI M+GLPARGKT+ISKK+ RY NW+G++TRVFN+G+YRR  T  YK H+FF   N EA  IR+  A +AL+D  DWL + +G +AVFDATN+TR+RR +I +I     G  + F+ES+CDDP++I+ NILEVKV SPDY+ MN +  V DF  RI HYE  YQP+DE  +   SF+++YN G K +V    G+++SRIVYY+MNI    RTIY+ RHGESE NL+G IGG+S+LS+RGH++A  L+ FI  Q+I  L+VWTS MKR  +T   +   + E+WKALNEIDAG CEEMTYE+I+  FP EF  RD +KF +RYP GESY+DLV+RLEPVIMELERQ NVLV+ HQAV RCL AYFLD+S DELPYL VPLHTV+KLTP AY C VE I L IDAVDTHR KP    D   P  + L
Sbjct:   76 VIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQ-ERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGL 499          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Match: Pfrx (gene:FBgn0027621 transcript:FBtr0074714)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 313/425 (73.65%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICF-NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP-TNIDEDRPSFEAL 1519
            VI M+GLPARGKT+ISKK+ RY NW+G++TRVFN+G+YRR  T  YK H+FF   N EA  IR+  A +AL+D  DWL + +G +AVFDATN+TR+RR +I +I     G  + F+ES+CDDP++I+ NILEVKV SPDY+ MN +  V DF  RI HYE  YQP+DE  +   SF+++YN G K +V    G+++SRIVYY+MNI    RTIY+ RHGESE NL+G IGG+S+LS+RGH++A  L+ FI  Q+I  L+VWTS MKR  +T   +   + E+WKALNEIDAG CEEMTYE+I+  FP EF  RD +KF +RYP GESY+DLV+RLEPVIMELERQ NVLV+ HQAV RCL AYFLD+S DELPYL VPLHTV+KLTP AY C VE I L IDAVDTHR KP    D   P  + L
Sbjct:   76 VIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQ-ERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGL 499          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Match: Pfrx (gene:FBgn0027621 transcript:FBtr0074720)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 313/425 (73.65%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICF-NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP-TNIDEDRPSFEAL 1519
            VI M+GLPARGKT+ISKK+ RY NW+G++TRVFN+G+YRR  T  YK H+FF   N EA  IR+  A +AL+D  DWL + +G +AVFDATN+TR+RR +I +I     G  + F+ES+CDDP++I+ NILEVKV SPDY+ MN +  V DF  RI HYE  YQP+DE  +   SF+++YN G K +V    G+++SRIVYY+MNI    RTIY+ RHGESE NL+G IGG+S+LS+RGH++A  L+ FI  Q+I  L+VWTS MKR  +T   +   + E+WKALNEIDAG CEEMTYE+I+  FP EF  RD +KF +RYP GESY+DLV+RLEPVIMELERQ NVLV+ HQAV RCL AYFLD+S DELPYL VPLHTV+KLTP AY C VE I L IDAVDTHR KP    D   P  + L
Sbjct:   76 VIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQ-ERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGL 499          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Match: Pfrx (gene:FBgn0027621 transcript:FBtr0074713)

HSP 1 Score: 523.087 bits (1346), Expect = 0.000e+0
Identity = 252/425 (59.29%), Postives = 313/425 (73.65%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWL-NSEGELAVFDATNTTRERRSMILEICF-NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKP-TNIDEDRPSFEAL 1519
            VI M+GLPARGKT+ISKK+ RY NW+G++TRVFN+G+YRR  T  YK H+FF   N EA  IR+  A +AL+D  DWL + +G +AVFDATN+TR+RR +I +I     G  + F+ES+CDDP++I+ NILEVKV SPDY+ MN +  V DF  RI HYE  YQP+DE  +   SF+++YN G K +V    G+++SRIVYY+MNI    RTIY+ RHGESE NL+G IGG+S+LS+RGH++A  L+ FI  Q+I  L+VWTS MKR  +T   +   + E+WKALNEIDAG CEEMTYE+I+  FP EF  RD +KF +RYP GESY+DLV+RLEPVIMELERQ NVLV+ HQAV RCL AYFLD+S DELPYL VPLHTV+KLTP AY C VE I L IDAVDTHR KP    D   P  + L
Sbjct:   76 VIAMVGLPARGKTFISKKLARYLNWIGISTRVFNLGEYRRHATTAYKSHEFFRADNEEAMAIRNRCANQALHDSCDWLLSGQGSIAVFDATNSTRDRRQLIHDIVVKQHGFRLFFVESICDDPQIIEQNILEVKVSSPDYLNMNTELVVRDFLQRIEHYEERYQPIDEVTESHLSFMKVYNAGKKVVVYNNEGHVESRIVYYLMNIHITPRTIYLTRHGESEYNLSGLIGGDSNLSARGHQYANALSTFIAQQQIDGLRVWTSWMKRAIQTVADVKAPQ-ERWKALNEIDAGHCEEMTYEQIKEKFPEEFKARDVNKFAYRYPRGESYEDLVARLEPVIMELERQGNVLVVSHQAVLRCLFAYFLDKSADELPYLYVPLHTVIKLTPVAYGCKVEHIKLPIDAVDTHRPKPKIPGDVSEPGLDGL 499          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5664])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 269/430 (62.56%), Postives = 329/430 (76.51%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IVM+GLPARGKTYISKK+TRY NW+GV T+VFN+G YRR++ Q YK ++FF P N EA TIR   A  AL D+ ++   E G++AVFDATNTTR+RR +I+      G +V F+ES+CDDPE+I+ANI++VK+ SPDY   +K+EA+ DF  RI  Y+ +Y PLD+E D   S+I+I+N G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+S LSS+G ++A+ L+ FI  Q I  LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ   P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S D LPYL+ PLHTVLKLTP AY C VE   L+I AV+THR KP N++  R   EAL TVP HL
Sbjct:   42 MIVMVGLPARGKTYISKKLTRYLNWIGVPTQVFNLGQYRREVVQTYKNYEFFRPDNEEAMTIRRSCAASALKDIGNYFAKEQGQVAVFDATNTTRDRRGVIISFAKERGYKVFFIESICDDPEIIEANIMQVKLSSPDYENYDKEEALVDFLKRIDCYKVSYVPLDDEKDSHLSYIKIFNVGSRYLVNRVQDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSGLSSQGQKYAKALSEFIRGQSIKELKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEAHPEEFALRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADSLPYLKCPLHTVLKLTPLAYGCKVESFYLNIQAVNTHRDKPINVNITRQPEEALTTVPEHL 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5664])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/430 (62.56%), Postives = 329/430 (76.51%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IVM+GLPARGKTYISKK+TRY NW+GV T+VFN+G YRR++ Q YK ++FF P N EA TIR   A  AL D+ ++   E G++AVFDATNTTR+RR +I+      G +V F+ES+CDDPE+I+ANI++VK+ SPDY   +K+EA+ DF  RI  Y+ +Y PLD+E D   S+I+I+N G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+S LSS+G ++A+ L+ FI  Q I  LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ   P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S D LPYL+ PLHTVLKLTP AY C VE   L+I AV+THR KP N++  R   EAL TVP HL
Sbjct:   29 MIVMVGLPARGKTYISKKLTRYLNWIGVPTQVFNLGQYRREVVQTYKNYEFFRPDNEEAMTIRRSCAASALKDIGNYFAKEQGQVAVFDATNTTRDRRGVIISFAKERGYKVFFIESICDDPEIIEANIMQVKLSSPDYENYDKEEALVDFLKRIDCYKVSYVPLDDEKDSHLSYIKIFNVGSRYLVNRVQDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSGLSSQGQKYAKALSEFIRGQSIKELKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEAHPEEFALRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADSLPYLKCPLHTVLKLTPLAYGCKVESFYLNIQAVNTHRDKPINVNITRQPEEALTTVPEHL 457          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Match: pfkfb4b (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4b [Source:ZFIN;Acc:ZDB-GENE-031031-4])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 278/487 (57.08%), Postives = 352/487 (72.28%), Query Frame = 2
Query:  104 ESPKIGRIKRITSVDVSPCSIPY-TCNNRVRKISVCPPDHHREFNNEQKKI-------VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            E P      R++S +    +IP     N +RKI +   +   E +  QK++       +IV +GLPARGKTYISKK+TRY NW+GV T  FNVG YRR+  + YK  +FF P N E   IR   A  AL D+ ++L+ EG ++AVFDATNTTRERR++I++     G +V F+ES+C+DP+VI  NI++VK+ SPDY   N +EA++DF  RI+ YE++YQPLDE  D++ S+I+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS RG EFA  L  FI +Q I +LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEEM YEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N++  R   EAL TVP H
Sbjct:   18 EEPGHDNTARMSSSEDIIMAIPRELTQNPLRKIWMPCKNGLPEKHISQKRVCMTNCPTLIVTVGLPARGKTYISKKLTRYLNWIGVPTHEFNVGQYRRECVKIYKSFEFFRPDNEEGLKIRKQCASAALNDVREYLSVEGGQVAVFDATNTTRERRNIIMKFADQNGYKVFFVESVCEDPKVIAENIVQVKLGSPDYTDRNTEEAIQDFMKRIKCYESSYQPLDENLDRELSYIKIMDVGQRYLVNRVLDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNVRGRIGGDSGLSHRGKEFAHSLGRFIQDQNIKDLKVWTSQMKRTIQTAESLGVP-YEQWKALNEIDAGVCEEMMYEEIQEHYPQEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHRDKPENVNISRLPEEALLTVPAH 503          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Match: pfkfb4a (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4a [Source:ZFIN;Acc:ZDB-GENE-051120-51])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 264/430 (61.40%), Postives = 325/430 (75.58%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IV +GLPARGKTYISKK+TRY NW+ V T+ FNVG YRR+  + YK  +FF P N E   IR   A  AL D+  +L  EG ++AVFDATNTTRERR  I+      G +V F+ES+C+DP+VI  NI++VK+ SPDY   N +EAV DF  RI+ YE +YQPLDEE D+D SFI+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS+RG ++A  L  FI +Q I  LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEE+ YEEIQ  +P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L ++AV+THR +PTN++  R + +ALQTVP HL
Sbjct:   25 LIVTVGLPARGKTYISKKLTRYLNWIDVPTKEFNVGQYRRECVKIYKSFEFFRPDNEEGLKIRKQCALAALNDVRQFLTDEGGQVAVFDATNTTRERRDTIIRFAEQNGFKVFFVESVCEDPDVIAENIVQVKLGSPDYTHCNTEEAVADFMKRIKCYENSYQPLDEELDRDLSFIKIIDVGRRYLVNRVQDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNIKGRIGGDSGLSARGKKYAETLGQFIQSQNIHELKVWTSQMKRTIQTAEAVGVP-YEQWKALNEIDAGVCEELMYEEIQQRYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKTAEELPYLKCPLHTVLKLTPVAYGCKVESIDLKVEAVNTHRDRPTNVNVHRTTEDALQTVPSHL 453          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Match: pfkfb4b (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4b [Source:ZFIN;Acc:ZDB-GENE-031031-4])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 265/429 (61.77%), Postives = 329/429 (76.69%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IV +GLPARGKTYISKK+TRY NW+GV T  FNVG YRR+  + YK  +FF P N E   IR   A  AL D+ ++L+ EG ++AVFDATNTTRERR++I++     G +V F+ES+C+DP+VI  NI++VK+ SPDY   N +EA++DF  RI+ YE++YQPLDE  D++ S+I+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS RG EFA  L  FI +Q I +LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEEM YEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N++  R   EAL TVP H
Sbjct:   57 LIVTVGLPARGKTYISKKLTRYLNWIGVPTHEFNVGQYRRECVKIYKSFEFFRPDNEEGLKIRKQCASAALNDVREYLSVEGGQVAVFDATNTTRERRNIIMKFADQNGYKVFFVESVCEDPKVIAENIVQVKLGSPDYTDRNTEEAIQDFMKRIKCYESSYQPLDENLDRELSYIKIMDVGQRYLVNRVLDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNVRGRIGGDSGLSHRGKEFAHSLGRFIQDQNIKDLKVWTSQMKRTIQTAESLGVP-YEQWKALNEIDAGVCEEMMYEEIQEHYPQEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHRDKPENVNISRLPEEALLTVPAH 484          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:100488795])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 274/461 (59.44%), Postives = 340/461 (73.75%), Query Frame = 2
Query:  164 IPYTCNN-RVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            IP+ C   + R+ S  P     +F N     +I+M+GLPARGKTYISKK+TRY NW+G+ T+VFNVG YRR++ Q YK ++FF P N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERRS+IL+       +  F+ES+CDDP++I  NI+EVK+ SPDY   ++++ VEDF  RI  Y   YQPL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG +FA  L  F+ +Q+I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ  FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S ++LPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N+D  R   EAL TVP H 
Sbjct:   45 IPHQCERLQQRRGSSIP-----QFTN--SPTMIIMVGLPARGKTYISKKLTRYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQVAVFDATNTTRERRSLILQFAKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVEDFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSAEQLPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPFNVDVSRDPEEALDTVPEHF 497          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:100488795])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 328/430 (76.28%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +I+M+GLPARGKTYISKK+TRY NW+G+ T+VFNVG YRR++ Q YK ++FF P N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERRS+IL+       +  F+ES+CDDP++I  NI+EVK+ SPDY   ++++ VEDF  RI  Y   YQPL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG +FA  L  F+ +Q+I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ  FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S ++LPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N+D  R   EAL TVP H 
Sbjct:   29 MIIMVGLPARGKTYISKKLTRYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQVAVFDATNTTRERRSLILQFAKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVEDFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSAEQLPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPFNVDVSRDPEEALDTVPEHF 457          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:100488795])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 328/430 (76.28%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +I+M+GLPARGKTYISKK+TRY NW+G+ T+VFNVG YRR++ Q YK ++FF P N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERRS+IL+       +  F+ES+CDDP++I  NI+EVK+ SPDY   ++++ VEDF  RI  Y   YQPL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG +FA  L  F+ +Q+I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ  FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S ++LPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N+D  R   EAL TVP H 
Sbjct:   36 MIIMVGLPARGKTYISKKLTRYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQVAVFDATNTTRERRSLILQFAKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVEDFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSAEQLPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPFNVDVSRDPEEALDTVPEHF 464          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:100488795])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 328/430 (76.28%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +I+M+GLPARGKTYISKK+TRY NW+G+ T+VFNVG YRR++ Q YK ++FF P N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERRS+IL+       +  F+ES+CDDP++I  NI+EVK+ SPDY   ++++ VEDF  RI  Y   YQPL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG +FA  L  F+ +Q+I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ  FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S ++LPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N+D  R   EAL TVP H 
Sbjct:   26 MIIMVGLPARGKTYISKKLTRYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQVAVFDATNTTRERRSLILQFAKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVEDFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSAEQLPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPFNVDVSRDPEEALDTVPEHF 454          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Match: PFKFB1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:100488795])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 328/430 (76.28%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +I+M+GLPARGKTYISKK+TRY NW+G+ T+VFNVG YRR++ Q YK ++FF P N EA  IR   A  AL D+  +L  E G++AVFDATNTTRERRS+IL+       +  F+ES+CDDP++I  NI+EVK+ SPDY   ++++ VEDF  RI  Y   YQPL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG +FA  L  F+ +Q+I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ  FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S ++LPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N+D  R   EAL TVP H 
Sbjct:   28 MIIMVGLPARGKTYISKKLTRYLNWIGIPTKVFNVGQYRREVVQTYKNYEFFHPDNQEAMKIRKQCALSALRDVDKYLTQEEGQVAVFDATNTTRERRSLILQFAKERVFKAFFIESICDDPDIIAENIMEVKLSSPDYKDCDREKVVEDFLKRIECYNMYYQPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDSGLSTRGKQFAHALGNFVKSQQITDLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQERFPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSAEQLPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPFNVDVSRDPEEALDTVPEHF 456          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Match: Pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:MGI Symbol;Acc:MGI:107816])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 264/429 (61.54%), Postives = 330/429 (76.92%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLN-SEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +++M+GLPARGKTYIS K+TRY NW+G  T+VFN+G YRR+    Y+ ++FF P N+EAQ IR   A  AL D+  +L+  EG +AVFDATNTTRERRS+IL+     G +V F+ES+C+DP++I  NI +VK+ SPDY+  ++++ +EDF  RI  YE  YQPLDEE D   S+I+I++ G +Y+VN+V  ++QSR  YY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG ++A  LA FI +Q I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N+D  R   EAL TVP H
Sbjct:   21 MVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVS-YRNYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPDIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQSISSLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEAVNTHRDKPENVDITREPEEALDTVPAH 447          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Match: Pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:MGI Symbol;Acc:MGI:2687284])

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/429 (62.70%), Postives = 327/429 (76.22%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IVM+GLPARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+MI       G +  F+ES+C DPEV+ ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDE+ D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EF++ LA FI++Q I +LKVWTS MKRT +TA+ ++    EQWK LNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RPS EAL TVP H
Sbjct:   41 LIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRKQCALAALSDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVVAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVP-YEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPAH 468          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Match: Pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:MGI Symbol;Acc:MGI:107816])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 264/429 (61.54%), Postives = 330/429 (76.92%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLN-SEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +++M+GLPARGKTYIS K+TRY NW+G  T+VFN+G YRR+    Y+ ++FF P N+EAQ IR   A  AL D+  +L+  EG +AVFDATNTTRERRS+IL+     G +V F+ES+C+DP++I  NI +VK+ SPDY+  ++++ +EDF  RI  YE  YQPLDEE D   S+I+I++ G +Y+VN+V  ++QSR  YY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG ++A  LA FI +Q I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N+D  R   EAL TVP H
Sbjct:   44 MVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVS-YRNYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPDIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQSISSLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEAVNTHRDKPENVDITREPEEALDTVPAH 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Match: Pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:MGI Symbol;Acc:MGI:2687284])

HSP 1 Score: 538.495 bits (1386), Expect = 0.000e+0
Identity = 263/421 (62.47%), Postives = 319/421 (75.77%), Query Frame = 2
Query:  278 ARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            ARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+MI       G +  F+ES+C DPEV+ ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDE+ D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EF++ LA FI++Q I +LKVWTS MKRT +TA+ ++    EQWK LNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RPS EAL TVP H
Sbjct:   33 ARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRKQCALAALSDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVVAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVP-YEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPAH 452          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Match: Pfkfb2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 [Source:MGI Symbol;Acc:MGI:107815])

HSP 1 Score: 524.628 bits (1350), Expect = 0.000e+0
Identity = 256/415 (61.69%), Postives = 311/415 (74.94%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLD-EEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNID 1492
            +IVMIGLPARGKTY+SKK+TRY NW+GV T+VFN+G YRR+  + Y+ +DFF   N EA  IR   A  AL D+  +   E G++AVFDATNTTRERR MIL        +V F+ES+CDDP+VI ANILEVKV SPDY   N++  +EDF  RI  Y+  YQPLD + +DKD SFI++ N G ++LVN+V   +QS+IVYY+MNI    RTIY+CRHGESE NL G+IGG+S LS RG +FA  L  F+  QEI +LKVWTS +KRT +TA+ +  T  EQWK LNEIDAG CEEMTY EI+  +P EFA RDQ+K+ +RYP GESYQDLV RLEPVIMELERQ N+LVI HQAV RCLLAYFLD+  DELPYLR PLH + KLTP AY C VE I+L++DAVDTHR KPT ++
Sbjct:   42 LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYQSYDFFRHDNEEAMKIRKQCALVALEDVKAYFTEESGQIAVFDATNTTRERRDMILNFAKQNAFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYQPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVHPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAHALKKFLEEQEIQDLKVWTSQLKRTIQTAESLGVT-YEQWKILNEIDAGVCEEMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNILVISHQAVMRCLLAYFLDKGADELPYLRCPLHIIFKLTPVAYGCKVETITLNVDAVDTHRDKPTEVE 455          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Match: sp|Q91309|F26_LITCT (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeianus OX=8400 PE=2 SV=1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 275/475 (57.89%), Postives = 347/475 (73.05%), Query Frame = 2
Query:  122 RIKRITSVDVSPCSIPYTCNN-RVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLN-SEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            R++ +T   +    IP+ C+  + R+ S  P     +F N     +IVM+GLPARGKTYISKK+TRY NW+G  T+VFNVG YRR  TQ Y  + FF   N EA  IR   A  AL D+  +L+  EG +AVFDATNTTRERRS+IL+     G +V F+ES+CDDP++I  NI +VK+ SPDY G ++++ +EDF  RI  Y+  Y+PL ++ D   S+I+I+N G +YLVN+V  ++QSR VYY+MNI    R+IY+ RHGESELNL GRIGG+S LS RG ++A +L  FI +Q+IP+LKVWTSHMKRT +TA+ ++    EQWKALNEIDAG CEEMTYEEIQ +FP EFA RDQDK+ +RYP GESY+D+V RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L+I+AV+THR KP N++  R   EAL TVP H 
Sbjct:    4 RLRELTQTRLQKIWIPHQCDRLQQRRGSSIP-----QFTN--SPTMIVMVGLPARGKTYISKKLTRYLNWIGTPTKVFNVGQYRRDATQSYNNYQFFRADNQEAMKIRKQCALHALKDVHTYLSREEGHVAVFDATNTTRERRSVILQFAKERGYKVFFIESICDDPDIIAENITQVKLSSPDYTGCDREKVLEDFLKRIDCYQMNYEPLHDDLDSSLSYIKIFNVGSRYLVNRVQDHIQSRAVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSGLSVRGKQYAHELGNFIKSQQIPDLKVWTSHMKRTIQTAEALHVP-YEQWKALNEIDAGVCEEMTYEEIQDHFPEEFALRDQDKYRYRYPKGESYEDIVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKTAEELPYLKCPLHTVLKLTPVAYGCKVESIYLNIEAVNTHREKPLNVEVSRDPEEALDTVPEHF 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Match: sp|P07953|F261_RAT (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus OX=10116 GN=Pfkfb1 PE=1 SV=3)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 274/472 (58.05%), Postives = 347/472 (73.52%), Query Frame = 2
Query:  134 ITSVDVSPCSIPYTCNNRV---RKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLN-SEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +T   +    IP++ ++ V   R+ S  P     +F N     +++M+GLPARGKTYIS K+TRY NW+G  T+VFN+G YRR+    Y+ ++FF P N EAQ IR   A  AL D+  +L+  EG +AVFDATNTTRERRS+IL+     G +V F+ES+C+DPE+I  NI +VK+ SPDY+  ++++ +EDF  RI  YE  YQPLDEE D   S+I+I++ G +Y+VN+V  ++QSR  YY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG ++A  LA FI +Q I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N+D  R + EAL TVP H
Sbjct:    8 LTQTRLQKIWIPHSSSSSVLQRRRGSSIP-----QFTN--SPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVS-YRNYEFFRPDNTEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPEIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQGISSLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEAVNTHRDKPENVDITREAEEALDTVPAH 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Match: sp|P25114|F264_RAT (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus OX=10116 GN=Pfkfb4 PE=1 SV=3)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 271/429 (63.17%), Postives = 327/429 (76.22%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IVM+GLPARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+MI       G +  F+ES+C DPEVI ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDEE D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EF++ LA FI++Q I +LKVWTS MKRT +TA+ ++    EQWK LNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RPS EAL TVP H
Sbjct:   41 LIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEEQDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVP-YEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPAH 468          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Match: sp|Q6DTY7|F264_MOUSE (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus OX=10090 GN=Pfkfb4 PE=2 SV=4)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/429 (62.70%), Postives = 327/429 (76.22%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IVM+GLPARGKTYISKK+TRY NW+GV TR FNVG YRR + + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+MI       G +  F+ES+C DPEV+ ANI++VK+ SPDYV  + DEA EDF  RI  YE +Y+ LDE+ D+D S+I+I + G  Y+VN+V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG EF++ LA FI++Q I +LKVWTS MKRT +TA+ ++    EQWK LNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ +ELPYL+ PLHTVLKLTP AY C VE I L++ AV+THR +P N+D  RPS EAL TVP H
Sbjct:   41 LIVMVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDIVKTYKSFEFFLPDNEEGLKIRKQCALAALSDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVVAANIVQVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVP-YEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEELPYLKCPLHTVLKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPSEEALVTVPAH 468          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Match: sp|P70266|F261_MOUSE (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus OX=10090 GN=Pfkfb1 PE=1 SV=2)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 264/429 (61.54%), Postives = 330/429 (76.92%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLN-SEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +++M+GLPARGKTYIS K+TRY NW+G  T+VFN+G YRR+    Y+ ++FF P N+EAQ IR   A  AL D+  +L+  EG +AVFDATNTTRERRS+IL+     G +V F+ES+C+DP++I  NI +VK+ SPDY+  ++++ +EDF  RI  YE  YQPLDEE D   S+I+I++ G +Y+VN+V  ++QSR  YY+MNI    R+IY+CRHGESELNL GRIGG+S LS+RG ++A  LA FI +Q I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE I L+++AV+THR KP N+D  R   EAL TVP H
Sbjct:   44 MVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVS-YRNYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPDIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHVQSRTAYYLMNIHVTPRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIRSQSISSLKVWTSHMKRTIQTAEALGVP-YEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCRVESIYLNVEAVNTHRDKPENVDITREPEEALDTVPAH 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Match: A0A0V0J663 (6PF2K domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR148587 PE=4 SV=1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 276/430 (64.19%), Postives = 352/430 (81.86%), Query Frame = 2
Query:  245 KKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPP 1534
            ++ VIV++GLPARGKTYIS+++TRY NW+G+ TRVFNVGDYRRK T + KGHDFFD SN EA +IR  AA +AL DL +WL ++GE+AVFDATNTTR RR M+   C     +VIF+ES+CD+ +VI+A+ILEVKV+SPDY G++KD A++DF  RI HY + Y+P+D++ DKD S+I+I+NQG +YL N++ GN+ SRIVYY+MNI   KRTIY+ RHGESELNL GRIGG+SSLS RG  FA+KL  F+ ++ + +LKVWTSH +RT +T++ I C+R+E WKAL+E+DAG CE MTY+EIQ  +P EF++RD DK+N+RYPMGESYQDLV+RLEPVIMELERQ +V+VICHQAVARCLLAYFL+  K ELPY++VPLHTV KLTPTAYRCI E + LD+ AVDTHR+KP +  ++   FEALQTVPP
Sbjct:   54 ERTVIVLVGLPARGKTYISRRLTRYLNWIGINTRVFNVGDYRRKATCE-KGHDFFDDSNTEAASIRMKAASDALDDLTEWLEADGEIAVFDATNTTRARREMVYNHCVKHKFKVIFVESICDNKKVIQASILEVKVNSPDYAGVDKDIALQDFLQRIEHYTSRYEPIDDDLDKDLSYIKIFNQGQRYLANRIEGNVNSRIVYYLMNINVGKRTIYLVRHGESELNLQGRIGGDSSLSERGRLFAQKLGKFMEDEGLSDLKVWTSHFRRTIQTSEFIQCSRLEHWKALDELDAGVCEGMTYDEIQQQYPLEFSRRDADKYNYRYPMGESYQDLVARLEPVIMELERQTSVMVICHQAVARCLLAYFLELDKVELPYIKVPLHTVFKLTPTAYRCISETVHLDVPAVDTHRSKPKHPTQNCTPFEALQTVPP 482          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Match: A0A0X3PVW2 (6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (Fragment) OS=Schistocephalus solidus OX=70667 GN=F26L PE=4 SV=1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 277/435 (63.68%), Postives = 352/435 (80.92%), Query Frame = 2
Query:  245 KKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPS-----FEALQTVPP 1534
            ++ VIV++GLPARGKTYIS+++TRY NW+G+ TRVFNVGDYRRK T + KGHDFFD SN EA +IR  AA +AL DL +WL ++GE+AVFDATNTTR RR M+   C     +VIF+ES+CD+ +VI+A+ILEVKV+SPDY G++KD A++DF  RI HY + Y+P+D++ DKD S+I+I+NQG +YL N++ GN+ SRIVYY+MNI   KRTIY+ RHGESELNL GRIGG+SSLS RG  FA+KL  F+ ++ + +LKVWTSH +RT +T++ I C+R+E WKAL+E+DAG CE MTY+EIQ  +P EF++RD DK+N+RYPMGESYQDLV+RLEPVIMELERQ +V+VICHQAVARCLLAYFL+  K ELPY++VPLHTV KLTPTAYRCI E + LD+ AVDTHR+KP     + P+     FEALQTVPP
Sbjct:   54 ERTVIVLVGLPARGKTYISRRLTRYLNWIGINTRVFNVGDYRRKATCE-KGHDFFDDSNTEAASIRMKAASDALDDLTEWLEADGEIAVFDATNTTRARREMVYNHCVKHKFKVIFVESICDNKKVIQASILEVKVNSPDYAGVDKDIALQDFLQRIEHYTSRYEPIDDDLDKDLSYIKIFNQGQRYLANRIEGNVNSRIVYYLMNINVGKRTIYLVRHGESELNLQGRIGGDSSLSERGRLFAQKLGKFMEDEGLSDLKVWTSHFRRTIQTSEFIQCSRLEHWKALDELDAGVCEGMTYDEIQQQYPLEFSRRDADKYNYRYPMGESYQDLVARLEPVIMELERQTSVMVICHQAVARCLLAYFLELDKVELPYIKVPLHTVFKLTPTAYRCISETVHLDVPAVDTHRSKPKECSVEHPTQNCTPFEALQTVPP 487          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Match: A0A5K3FIF7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 279/449 (62.14%), Postives = 357/449 (79.51%), Query Frame = 2
Query:  191 RKISVC-PPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPP 1534
            R++S+   P  +R       + +IV++GLPARGKTY+S+++TRY NW+G+ TRVFNVGDYRR+ T     HDFFD +N EA  IR  AAQ+AL DL +WL ++GE+AVFDATNTTR+RR MI E C     +VIF+ES+CD+ +VI+A+ILEVKV+SPDY+G++KD A++DF  RI HY   Y+P+D++ DK+  +I+I+NQG +YL N++ GN+ SRIVYY+MNI   KRTIY+ RHGESE NL G++GG+  LSSRG  FA+KL  F+ N+ + +LKVWTSHM+RT ET + I C+R++ WKAL+E+DAG CE MTYEEIQ  +P +FA+RD DKF++RYPMGESY+DLV+RLEPVIMELERQ++VLVICHQAVARCLLAYF +  K ELPY+RVPLHTV KLTPTAYRCIVE + LD+DAVDTHR KP N DE +  FEALQTVPP
Sbjct:    5 RRVSLLFAPLSNRTLCTADDRTIIVLVGLPARGKTYMSRRLTRYLNWIGINTRVFNVGDYRRRATC-INSHDFFDDTNTEAANIRMKAAQDALCDLTEWLENDGEIAVFDATNTTRKRREMIYEHCQKHKFKVIFVESICDNQDVIQASILEVKVNSPDYIGVDKDFALQDFLKRIEHYAARYEPIDDDIDKELPYIKIFNQGQRYLANRIAGNVSSRIVYYLMNINVGKRTIYLVRHGESEYNLRGQLGGDPPLSSRGKLFAQKLGKFMENEGLDDLKVWTSHMRRTIETGELIKCSRLDHWKALDELDAGVCEGMTYEEIQKKYPFDFARRDMDKFHYRYPMGESYEDLVARLEPVIMELERQHHVLVICHQAVARCLLAYFTEMDKVELPYIRVPLHTVFKLTPTAYRCIVETVKLDVDAVDTHRDKPVNPDEVKSPFEALQTVPP 452          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Match: A0A4E0RXI9 (6-phosphofructo-2-kinase / fructose-2 6-bisphosphatase OS=Fasciola hepatica OX=6192 GN=D915_002452 PE=4 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 283/477 (59.33%), Postives = 368/477 (77.15%), Query Frame = 2
Query:  116 IGRIKRITSVDVSP---CSIPYTCNNRVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNS-EGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPP 1534
            + R +RI S++ SP   C+IP   + R                 ++ K V+V++GLPARGK+YI+ K+TRY NW+G+TTRVFNVG YRR+  Q  +GHDFF   N +A+  R   A+EAL D+I WL S +G++ VFDATNTTRERR  I+E C +  ++V+F+ES+C DP+VI+ N+LEVKV+SPDYVGM+K++A+EDF  R+ HYE  Y P+D++ DKD+S+I+I+NQG +YL N + GN+ SRI YY+MNIR  KRTIY+ RHGE++LNL G+IGG++SLS RG EFA +LA F++ + + +LKVWTSH+KRT ETA+ + CT I  WKAL+E+DAG C+ MTY EIQ  +P +FA+RD DK+++RYPMGESY+DLV RLEPVIMELERQ +VLVICHQAVARCLLAYF D+++DELPYLRVPLHTV KLTP AYRCIVE + L + AVDTHR KP NI+ +R SFEALQTVPP
Sbjct:    1 MSRDRRI-SLNYSPLSNCAIPILGSYR-----------------KEGKTVVVLVGLPARGKSYIATKLTRYLNWVGITTRVFNVGVYRRRHFQAQQGHDFFCDDNEDAKQSRHKIAEEALEDMISWLVSDQGDIGVFDATNTTRERRLWIMEKCKSRHLDVLFVESICSDPKVIEENVLEVKVNSPDYVGMDKEKAMEDFMKRMHHYEAQYVPIDDDLDKDWSYIKIFNQGQRYLANHIEGNVNSRIAYYLMNIRVRKRTIYLTRHGETDLNLAGKIGGDASLSPRGREFAMELAKFMSQENLKDLKVWTSHLKRTIETAELVPCTSIAHWKALDELDAGVCDGMTYREIQEKYPADFARRDADKYHYRYPMGESYEDLVGRLEPVIMELERQTSVLVICHQAVARCLLAYFEDKNQDELPYLRVPLHTVFKLTPVAYRCIVERVQLQVPAVDTHRPKPLNIEPNRTSFEALQTVPP 459          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Match: W6UNF0 (6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase OS=Echinococcus granulosus OX=6210 GN=EGR_01939 PE=4 SV=1)

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 282/460 (61.30%), Postives = 356/460 (77.39%), Query Frame = 2
Query:  191 RKIS-VCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTR-----------VFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPP 1534
            R++S V  P  +R     + + VIV++GLPARGKTY+++K+TRY NW+G+ TR           VFNVGDYRRK T   +GHDFFD +N EA  IR  AA+EAL DL +WL  +GE+AVFDATNTTR+RR MIL  C     +VIF+ES+CD+ +V++A+ILEVKV+SPDY+GM+K+ A++DF  RI HY   Y+PLD E DKD  FI+I NQG +YLVN++ GN+ SRIVYY+MNI   KRTIY+ RHGESE NL G++GG++ LS RG  FA+KL  F+  + + +LKVWTSHM+RT +T++ I C+R+E WKALNE+ AG CE MTY+EIQ  +PTEFA RD DKF++RYPMGESY+DLV+RLEPVIMELERQ NVLVICHQAV+RCLLAYF +  K ELPY+RVPLHTV KLT +AYRCIVE + LD++AVDTHR+KP N +E R  FEAL+TVPP
Sbjct:    5 RRVSLVFTPLSNRTLCTPEDRTVIVLVGLPARGKTYMARKLTRYLNWIGINTRGKLLSLVFKSIVFNVGDYRRKATC-LQGHDFFDDTNKEAANIRMKAAREALSDLTEWLKDDGEIAVFDATNTTRKRRDMILNYCRPHNFKVIFVESICDNQDVVQASILEVKVNSPDYIGMDKESAMQDFLKRIEHYAARYEPLDIERDKDVPFIKIINQGQRYLVNRIAGNVSSRIVYYLMNINVAKRTIYLVRHGESEYNLRGKLGGDADLSDRGKLFAQKLGRFMEREGLSDLKVWTSHMRRTIQTSEFIKCSRLEHWKALNELSAGVCEGMTYDEIQRKYPTEFACRDADKFHYRYPMGESYEDLVARLEPVIMELERQGNVLVICHQAVSRCLLAYFTEMDKAELPYIRVPLHTVFKLTSSAYRCIVETMKLDVEAVDTHRSKPVNPNEVRSPFEALKTVPP 463          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:103045309])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 269/430 (62.56%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IVM+GLPARGKTYIS+K+TRY NW+GV T+VFN+G YRR+  + YK ++FF   N EA  IR   A  AL D+ ++   E G++AVFDATNTTRERR +I+      G +V F+ES+CDDPE+I+ANI+EVK+ SPDY   +K+EA++DF  RI  Y+T Y  LDEE D+  S+I+I+N G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+S LS++G ++A  LA FI NQ I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYE+IQ N+P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE   L+I AV+THR +P N+D  R   EAL+TVP H 
Sbjct:   30 MIVMVGLPARGKTYISRKLTRYLNWIGVQTQVFNLGQYRREAVKSYKNYEFFRHDNEEAMKIRRACASNALKDIANYFAKEQGQVAVFDATNTTRERRGVIISFAKEKGYKVFFIESICDDPEIIEANIMEVKLSSPDYEDCDKEEALDDFVKRIECYKTNYVSLDEEKDRHLSYIKIFNVGSRYLVNRVQDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSGLSTQGKKYASALAEFIRNQAIKDLKVWTSHMKRTIQTAEALGVA-YEQWKALNEIDAGMCEEMTYEKIQENYPEEFAMRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVESFYLNIKAVNTHRERPANVDVTRGPEEALRTVPDHF 458          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:103045309])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 269/430 (62.56%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IVM+GLPARGKTYIS+K+TRY NW+GV T+VFN+G YRR+  + YK ++FF   N EA  IR   A  AL D+ ++   E G++AVFDATNTTRERR +I+      G +V F+ES+CDDPE+I+ANI+EVK+ SPDY   +K+EA++DF  RI  Y+T Y  LDEE D+  S+I+I+N G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+S LS++G ++A  LA FI NQ I +LKVWTSHMKRT +TA+ +     EQWKALNEIDAG CEEMTYE+IQ N+P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C VE   L+I AV+THR +P N+D  R   EAL+TVP H 
Sbjct:   42 MIVMVGLPARGKTYISRKLTRYLNWIGVQTQVFNLGQYRREAVKSYKNYEFFRHDNEEAMKIRRACASNALKDIANYFAKEQGQVAVFDATNTTRERRGVIISFAKEKGYKVFFIESICDDPEIIEANIMEVKLSSPDYEDCDKEEALDDFVKRIECYKTNYVSLDEEKDRHLSYIKIFNVGSRYLVNRVQDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSGLSTQGKKYASALAEFIRNQAIKDLKVWTSHMKRTIQTAEALGVA-YEQWKALNEIDAGMCEEMTYEKIQENYPEEFAMRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVESFYLNIKAVNTHRERPANVDVTRGPEEALRTVPDHF 470          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Match: pfkfb4b (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4-like [Source:NCBI gene;Acc:103024058])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 267/429 (62.24%), Postives = 330/429 (76.92%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IV +GLPARGKTYISKK+TRY NW+GV T+ FNVG YRR+  + YK  +FF P N E   IR   A  AL D+  +L+ EG ++AVFDATNTTRERR MI+      G +V F+ES+C+DPEVI  NI++VK+ SPDY+  N +EAV+DF  RI+ YE +YQPLDE  D++ S+I++ + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS+RG EFA  L  FI +Q I +LKVWTS MKRT +TA+ +   + EQWKALNEIDAG CEEM YEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C V+ I L+++AV+THR KP N++  R S EAL TVP H
Sbjct:   20 LIVTVGLPARGKTYISKKLTRYLNWIGVPTKEFNVGQYRRECVKIYKNFEFFRPDNEEGLKIRKQCALTALNDVRQYLSVEGGQVAVFDATNTTRERRGMIMRFAEQNGYKVFFVESVCEDPEVIAQNIVQVKLGSPDYIDCNTEEAVQDFMKRIKCYENSYQPLDEILDRELSYIKVMDVGRRYLVNRVQDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNIRGRIGGDSGLSTRGKEFAHCLGKFIQDQNIKDLKVWTSQMKRTIQTAEALG-VQYEQWKALNEIDAGVCEEMRYEEIQEHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVQSIYLNVEAVNTHRDKPENVNISRLSEEALFTVPAH 447          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Match: pfkfb4b (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4-like [Source:NCBI gene;Acc:103024058])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 267/429 (62.24%), Postives = 330/429 (76.92%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            +IV +GLPARGKTYISKK+TRY NW+GV T+ FNVG YRR+  + YK  +FF P N E   IR   A  AL D+  +L+ EG ++AVFDATNTTRERR MI+      G +V F+ES+C+DPEVI  NI++VK+ SPDY+  N +EAV+DF  RI+ YE +YQPLDE  D++ S+I++ + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS+RG EFA  L  FI +Q I +LKVWTS MKRT +TA+ +   + EQWKALNEIDAG CEEM YEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S DELPYL+ PLHTVLKLTP AY C V+ I L+++AV+THR KP N++  R S EAL TVP H
Sbjct:   50 LIVTVGLPARGKTYISKKLTRYLNWIGVPTKEFNVGQYRRECVKIYKNFEFFRPDNEEGLKIRKQCALTALNDVRQYLSVEGGQVAVFDATNTTRERRGMIMRFAEQNGYKVFFVESVCEDPEVIAQNIVQVKLGSPDYIDCNTEEAVQDFMKRIKCYENSYQPLDEILDRELSYIKVMDVGRRYLVNRVQDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNIRGRIGGDSGLSTRGKEFAHCLGKFIQDQNIKDLKVWTSQMKRTIQTAEALG-VQYEQWKALNEIDAGVCEEMRYEEIQEHYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSADELPYLKCPLHTVLKLTPVAYGCKVQSIYLNVEAVNTHRDKPENVNISRLSEEALFTVPAH 477          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Match: pfkfb4a (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 [Source:NCBI gene;Acc:103042309])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 325/430 (75.58%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IV +GLPARGKTYISKK+TRY NW+GV T+ FNVG YRR+  + YK  +FF P N E   IR   A  AL D+  +L  EG ++AVFDATNTTRERR  I       G +V F+ES+C+DP+VI  NI++VK+ SPDY   N ++AVEDF  RI+ YE +YQPLDE  D+D SFI+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S L+ RG EFA  L  FI+ Q I +LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEE+ YEEIQ  +P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S +ELPYL+ PLHTVLKLTP AY C VE I L++DAV+THR +P N++  R + +ALQTVP HL
Sbjct:   53 LIVTVGLPARGKTYISKKLTRYLNWIGVPTKEFNVGQYRRECVKIYKSFEFFRPDNEEGLKIRKECASAALNDVRQYLTEEGGQVAVFDATNTTRERRETINRFAEQNGFKVFFVESVCEDPDVIAENIVQVKLGSPDYTHCNTEQAVEDFMKRIKCYENSYQPLDEVLDRDLSFIKIIDVGRRYLVNRVQDHIQSRIVYYLMNIHITPRSIYLCRHGESDLNVKGRIGGDSGLTFRGKEFAHYLGQFIHAQGISDLKVWTSQMKRTIQTAEALGVP-YEQWKALNEIDAGVCEELMYEEIQQRYPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSAEELPYLKCPLHTVLKLTPVAYGCKVESIYLNVDAVNTHRERPENVNVHRSAADALQTVPAHL 481          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Sea Lamprey
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5664])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 271/429 (63.17%), Postives = 326/429 (75.99%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            VIVM+GLPARGKTY+SKK++RY NW+G+ T+ FNVG YRR+ TQ YK + FF P N EA  IR   A  AL DL  +L  EG ++AVFDATNTTRERR +I   C     +V F+ESLCDDP+VI  +I EVKV SPDY   NKD+A  DF  RI  Y+  YQPLD+ +D++ S+I+I+N G  +LVN V  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  L+ RG +FA  L+ F++ Q I +LKVWTS MKRT +TA+ +N T  EQWKALNEIDAG CEEMTYEEIQS++P EFA RDQDKF++RYP GESYQD+V RLEPVIMELERQ NVLV+CHQAV RCLLAYFLD+S  ELPYL  PLHTVLKLTP AY C VE   L+++AV+THR KP N+   R S EAL+TVP H
Sbjct:   10 VIVMVGLPARGKTYMSKKLSRYLNWVGIPTKAFNVGQYRREATQLYKSYQFFRPDNEEAMKIRRHCALVALEDLHKYLKDEGGQVAVFDATNTTRERRELITNFCNENSYKVFFVESLCDDPDVIATSITEVKVSSPDYKDCNKDDATVDFLKRIECYKETYQPLDDTWDREMSYIKIFNVGRGFLVNHVQDHVQSRIVYYLMNIHVQPRSIYLCRHGESELNLKGRIGGDLGLADRGKQFANALSSFLSEQNIKDLKVWTSQMKRTIQTAEALNTT-YEQWKALNEIDAGVCEEMTYEEIQSSYPDEFAMRDQDKFHYRYPKGESYQDVVHRLEPVIMELERQENVLVVCHQAVMRCLLAYFLDKSSAELPYLECPLHTVLKLTPIAYGCRVESFFLNVEAVNTHREKPENVSVSRKSSEALKTVPAH 437          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Yeast
Match: FBP26 (Fructose-2,6-bisphosphatase, required for glucose metabolism; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003691])

HSP 1 Score: 391.734 bits (1005), Expect = 6.408e-132
Identity = 197/422 (46.68%), Postives = 286/422 (67.77%), Query Frame = 2
Query:  233 NNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYK-GHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQ--EIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTN 1486
            N+   K+ ++M+GLPARGK++IS+K+ RY +W+ +  + FNVG+YRR ++       +FF+  N +   +R  AAQ A+ D++++   E G +AVFDATN+TR+RR  + +IC    I+ +FLES  +D E+I  N  ++   SPDY       A  DF  RIR YE  Y+PLD + DKD +FI++ N   + ++NK+   L+SRIV+Y+MNIRP  + I++ RHGES  N+  +IGG+SSLS RG ++A+KL   +     EI NL VWTS +KRT +TA  +   ++ QWKAL+E+DAG C+ MTYEEI+  +P +F  RD DK+ +RY  GESY+D+V RLEPVIMELERQ NVL+I HQAV RC+ AYF++  ++E P++ +PLHT++KL P AY   V +I  +I AV T++ K T+
Sbjct:    8 NDNDIKVCVIMVGLPARGKSFISQKIIRYLSWLSIKAKCFNVGNYRRDVSGNVPMDAEFFNFENTDNFKLRELAAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKWLKDICEKNNIQPMFLESWSNDHELIINNAKDIGSTSPDYENSEPHVAEADFLERIRQYERFYEPLDPQKDKDMTFIKLVNIIEEVVINKIRTYLESRIVFYVMNIRPKPKYIWLSRHGESIYNVEKKIGGDSSLSERGFQYAKKLEQLVKESAGEI-NLTVWTSTLKRTQQTANYLPYKKL-QWKALDELDAGVCDGMTYEEIEKEYPEDFKARDNDKYEYRYRGGESYRDVVIRLEPVIMELERQENVLIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIKLEPRAYGTKVTKIKANIPAVSTYKEKGTS 427          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Yeast
Match: PFK26 (6-phosphofructo-2-kinase; inhibited by phosphoenolpyruvate and sn-glycerol 3-phosphate; has negligible fructose-2,6-bisphosphatase activity; transcriptional regulation involves protein kinase A [Source:SGD;Acc:S000001369])

HSP 1 Score: 295.819 bits (756), Expect = 8.001e-91
Identity = 180/471 (38.22%), Postives = 269/471 (57.11%), Query Frame = 2
Query:  104 ESPKIGRIKRITSVDVSPCSIPYTCNNRVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHD----FFDPSNVEAQTIR-SFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICF--NCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFI----------------NNQEIP-----NLKVWTSHMKRTWETAKQINCTR--IEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYP--MGESYQDLVSRLEPVIMELER-QNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAY 1417
            +SP     +R T++DV   +   T            PD      +   K+VIVM+GLPA GK++I+ K++R+ N+     +VFNVG+ RRK  +++   D    FF+P N ++  +R  +A       L   L   G + +FDATNT+RERR  +L      +  ++V+FLES+C D  +++ NI  +K+  PDY G + + +++DFK+R+ +Y  AY+P+++  D++  +I++ + G K +   + G L S+ VYY++N     R I+I R GESE N++GRIGGNS L+ RG  FA+ L  FI                NN+        +  VWTS   RT  TA+  N     I+Q K L+E+ AG  + MTY EI++NFP EF +R +DK  +RYP   GESY D+++RL PVI ELER ++NVL+I H+ VAR LL YF++ S   +  L VPLH V  L P  Y
Sbjct:  146 KSPTRHHKRRPTTIDVPGLTKSKTS-----------PDGLISKEDSGSKLVIVMVGLPATGKSFITNKLSRFLNYSLYYCKVFNVGNTRRKFAKEHGLKDQDSKFFEPKNADSTRLRDKWAMDTLDELLDYLLEGSGSVGIFDATNTSRERRKNVLARIRKRSPHLKVLFLESVCSDHALVQKNI-RLKLFGPDYKGKDPESSLKDFKSRLANYLKAYEPIED--DENLQYIKMIDVGKKVIAYNIQGFLASQTVYYLLNFNLADRQIWITRSGESEDNVSGRIGGNSHLTPRGLRFAKSLPKFIARQREIFYQNLMQQKKNNENTDGNIYNDFFVWTSMRARTIGTAQYFNEDDYPIKQMKMLDELSAGDYDGMTYPEIKNNFPEEFEKRQKDKLRYRYPGIGGESYMDVINRLRPVITELERIEDNVLIITHRVVARALLGYFMNLSMGIIANLDVPLHCVYCLEPKPY 602          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Yeast
Match: YLR345W_mRNA (Similar to 6-phosphofructo-2-kinase enzymes; mRNA expression is repressed by the Rfx1p-Tup1p-Ssn6p repressor complex; YLR345W is not an essential gene [Source:SGD;Acc:S000004337])

HSP 1 Score: 186.037 bits (471), Expect = 1.525e-52
Identity = 116/433 (26.79%), Postives = 228/433 (52.66%), Query Frame = 2
Query:  248 KIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNS-EGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLV-NKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFI------------NNQEI-------------PNLKVWTSHMKRTWETAKQIN--CTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQN-NVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDA 1456
            +I++V++GLPA  KT +S  +TRY  W+GV T+ F+  +Y+         +    P++ E          + L D++ + N   G+LA++DA N  +  R  +       G++V+F+ES+  D E++  NI  + ++S DY G++ DEA++++  R+   E  Y+ +    D++ S+I+  N G + +V + +HG L ++IV+++MN+R  K  +Y  R G S+         +  L+  G  +++ L  F+            N+  +              +L VWT   KRT +TA   +    +++Q   L +++ G   ++T ++I   FP+E+ +  +D ++FR+P  ESY DL  R+EP+++E+E  + ++L+I H++  R L  Y +  +  ELP L      +++++ + +   VE +++ + +
Sbjct:   83 RILVVLVGLPATSKTLLSVAITRYTRWLGVRTKSFHFSEYKESAKNIPSDYFCVVPTSKEGVAFVEKLRMQMLNDILAFFNDLSGQLAIYDALNIRKIDRKNLETTFSEIGVKVLFIESIVSDQEIMNRNI-ALALESNDYKGLSTDEAIDEYMRRLSVNEPYYEMMTH--DEELSYIKYINLGKQIIVKDNIHGYLVNKIVFFLMNLRQKKGCVYFARCGTSD---KDNYIHDEELNEEGIHYSQVLKDFVLQRIKQKRQAKKNSDSLVEVIDGSHDEDLKTSLIVWTGPRKRTHDTALFFSKEGIKVQQRSELRQLNPGSIADLTDQQIMDKFPSEYKESLKDPYHFRFPRAESYHDLAVRMEPLLLEMEHTSKDILIIAHESTLRVLYGYLMACTCVELPNLNFTRDKLVEISFSPFCNTVELLNIPLTS 509          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Yeast
Match: PFK27 (6-phosphofructo-2-kinase; catalyzes synthesis of fructose-2,6-bisphosphate; inhibited by phosphoenolpyruvate and sn-glycerol 3-phosphate, expression induced by glucose and sucrose, transcriptional regulation involves protein kinase A [Source:SGD;Acc:S000005496])

HSP 1 Score: 80.1073 bits (196), Expect = 1.449e-16
Identity = 67/225 (29.78%), Postives = 101/225 (44.89%), Query Frame = 2
Query:  233 NNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTT----RVFNVGDYRRK----------LTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMIL-EIC-FNC------GIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLD--------------EEFDKDYSFIRIYNQGV 799
            N +  K +IV+IGLPA GK+ IS  + +      +T     +VFN G  RR+          L       D F+P N + +   +    + L+  I+  N E ++ +FDATN+T ERR  I  E+C FN        +  I L+  C +   IK NI   K  + DY+    + A++DF  R++HY + + P                EE D    F  + N GV
Sbjct:   91 NGKVNKFMIVLIGLPATGKSTISSHLIQCLKNNPLTNSLRCKVFNAGKIRRQISCATISKPLLLSNTSSEDLFNPKNNDKKETYARITLQKLFHEIN--NDECDVGIFDATNSTIERRRFIFEEVCSFNTDELSSFNLVPIILQVSCFNRSFIKYNI-HNKSFNEDYLDKPYELAIKDFAKRLKHYYSQFTPFSLDEFNQIHRYISQHEEIDTSLFFFNVINAGV 312          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Nematostella
Match: EDO42538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S156])

HSP 1 Score: 510.375 bits (1313), Expect = 5.223e-178
Identity = 236/424 (55.66%), Postives = 316/424 (74.53%), Query Frame = 2
Query:  269 GLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYK-GHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPH 1537
            GLPARGK++IS+K+ RY NW+GV+T+VF++GDYRR++ +  +  H FFDP+N     IR   A+  L D+++WL  +G++A+FDATN+TR+RR  I+E C +    V+FLES+ DDP ++K+N++ VK+ SPDY G+  ++A EDF  RI HYE AY+PL    D+  S+++I N G +++ NK+ G L+SRIVYY+MNI    + IY+ RHGESE NL GRIGG+S LS RG  +  KLA F+  Q++ + +VWTS  KRT +T + I     E+W ALNEIDAG CE MTYEEIQ NFP +FA+RD+DKF++RY  GESY+DLV+RLEPVIMELERQ+NVLV+CHQAV RCLLAYFLD++ +ELPY++VPLH+VLKLT  AY C +E+  L I AV+THR KP ++   R S  ALQTVP H
Sbjct:   24 GLPARGKSFISRKLARYLNWIGVSTKVFSLGDYRRRMLEGSQFDHSFFDPNNPNGMNIREECAKLVLADIVEWLKDKGKVAIFDATNSTRKRRETIIEKCQSYECRVMFLESVVDDPVIVKSNVMAVKISSPDYKGVQPEQACEDFLARIEHYEQAYEPLCMAKDRHVSYLKIINGGKQFVANKIEGYLESRIVYYMMNIHITPKAIYLTRHGESEYNLKGRIGGDSDLSHRGRLYGEKLAEFMAEQKLQDFRVWTSEFKRTIQTTEHIKGVSTEKWAALNEIDAGVCEGMTYEEIQENFPEDFAKRDEDKFHYRYRRGESYEDLVARLEPVIMELERQHNVLVVCHQAVGRCLLAYFLDKNYEELPYIKVPLHSVLKLTTEAYGCKIEQFDLHIPAVNTHRQKPEDVSVSRDSAHALQTVPAH 447          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Nematostella
Match: EDO34619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNT5])

HSP 1 Score: 432.565 bits (1111), Expect = 4.717e-147
Identity = 212/418 (50.72%), Postives = 289/418 (69.14%), Query Frame = 2
Query:  194 KISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLD 1447
            K+    P++   F N     VIV++GLPARGKTY++KK+ RY NW+G+  +VFNVG+YRRK     K HDFF   N EAQ IR   A + L D+  WL+   + A+FDATNTTRERR M+L+ C   G +  F+ES+C++ E++ +NI EVKV SPDY  ++K++A  DFK RI+HY+ AY+PL  E D D SFI+I N G +YLVN + G LQS+ VY++MN+   KR+IY+ RH E E N++  +GG++ L+ RG EFA+ LA FIN Q+IP+LKVWTS +KR  +TAK I    +E WKALNEID G  +     ++ +  P +   R ++ F +RYP+GESY D+ +RLEPVIMELERQNNV++I H+AV + ++AYF + + DE+P L +PLHTV KLTP AY C VE   L+
Sbjct:   57 KVDCALPEYTPRFVN--VPTVIVLVGLPARGKTYMAKKLGRYLNWIGIQCKVFNVGEYRRKAVGMDKLHDFFKVDNQEAQAIRRQCAIDCLNDVSSWLDEGVQAAIFDATNTTRERRRMVLDYCRRRGYKTFFMESVCNNSEIVASNIKEVKVFSPDYKEVDKEQAFNDFKERIKHYQAAYEPLTME-DGDLSFIKIINAGEQYLVNNIDGYLQSKSVYFLMNLHVRKRSIYLVRHAECENNVHQLLGGDTDLTKRGDEFAQTLAAFINEQDIPDLKVWTSQLKRAVQTAKYIQHAPVEPWKALNEIDYGIYDGRPVSDLNTMGPDDIKARHKNMFIYRYPLGESYSDVCARLEPVIMELERQNNVVLIVHEAVMQIIMAYFTNHTPDEIPNLDIPLHTVFKLTPIAYGCRVERFPLE 471          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Nematostella
Match: EDO26235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DV90])

HSP 1 Score: 77.0258 bits (188), Expect = 1.474e-17
Identity = 32/59 (54.24%), Postives = 46/59 (77.97%), Query Frame = 2
Query:  269 GLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYK-GHDFFDPSNVEAQTIR 442
            GLPARGK++IS+K+ RY NW+GV+T+VF++GDYRR++ +  +  H FFDP+N     IR
Sbjct:   24 GLPARGKSFISRKLARYLNWIGVSTKVFSLGDYRRRMLEGSQFDHSFFDPNNPNGMNIR 82          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Match: pfkfb4a (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 [Source:NCBI gene;Acc:101159498])

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 271/430 (63.02%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IV +GLPARGKTYISKK+TRY NW+GV TR FNVG YRR   + YK  +FF P N E   IR   A  AL D+  +L  +G ++AVFDATNTTRERR  I++     G +V F+ES+C+DP+VI+ NI++VK+ SPDY   N DEAVEDF  RI+ YE +Y+ LDE  D+D S+I+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGESELN+ GRIGG+S L++RG +FA+KLA FI  Q I +LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEEM YEEIQ + P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+S +ELPYL+ PLHTVLKLTP AY C VE ISL++DAV+THR KP N++  R + +ALQTVPPHL
Sbjct:   77 LIVTVGLPARGKTYISKKLTRYLNWIGVPTREFNVGQYRRDFMKIYKSFEFFRPDNEEGLKIRQQCASAALNDVRQYLAEDGGQVAVFDATNTTRERRETIIQFAEQNGFKVFFVESVCEDPDVIQENIVQVKLCSPDYTNCNTDEAVEDFMQRIKCYENSYETLDEVLDRDLSYIKIIDVGQRYLVNRVLDHIQSRIVYYLMNIHITPRSIYLCRHGESELNVKGRIGGDSGLTTRGKQFAKKLAQFIQTQSIVDLKVWTSQMKRTIQTAEAL-AVPYEQWKALNEIDAGVCEEMMYEEIQESHPLEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSAEELPYLKCPLHTVLKLTPVAYGCKVESISLNVDAVNTHREKPENVNVHRSAADALQTVPPHL 505          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:101165483])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 272/430 (63.26%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            VIVM+GLPARGKTYISKK+TRY NW+GV T+VFNVG YRR+  + YK  +FF P N EA  IR   A  AL D+  + + E G++AVFDATNTTRERR++I       G +V F+ES+CDDPE+I  NI +VK  SPDY+  ++DEA+EDF  RI  Y+T+Y P+D+E D++ S+I+I++ G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+SSLS RG +FA  LA FI  Q I +LKVWTSHMKRT +TA+ +   + EQWKALNEIDAG CEE+TYEEIQ NF  EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+  DELPYLR PLHTVLKLTP AY C VE   L+I+AV+THR +P N+  +R   EALQTVP H+
Sbjct:   32 VIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGQYRREAVKTYKNFEFFKPDNEEAMRIRKACASAALKDVAVYFSKENGQVAVFDATNTTRERRAVINSFAKERGYKVFFVESICDDPEIIAENIRQVKFGSPDYIDRDEDEAMEDFIKRIDCYKTSYLPIDDEKDRNLSYIKIFDVGSRYLVNRVRDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSSLSPRGQKFASSLASFIRGQRIKDLKVWTSHMKRTIQTAEALG-VQYEQWKALNEIDAGVCEELTYEEIQENFMEEFALRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKPADELPYLRCPLHTVLKLTPVAYGCKVESFYLNIEAVNTHRERPKNVSINRDPDEALQTVPEHV 460          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Match: pfkfb1 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 [Source:NCBI gene;Acc:101165483])

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 272/430 (63.26%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSE-GELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            VIVM+GLPARGKTYISKK+TRY NW+GV T+VFNVG YRR+  + YK  +FF P N EA  IR   A  AL D+  + + E G++AVFDATNTTRERR++I       G +V F+ES+CDDPE+I  NI +VK  SPDY+  ++DEA+EDF  RI  Y+T+Y P+D+E D++ S+I+I++ G +YLVN+V  ++QSRIVYY+MNI    R+IY+ RHGESELNL GRIGG+SSLS RG +FA  LA FI  Q I +LKVWTSHMKRT +TA+ +   + EQWKALNEIDAG CEE+TYEEIQ NF  EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD+  DELPYLR PLHTVLKLTP AY C VE   L+I+AV+THR +P N+  +R   EALQTVP H+
Sbjct:   32 VIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGQYRREAVKTYKNFEFFKPDNEEAMRIRKACASAALKDVAVYFSKENGQVAVFDATNTTRERRAVINSFAKERGYKVFFVESICDDPEIIAENIRQVKFGSPDYIDRDEDEAMEDFIKRIDCYKTSYLPIDDEKDRNLSYIKIFDVGSRYLVNRVRDHIQSRIVYYLMNIHVTPRSIYLSRHGESELNLLGRIGGDSSLSPRGQKFASSLASFIRGQRIKDLKVWTSHMKRTIQTAEALG-VQYEQWKALNEIDAGVCEELTYEEIQENFMEEFALRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKPADELPYLRCPLHTVLKLTPVAYGCKVESFYLNIEAVNTHRERPKNVSINRDPDEALQTVPEHV 460          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Match: ENSORLT00000024564.2 (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase [Source:NCBI gene;Acc:101162989])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 266/430 (61.86%), Postives = 331/430 (76.98%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNS-EGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IVM+GLPARGKTYISKK+TRY NW+GV+T+ FNVG+YRR+ T  Y  ++FF P N EA  IR      AL D+  +L   +G++AVFDATNTT ERR +IL    + G +V F+ES+CDDPE+I  NI +VK+ SPDY   +K+EA+ DF  RI  Y+  Y PLD++ D++ S+I+I+N G +YLVNKV  ++QSRIVYY+MNI    R+IY+CRHGESELNL GRIGG+  LS RG +FA  L  ++ +Q I +LKVWTSHMKRT +TA+ +   + EQWKALNEIDAG CEEMTYEEIQ +FP EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFL++S DELPYL+ PLHTVLKLTP AY C VE + L+I+AV+THR +P N+D DR   EAL+TVP H+
Sbjct:   53 LIVMVGLPARGKTYISKKLTRYLNWIGVSTKAFNVGEYRREATCSYNSYEFFSPDNTEAMEIRKTCVAAALKDVFTYLTRYQGQVAVFDATNTTPERRQVILSFAKDNGYKVFFVESICDDPEIIAENIKQVKLTSPDYTDCDKEEALVDFLKRIECYQQTYIPLDDDTDRNLSYIKIFNVGSRYLVNKVQDHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLLGRIGGDPGLSHRGTKFATALGDYMRDQSISDLKVWTSHMKRTIQTAEFLG-VQYEQWKALNEIDAGVCEEMTYEEIQEHFPEEFALRDQDKYRYRYPKGESYEDLVHRLEPVIMELERQENVLVICHQAVMRCLLAYFLNKSDDELPYLKCPLHTVLKLTPIAYGCKVESVFLNIEAVNTHRDRPENVDVDRDPEEALETVPDHM 481          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Match: pfkfb4b (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 [Source:NCBI gene;Acc:101174905])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 262/430 (60.93%), Postives = 332/430 (77.21%), Query Frame = 2
Query:  254 VIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEG-ELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            +IV +GLPARGKTYISKK+TRY NW+GV T+ FNVGDYRR+  + YK  +FF P N E   IR   A  AL D+  +L+ EG  +AVFDATNTTRERR+ I+      G +V F+ES+C+DP+VI  NI++VK+ +PDY   N +EA+EDF  RI+ YE++YQPLDE+ D++ S+I+I + G +YLVN+V  ++QSRIVYY+MNI    R+IY+CRHGES+LN+ GRIGG+S LS RG +FA++L  FI+ Q+I +LKVWTS MKRT +TA+ +     EQWKALNEIDAG CEEM YEEIQ ++P EFA RDQDK+ +RYP GESY+DLV RLEPVIMELERQ NVLVICHQAV RCLLAYFLD++ DELPYL+ PLHTVLKLTP AY C VE + L +++V+THR +P N+   R + +ALQTVP HL
Sbjct:   23 LIVTVGLPARGKTYISKKLTRYLNWIGVATKEFNVGDYRRECLKIYKSFEFFRPDNEEGLKIRRHCATSALNDVCQYLSVEGGHVAVFDATNTTRERRNTIINFAEQNGFKVFFVESVCEDPDVIAENIVQVKLGNPDYKNCNPEEALEDFMKRIKCYESSYQPLDEDLDRNVSYIKIIDVGRQYLVNRVADHIQSRIVYYLMNIHITPRSIYLCRHGESDLNIKGRIGGDSGLSPRGKDFAKRLRNFIDEQKIKDLKVWTSQMKRTIQTAECLG-VPYEQWKALNEIDAGVCEEMMYEEIQEHYPQEFAMRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKTADELPYLKCPLHTVLKLTPIAYGCQVESMYLGVESVNTHRERPQNVTTQRSTEDALQTVPAHL 451          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Planmine SMEST
Match: SMESG000015713.1 (SMESG000015713.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 2
Query:   83 MSLKIGNESPKIGRIKRITSVDVSPCSIPYTCNNRVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 1540
            MSLKIGNESPKIGRIKRITSVDVSPCSIPYTCNNRVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL
Sbjct:    1 MSLKIGNESPKIGRIKRITSVDVSPCSIPYTCNNRVRKISVCPPDHHREFNNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARKLAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCEEMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQNNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVEEISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL 486          
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Planmine SMEST
Match: SMESG000068403.1 (SMESG000068403.1)

HSP 1 Score: 225.713 bits (574), Expect = 1.981e-68
Identity = 104/217 (47.93%), Postives = 155/217 (71.43%), Query Frame = 2
Query:  239 EQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLTQQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNS-EGELAVFDATNTTRERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNKDEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNLQSRIVYYIMNIRPVKRTI 886
            E KK+VIV+IGLPARGK+Y+SKK+ +Y NW+ ++ ++FNVG+YRR+   +Y G++FFD +N +AQ IR  +A  A+ D+IDWLN+ +G++A FDATNTTRERR  I        I+++FLE +CDD   I  NI +VK+ + DY+   +++A++DFK+RI HY   Y+P+D EFDK  SFIRI+N+G ++ +NK+    +  I ++I +IR   R I
Sbjct:    7 ENKKLVIVLIGLPARGKSYVSKKLCKYLNWLNISAQIFNVGNYRREFEGEYTGNNFFDGNNCDAQKIRKLSADSAMNDMIDWLNNRDGKIAFFDATNTTRERRHWIEMSVTQHQIDILFLEIVCDDQHTINDNIEKVKLFTRDYLHCPREDAIKDFKSRIEHYAAVYEPVDGEFDKSTSFIRIFNKGSRFEINKIDSIFKQEIFHFIKSIRLTNRFI 223          
The following BLAST results are available for this feature:
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PFKFB10.000e+057.176-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB40.000e+062.706-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB40.000e+061.316-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB20.000e+062.236-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB20.000e+060.616-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkb-1.12.787e-15751.40pep chromosome:WBcel235:I:5131460:5134101:1 gene:W... [more]
pfkb-1.12.787e-15751.40pep chromosome:WBcel235:I:5131288:5134099:1 gene:W... [more]
pfkb-1.12.787e-15751.40pep chromosome:WBcel235:I:5131531:5134099:1 gene:W... [more]
pfkb-1.12.787e-15751.40pep chromosome:WBcel235:I:5131520:5134099:1 gene:W... [more]
pfkb-1.11.747e-14951.60pep chromosome:WBcel235:I:5131288:5134032:1 gene:W... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pfrx0.000e+059.29gene:FBgn0027621 transcript:FBtr0307193[more]
Pfrx0.000e+059.29gene:FBgn0027621 transcript:FBtr0074715[more]
Pfrx0.000e+059.29gene:FBgn0027621 transcript:FBtr0074714[more]
Pfrx0.000e+059.29gene:FBgn0027621 transcript:FBtr0074720[more]
Pfrx0.000e+059.29gene:FBgn0027621 transcript:FBtr0074713[more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkfb10.000e+062.566-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb10.000e+062.566-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb4b0.000e+057.086-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb4a0.000e+061.406-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb4b0.000e+061.776-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PFKFB10.000e+059.446-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB10.000e+061.866-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB10.000e+061.866-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB10.000e+061.866-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
PFKFB10.000e+061.866-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pfkfb10.000e+061.546-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
Pfkfb40.000e+062.706-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
Pfkfb10.000e+061.546-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
Pfkfb40.000e+062.476-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
Pfkfb20.000e+061.696-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91309|F26_LITCT0.000e+057.896-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
sp|P07953|F261_RAT0.000e+058.056-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
sp|P25114|F264_RAT0.000e+063.176-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
sp|Q6DTY7|F264_MOUSE0.000e+062.706-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
sp|P70266|F261_MOUSE0.000e+061.546-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6630.000e+064.196PF2K domain-containing protein (Fragment) OS=Schi... [more]
A0A0X3PVW20.000e+063.686-phosphofructo-2-kinase/fructose-2, 6-bisphosphat... [more]
A0A5K3FIF70.000e+062.14Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4E0RXI90.000e+059.336-phosphofructo-2-kinase / fructose-2 6-bisphospha... [more]
W6UNF00.000e+061.306-phosphofructo-2-kinase/fructose-2, 6-biphosphata... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkfb10.000e+062.566-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb10.000e+062.566-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb4b0.000e+062.246-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
pfkfb4b0.000e+062.246-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
pfkfb4a0.000e+061.866-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfkfb10.000e+063.176-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FBP266.408e-13246.68Fructose-2,6-bisphosphatase, required for glucose ... [more]
PFK268.001e-9138.226-phosphofructo-2-kinase; inhibited by phosphoenol... [more]
YLR345W_mRNA1.525e-5226.79Similar to 6-phosphofructo-2-kinase enzymes; mRNA ... [more]
PFK271.449e-1629.786-phosphofructo-2-kinase; catalyzes synthesis of f... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO425385.223e-17855.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346194.717e-14750.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262351.474e-1754.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pfkfb4a0.000e+063.026-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
pfkfb10.000e+063.266-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb10.000e+063.266-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
ENSORLT00000024564.20.000e+061.866-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
pfkfb4b0.000e+060.936-phosphofructo-2-kinase/fructose-2,6-bisphosphata... [more]
back to top
BLAST of 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000015713.10.000e+0100.00SMESG000015713.1[more]
SMESG000068403.11.981e-6847.93SMESG000068403.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018359 ID=SMED30018359|Name=6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1759bp
GTTTATCTCTAAATTTTACTAAATTCAAAATTGCTAAATTGTTTTACTTA
TACAGTTTAAAATTGTTCTTAAAGTACTGCACATGTCCTTGAAAATAGGT
AATGAAAGTCCGAAAATTGGTAGAATTAAAAGAATAACAAGTGTCGACGT
ATCTCCATGTTCAATACCTTACACTTGTAATAATCGAGTAAGAAAAATAT
CTGTTTGTCCGCCAGATCATCATCGAGAATTTAATAATGAACAGAAAAAA
ATTGTCATTGTTATGATAGGATTGCCTGCTCGAGGTAAGACATATATTTC
CAAGAAAATGACTCGATATTTTAATTGGATGGGTGTCACTACTCGAGTAT
TTAATGTTGGAGATTATCGAAGAAAACTAACACAACAATACAAGGGACAT
GATTTTTTTGACCCTAGTAATGTTGAAGCTCAGACAATTAGGAGTTTTGC
CGCTCAAGAAGCCTTGTATGATTTAATTGATTGGCTGAATAGTGAAGGCG
AGTTGGCTGTATTTGATGCTACAAATACAACTAGAGAAAGAAGAAGCATG
ATTTTAGAAATATGTTTCAATTGTGGAATTGAAGTTATTTTTCTTGAATC
TTTATGTGATGATCCAGAAGTTATTAAGGCTAATATTCTTGAAGTTAAAG
TAGATAGTCCTGATTATGTTGGTATGAATAAAGATGAAGCAGTTGAAGAT
TTCAAGAACAGAATAAGGCATTACGAGACTGCTTATCAACCGTTAGATGA
GGAATTTGACAAGGATTATTCTTTTATTCGTATATATAATCAAGGTGTTA
AGTATTTAGTTAATAAAGTACATGGAAATTTGCAAAGTCGAATAGTCTAT
TATATTATGAATATTAGGCCTGTTAAGCGAACTATTTACATATGCCGACA
CGGTGAAAGTGAATTGAATCTGAATGGAAGGATTGGCGGAAATTCTTCTT
TATCAAGTCGAGGCCATGAATTTGCTCGTAAACTAGCTATATTTATTAAT
AATCAAGAAATTCCAAATTTAAAAGTTTGGACTAGTCATATGAAACGCAC
TTGGGAAACGGCTAAACAAATAAATTGCACGCGCATTGAGCAATGGAAGG
CTCTTAATGAAATCGATGCAGGTAAGTGCGAAGAAATGACGTACGAAGAA
ATCCAATCAAATTTCCCAACTGAATTTGCGCAAAGAGATCAGGATAAATT
TAATTTTCGGTATCCTATGGGGGAATCTTATCAAGATTTGGTCAGCCGAC
TAGAACCAGTCATAATGGAACTGGAACGACAGAATAATGTATTAGTTATT
TGCCACCAAGCTGTAGCCAGATGTCTTTTAGCATATTTTTTAGATCGATC
TAAAGATGAATTGCCGTATTTACGGGTACCTTTACATACTGTGTTAAAAT
TAACACCCACTGCCTACCGGTGTATTGTTGAGGAAATATCGTTAGACATT
GATGCTGTTGACACGCATCGAGCTAAACCCACGAATATTGATGAAGATCG
GCCTTCCTTTGAAGCTCTGCAGACAGTTCCTCCACATTTATAATAATAGT
CAAGAATCGTTGGATGTAACAAATGATCATTATTCTATTAATTTTAAACC
AGAGATAAAATTATATTTAGGATCTCTGATTCATTAATAAAATGTTAGAA
ACTAATGATGATGCTGTTGATTTTTTTCATTCTTTATCAAATTATTAAAA
GAATATAATAATATTTTCATTAAACTTTAATTGGATATTATTATTTTAAA
TCATAGAAC
back to top

protein sequence of SMED30018359-orf-1

>SMED30018359-orf-1 ID=SMED30018359-orf-1|Name=SMED30018359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MSLKIGNESPKIGRIKRITSVDVSPCSIPYTCNNRVRKISVCPPDHHREF
NNEQKKIVIVMIGLPARGKTYISKKMTRYFNWMGVTTRVFNVGDYRRKLT
QQYKGHDFFDPSNVEAQTIRSFAAQEALYDLIDWLNSEGELAVFDATNTT
RERRSMILEICFNCGIEVIFLESLCDDPEVIKANILEVKVDSPDYVGMNK
DEAVEDFKNRIRHYETAYQPLDEEFDKDYSFIRIYNQGVKYLVNKVHGNL
QSRIVYYIMNIRPVKRTIYICRHGESELNLNGRIGGNSSLSSRGHEFARK
LAIFINNQEIPNLKVWTSHMKRTWETAKQINCTRIEQWKALNEIDAGKCE
EMTYEEIQSNFPTEFAQRDQDKFNFRYPMGESYQDLVSRLEPVIMELERQ
NNVLVICHQAVARCLLAYFLDRSKDELPYLRVPLHTVLKLTPTAYRCIVE
EISLDIDAVDTHRAKPTNIDEDRPSFEALQTVPPHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR0030946Pfruct_kin
IPR013078His_Pase_superF_clade-1
IPR027417P-loop_NTPase
IPR029033His_PPase_superfam
IPR0130796Phosfructo_kin
IPR001345PG/BPGM_mutase_AS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0005524ATP binding
GO:00038736-phosphofructo-2-kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006003fructose 2,6-bisphosphate metabolic process
GO:0006000fructose metabolic process
GO:0008152metabolic process
GO:0016310phosphorylation
GO:0046835carbohydrate phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003094Fructose-2,6-bisphosphatasePRINTSPR009916PFRUCTKNASEcoord: 246..267
score: 53.6
coord: 346..362
score: 67.65
coord: 167..181
score: 57.22
coord: 193..207
score: 48.06
coord: 268..290
score: 71.74
coord: 141..155
score: 85.83
IPR003094Fructose-2,6-bisphosphatasePANTHERPTHR106066-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASEcoord: 19..483
IPR013078Histidine phosphatase superfamily, clade-1SMARTSM00855PGAM_5coord: 267..415
e-value: 1.1E-13
score: 61.5
IPR013078Histidine phosphatase superfamily, clade-1PFAMPF00300His_Phos_1coord: 268..451
e-value: 1.3E-38
score: 132.7
IPR013078Histidine phosphatase superfamily, clade-1CDDcd07067HP_PGM_likecoord: 267..454
e-value: 2.51715E-28
score: 107.793
IPR0130796-phosphofructo-2-kinasePFAMPF015916PF2Kcoord: 51..263
e-value: 3.6E-87
score: 291.4
IPR029033Histidine phosphatase superfamilyGENE3DG3DSA:3.40.50.1240coord: 265..485
e-value: 1.1E-76
score: 259.1
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 267..474
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 55..262
e-value: 1.2E-86
score: 291.7
NoneNo IPR availablePIRSFPIRSF0007096PFK_fruc_bisph_Ptasecoord: 8..480
e-value: 7.1E-200
score: 663.3
NoneNo IPR availablePANTHERPTHR10606:SF156-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE 1coord: 19..483
IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active sitePROSITEPS00175PG_MUTASEcoord: 270..279
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 57..264