Glycine amidinotransferase, mitochondrial

Overview
NameGlycine amidinotransferase, mitochondrial
Smed IDSMED30018353
Uniprot Best hitGlycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1 (E=1.23641e-125)
Length (bp)1408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine amidinotransferase, mitochondrial (SMED30018353) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30018353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine amidinotransferase, mitochondrial (SMED30018353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30018353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Glycine amidinotransferase, mitochondrial ( AGAT-1 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 3 cell and integumental system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30018353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30018353SMESG000051964.1 dd_Smed_v4_920_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
Category 3 cellSMED30018353SMESG000051964.1 dd_Smed_v4_920_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30018353SMESG000051964.1 SMED_00498_V2_1rGPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30018353SMESG000051964.1 SMED_00498_V2_1rGPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:23318641whole organismasexual adultfluorescence in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:23318635whole organismasexual adultfluorescence in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gutSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:26457503whole organismasexual adultcolorimetric in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:26114597whole organismasexual adultfluorescence in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
parenchymaSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:26457503whole organismasexual adultcolorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:24704339whole organismasexual adultfluorescence in situ hybridization evidence
parenchymaSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:26114597whole organismasexual adultcolorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28292427whole organismasexual adultfluorescence in situ hybridization evidence
epidermal progenitor cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
Category 3 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:29357350whole organismasexual adultfluorescence in situ hybridization evidence
X1 cellSMED30018353SMESG000051964.1 SMED30018353smed_20140614PMID:29100657FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30018353SMESG000051964.1 SmedASXL_002889SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
Category 3 cellSMED30018353SMESG000051964.1 NB.8.8bsmed_ncbi_20200123PMID:18786419whole organismasexual adultcolorimetric in situ hybridization evidence
Category 3 cellSMED30018353SMESG000051964.1 NB.8.8bsmed_ncbi_20200123PMID:18786419whole organismasexual adultcDNA to DNA expression microarray evidence
Category 3 cellSMED30018353SMESG000051964.1 dd_Smed_v6_920_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Category 2 cellSMED30018353SMESG000051964.1 dd_Smed_v6_920_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Homology
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 362.073 bits (928), Expect = 2.810e-121
Identity = 183/367 (49.86%), Postives = 244/367 (66.49%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PG+ ++ P+RPC QI + KKAGW ++  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GIT +KV  ++  S+GGG HCWT DVRRRG LQ+Y D
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 313.923 bits (803), Expect = 7.493e-103
Identity = 161/332 (48.49%), Postives = 218/332 (65.66%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGI 1157
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PG+ ++ P+RPC QI + KKAGW ++  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK G+
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGM 388          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 121.709 bits (304), Expect = 5.631e-32
Identity = 59/137 (43.07%), Postives = 86/137 (62.77%), Query Frame = 3
Query:  267 AKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY 677
            ++A   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y
Sbjct:   22 SRANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDY 154          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 368.622 bits (945), Expect = 4.433e-124
Identity = 181/363 (49.86%), Postives = 240/363 (66.12%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            PV A NEWDPLEE+++G  + AC P    E KA   E  + F  ++ G+ +      EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQV+N  GIEW+RRHL+P   ++H ++F DP PMHID T     PGL ++ P+RPC QI M KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI  VKV  +H  S+GGG HCWT+DVRRRG LQ+YF
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQTFPK----EHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 198.364 bits (503), Expect = 7.903e-60
Identity = 101/226 (44.69%), Postives = 135/226 (59.73%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLA 848
            PV A NEWDPLEE+++G  + AC P    E K                 Y       EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQV+N  GIEW+RRHL+
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVK-----------------YGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLS 272          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:NCBI gene;Acc:266799])

HSP 1 Score: 176.792 bits (447), Expect = 7.219e-52
Identity = 91/211 (43.13%), Postives = 123/211 (58.29%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQ 803
            PV A NEWDPLEE+++G  + AC P    E K                +Y       EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQ
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVK----------------QYGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQ 258          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 370.548 bits (950), Expect = 9.434e-125
Identity = 190/395 (48.10%), Postives = 250/395 (63.29%), Query Frame = 3
Query:   81 IARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            + RS     +  V  K  A     +    +  PV ++NEWDPLEE+++G P+ A  P    E KA   E  + F  KH G+ +      EH K   +E +    +L+ EGV V  PE ID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+ LIKDY+ RGAKWT APKP   + L+ ++Y  R  ED          + TE EP FDAADF+R GRDIFA  SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FEK GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YF
Sbjct:   20 VQRSFQSTQAAAVSEKPCAADEKVSDTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 409          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: tmem222 (transmembrane protein 222 [Source:Xenbase;Acc:XB-GENE-943282])

HSP 1 Score: 370.163 bits (949), Expect = 1.681e-124
Identity = 190/395 (48.10%), Postives = 250/395 (63.29%), Query Frame = 3
Query:   81 IARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            + RS     +  V  K  A     +    +  PV ++NEWDPLEE+++G P+ A  P    E KA   E  + F  KH G+ +      EH K   +E +    +L+ EGV V  PE ID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+ LIKDY+ RGAKWT APKP   + L+ ++Y  R  ED          + TE EP FDAADF+R GRDIFA  SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FEK GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YF
Sbjct:   32 VQRSFQSTQAAAVSEKPCAADEKVSDTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 374.785 bits (961), Expect = 1.768e-126
Identity = 186/367 (50.68%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ +NY   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 374.785 bits (961), Expect = 1.768e-126
Identity = 186/367 (50.68%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ +NY   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q9D964|GATM_MOUSE (Glycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 1.236e-125
Identity = 186/367 (50.68%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ +NY   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q9I9K9|GATM_CHICK (Glycine amidinotransferase, mitochondrial OS=Gallus gallus OX=9031 GN=GATM PE=2 SV=2)

HSP 1 Score: 373.629 bits (958), Expect = 3.505e-125
Identity = 190/397 (47.86%), Postives = 258/397 (64.99%), Query Frame = 3
Query:   81 IARSLHD-QISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            + RSL   Q +    N+ +A   + +P   K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G+ +      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+++IKDY++ GAKWT APKP   + L+ ++Y  R+ ED      +   + TE EP FDAADFIR GRDIF   SQV+N  GIEW+RRHLAP   RVH ++F DP PMHIDTT     PGL ++ P+RPC QI + KKAGW V+  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YFD
Sbjct:   32 VQRSLQSTQAAAASQNRCAAEDKAQSPA-PKECPVCSYNEWDPLEEVIVGRAENACVPPFSVEVKANTYEKYWGFYQKFGGESFPK----DHVKKAIAEIEEMCNILKKEGVIVKRPDPIDWSVKYRTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRRIIKDYFNNGAKWTTAPKPTMADELYDQDYPIRSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFVQRSQVTNYMGIEWMRRHLAPD-YRVHVISFKDPNPMHIDTTFNIIGPGLVLSNPDRPCHQIELFKKAGWTVIHPPVPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFENLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFD 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|P50442|GATM_RAT (Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gatm PE=1 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 7.255e-125
Identity = 185/367 (50.41%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|P50441|GATM_PIG (Glycine amidinotransferase, mitochondrial OS=Sus scrofa OX=9823 GN=GATM PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 3.245e-124
Identity = 182/367 (49.59%), Postives = 246/367 (67.03%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+R+HLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +K+  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKYGGHYFPK----DHLKKAVAEIEEMCNILKMEGVTVRRPDPIDWSVKYKTPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRSIIKDYFRRGAKWTTAPKPTMADELYDQDYPIYSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYMGIEWMRKHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPIPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKISIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q6P832|GATM_XENTR (Glycine amidinotransferase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=gatm PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 8.903e-124
Identity = 190/395 (48.10%), Postives = 250/395 (63.29%), Query Frame = 3
Query:   81 IARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            + RS     +  V  K  A     +    +  PV ++NEWDPLEE+++G P+ A  P    E KA   E  + F  KH G+ +      EH K   +E +    +L+ EGV V  PE ID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+ LIKDY+ RGAKWT APKP   + L+ ++Y  R  ED          + TE EP FDAADF+R GRDIFA  SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FEK GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YF
Sbjct:   32 VQRSFQSTQAAAVSEKPCAADEKVSDTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: gnl|BL_ORD_ID|20315891 (tr|A0A1S6KMF4|A0A1S6KMF4_SCHMD Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 410/410 (100.00%), Postives = 410/410 (100.00%), Query Frame = 3
Query:   69 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH 1298
            MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH
Sbjct:    1 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH 410          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: gnl|BL_ORD_ID|22850758 (tr|A0A3Q0KNU0|A0A3Q0KNU0_SCHMA Glycine amidinotransferase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 4.197e-145
Identity = 205/413 (49.64%), Postives = 280/413 (67.80%), Query Frame = 3
Query:   69 MLTKIARSLHDQISINVVNKLSARLCSYTPG----------NKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKT----SILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            M + I R  + Q SI  V  +++     T            NK  SPV +WNEWDPLEEI++G P+ A  P +LPE K C +  K +F +++ GKYW DVI  EH++++  + ++F+KIL+ EG+KVV P+P+D  K+    +    G   AMPRDFLLIVG+E+IE+TMTWRSRYFE++ Y+ L  +YW +GAKWT APKP    T F +  R +  +    DE       + TE EP FDAADFIR GRDIFA  SQV+N +GIEWVRRHL P+GI+VH ++FVDP+PMHID T    +PG+A+  P+RPC Q  +++KAGW +V APYP + K+   ++ S WLS+NV+MLD+NRV+VE +E GIQ++++  GI P+ V FK+  SIGGG HCWT D+RR+G L++YFDW
Sbjct:    1 MASTILRKFYQQ-SIKYVQNVTSVPIKTTSSLYSTDVELKQNKLKSPVNSWNEWDPLEEIIVGTPEYATVPYLLPEVKTCAASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKILELEGIKVVRPDPVDHRKSYKLLDIETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWKQGAKWTIAPKP----TNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAVQNPDRPCHQFDIIRKAGWQIVNAPYPLMKKDHEMWLGSNWLSMNVLMLDQNRVVVESEETGIQEMYKSMGIKPINVKFKYANSIGGGFHCWTCDIRRQGKLESYFDW 408          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: gnl|BL_ORD_ID|16276653 (tr|A0A183AH38|A0A183AH38_9TREM Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS6273 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.809e-143
Identity = 195/364 (53.57%), Postives = 259/364 (71.15%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLF-KENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            PV +WNEWDPLEEI++G+PD A  P ++PE K C++E+ + F  K+ GKYW D +  +H+ ++  +   F++ L+ EGVKV+ PEP+D  K+     F + G   AMPRDFLL+VG+E+IE+TMTWR+RYFE++ Y+ +I DYW RGAKWT APKP   + L  +E  +  E+  +       I TE EP FDAADFIR GRDIF   SQV+N AGIEWVRRHL P+GIRVH + F DP+PMHID T    +PG+A+  P+R C +I + K AGWDVV  P P I+K+ P ++ S WLS+NV+MLD  RV+VE++E+GIQ+++ K G+TPV V  +H  SIGGG HCWT DVRRRG LQ+YFDW
Sbjct:   14 PVNSWNEWDPLEEIIVGIPDYATVPHLVPEVKICVAESNWAFFEKNAGKYWADAMPRDHWDLLCRQINEFVRKLELEGVKVIRPEPVDHRKSYSLLGFQSQGFYSAMPRDFLLVVGDELIEATMTWRARYFEYVSYRPIIMDYWKRGAKWTVAPKPTDYQKLINQETAKHLENHVSDKSNIGHITTESEPCFDAADFIRAGRDIFVQRSQVTNLAGIEWVRRHLEPRGIRVHRLTFEDPRPMHIDATFSLVKPGVALQNPDRQCHEIDLFKAAGWDVVDVPRPLISKSHPLWLGSNWLSMNVLMLDPTRVMVEEEEVGIQEMYRKIGVTPVPVKIRHANSIGGGFHCWTCDVRRRGGLQSYFDW 377          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: gnl|BL_ORD_ID|22711311 (tr|A0A095AQE5|A0A095AQE5_SCHHA Glycine amidinotransferase, mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_04855 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 4.895e-143
Identity = 195/372 (52.42%), Postives = 265/372 (71.24%), Query Frame = 3
Query:  162 NKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKT----SILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            NK  SPV +WNEWDPLEEI++G P+ A  P +LPE K C +  K +F +++ GKYW DVI  EH++++  + ++F+K+L+ EG+KVV P+P+D  K+    +F   G   AMPRDFLLIVG+E+IE+TMTWRSRYFE++ Y+ L  +YW +GAKWT  PKP    T F +  R +  +    DE       + TE EP FDAADFIR GRDIFA  SQV+N +GIEWVRRHL P+GI+VH ++FVDP+PMHID T    +PG+AI  P+RPC Q+  ++KAGW V+ AP P + K+   ++ S WLS+NV+MLD+NRV+VE +E GIQ++++  GI P+ V FK+  SIGGG HCWT D+RR+  L++YFDW
Sbjct:   41 NKLTSPVNSWNEWDPLEEIIVGTPEYATVPHLLPEVKTCAASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKMLELEGIKVVRPDPVDHRKSYKLLDFETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWKQGAKWTIGPKP----TNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAIQNPDRPCHQVDFIRKAGWQVINAPQPLMKKDHEMWLGSNWLSMNVLMLDQNRVIVESEETGIQEMYKSIGIKPINVKFKYANSIGGGFHCWTCDIRRQSKLESYFDW 408          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: gnl|BL_ORD_ID|20355262 (tr|H2KUH6|H2KUH6_CLOSI Glycine amidinotransferase mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_109091 PE=4 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 7.703e-143
Identity = 201/405 (49.63%), Postives = 270/405 (66.67%), Query Frame = 3
Query:   69 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKK-----HSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTS-ILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            +L K+  S +  +S    +++  R  S T GN K      SPVW+WNEWDPLEEI++G P+ A  P  LPE K C   + ++F  K+ G+YW D I  EH++ ++ E + ++++LQ EGVKV+ P  +D + T     F + G   AMPRDFLL++GNE+IE+TMTWRSRYFE++ Y+ LI +YW +GAKWT APKP   + +  +      DS          I TE EP FDAADF R GRDIF   SQV+N AGIEWVRRH+ P GIRVH + F DP+PMHID T    +PG+AI  P+RPC Q  ++K AGWDV+ AP P++ K+ PY++ S WLS+NV+MLD  RVLVEK E  I +++ + GITP+ V  +H  SIGG  HCWTSD++RRG+L++YFDW
Sbjct:    6 LLAKLGSSRNHLLS---SSQIFHRKFSDTGGNSKTPVNSSSPVWSWNEWDPLEEIIVGTPEGAVVPRPLPEVKMCTPMDTWEFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVDHSSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLILEYWKQGAKWTVAPKPTDFDAIINKEVTKKLDSGVSDKSNIGFITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVIDAPTPNVPKSHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIKRRGNLESYFDW 407          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:103044592])

HSP 1 Score: 369.777 bits (948), Expect = 1.339e-124
Identity = 184/363 (50.69%), Postives = 240/363 (66.12%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            PV A+NEWDPLEE+++G  + A  P    E KA   E  + F  K+ G+ + +    EH K  + E +    IL+ EGV V  PEPID++    TP+FT+ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGAKWT APKP   + L+ + Y  R  ED      E   + TE EP FDAADFIR G D+F   SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI M KKAGW VV  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI  +KV  +H  S+GGG HCWT+DVRRRG LQ+YF
Sbjct:   57 PVCAYNEWDPLEEVIVGRAENARVPPFTVEVKANTYEKYWPFYQKYGGQTFPE----EHLKKAIAEIEEMCNILRHEGVTVQRPEPIDWSVEYKTPDFTSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGAKWTTAPKPTMADELYDQEYPIRTVEDRHKLAAEGKFVTTEHEPCFDAADFIRAGTDLFVQRSQVTNFLGIEWMRRHLAPH-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFENLGIKTIKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 414          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO35968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK04])

HSP 1 Score: 353.599 bits (906), Expect = 1.387e-118
Identity = 178/363 (49.04%), Postives = 235/363 (64.74%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            PV + NEWD LEE+++G  + A  P+  PE KA  S   + F   + G+ +      EH K    E + F  IL  EGV V  PEPIDF++   TP+F + G+  AMPRD LL+VG+E+IES M WRSR+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+  +Y  R+ ED      E   + TE EP FDAADF+R GRDIF   SQV+N  GIEW++RHL  +  R+H+++F DP PMHID T     PGL ++ P+RPC QI M KKAGW VV  P P I  + P ++SS+WLS+NV+MLD  RV+ +K+E    K+FEK GITP+ V  +   S+GGG HCWT DVRRRG L++Y 
Sbjct:   71 PVGSHNEWDLLEEVIVGNVEGATVPKFTPEVKANTSHKNWKFFELYGGRPFP----AEHLKKAATEIEEFCNILHHEGVTVRRPEPIDFSEVCKTPDFESSGLYSAMPRDILLVVGDEIIESPMAWRSRFFEYRAYRPLIKEYFRRGARWTTAPKPQMSDELYDLDYPIRSVEDRHKLSSEGKFVTTEFEPCFDAADFMRAGRDIFVQRSQVTNYMGIEWMKRHLGNQ-YRIHTLSFDDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDMFKKAGWTVVQPPEPLIPDSHPLWMSSKWLSMNVLMLDPTRVVCDKNETTTIKMFEKLGITPIPVSIRFANSLGGGFHCWTCDVRRRGKLESYL 428          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Match: gatm (glycine amidinotransferase [Source:NCBI gene;Acc:101156236])

HSP 1 Score: 365.54 bits (937), Expect = 5.813e-123
Identity = 181/371 (48.79%), Postives = 243/371 (65.50%), Query Frame = 3
Query:  153 TPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            T    +  PV ++NEWDPLEE+++G  + A  P    E KA   E  + F  KH G+ +      +H K  + E +    IL+ EGV V  PEPID++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ +GAKWT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR GRD+F   SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC Q+ M KKAGW VV  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI  +KV  +H  S+GGG HCWT+DVRRRG LQ+YF
Sbjct:   57 TESAPQECPVCSYNEWDPLEEVIVGRAENAHVPPFTVEVKANTYEKYWPFYQKHGGQSFP----ADHLKKAVAEIEEMCNILRHEGVVVRRPEPIDWSLEYKTPDFSSTGMYAAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRKGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAQGKFVTTEHEPCFDAADFIRAGRDLFVQRSQVTNYMGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQVDMFKKAGWTVVKPPTPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIQTIKVNIRHANSLGGGFHCWTTDVRRRGTLQSYF 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051964.1 (SMESG000051964.1)

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 408/410 (99.51%), Postives = 409/410 (99.76%), Query Frame = 3
Query:   69 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH 1298
            MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYK+MLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDE RVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH
Sbjct:    1 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKLMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDEKRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFETH 410          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051953.1 (SMESG000051953.1)

HSP 1 Score: 438.343 bits (1126), Expect = 1.085e-151
Identity = 215/416 (51.68%), Postives = 283/416 (68.03%), Query Frame = 3
Query:   69 MLTKIAR-----SLHDQISINVVNKLSARLCSYT----PGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISEN-KFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEK 1286
            ML+K  R     SL+ +IS    N      CS +    P NK++SPVW+WNEWDPLEE+++G+PD    P   PE  AC  E    +F+ K+ GKYW D++  E +  +L EHK F  IL+GEGV VVHP P+D  K   TP F + G+D A PRD +L+VG+E++E+TMTWRSR++E++CY+ L+ DYW RGA + +APKP+C E  FK+++   + S   FDE   + TE EP+FDAADF+R GRDIF   S V+N  GIEW+RRHLA KGIR+H +NF DP  MHID T FT +PG  I  PE        LKKAGW +V  P P    +    +S +WLS+NV++LD+ RVLVEK E+G+ K+FE  G+ P+KV F HCF++GGG+HCWTSDVRR+G L+NYFDWPQE+LEK
Sbjct:    1 MLSKFNRILPLNSLY-KISAPAANIKYRNCCSKSSTDKPTNKRNSPVWSWNEWDPLEEVIVGVPDHGVVPYPYPETAACFGERLTENFMKKYGGKYWSDIMPKEVWNNVLKEHKEFCNILKGEGVTVVHPTPMDMKKEYETPYFKSVGLDVAFPRDIILVVGDEIMETTMTWRSRFWEYLCYRPLMLDYWKRGANFQSAPKPVCSEESFKKDF---DISGNKFDELGYVTTEFEPMFDAADFMRAGRDIFVQQSHVTNATGIEWMRRHLAEKGIRLHLLNFNDPYAMHIDATFFTVKPGYLIENPEVINPYADYLKKAGWKIVKGPKPADRSDMYEGMSYKWLSMNVLVLDQKRVLVEKREVGMHKMFESIGMQPIKVDFGHCFAVGGGLHCWTSDVRRKGTLENYFDWPQEVLEK 412          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000068402.1 (SMESG000068402.1)

HSP 1 Score: 408.297 bits (1048), Expect = 8.487e-140
Identity = 191/375 (50.93%), Postives = 262/375 (69.87%), Query Frame = 3
Query:  165 KKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKF 1289
            KK SPVW+WNEWD LEE V+G+PD A  P + PE KAC+S + +DFL  + GKYW D++   H+K + +E + F K+L+GEGVKVV PE  DF K      F +HG+  AMPRD +L+VG+E+IESTMTW+SRYFEF+ Y+KL+K Y+ +GAKWT APKP+  + L +++Y  D   T   ++   I TE+E  FDAADF RCG+DIF   SQV+N+A I W+RRHLAP+GIRVH +NF D   MH+D TL   +PG+ +  P+ P +++      GW+ V  P P +++    Y+SS +L++N +M+D  RV +EK+E G QKLFE  G+  + V  KHCFSIGGG HCWTSD++RRG L+NYF+W +  L+K+
Sbjct:   47 KKKSPVWSWNEWDHLEECVVGIPDNAVVPTMTPEVKACMSPDLWDFLDANGGKYWSDILPDGHWKQLQNEIEEFAKVLEGEGVKVVRPEAQDFGKIFTGLGFCSHGIYAAMPRDLVLVVGDELIESTMTWKSRYFEFVSYRKLLKGYYDKGAKWTVAPKPLMLDELLEKDY--DFYGT---NKLKRITTEKEICFDAADFFRCGQDIFGQRSQVTNSAAINWMRRHLAPQGIRVHELNFYDAFCMHVDATLVPVKPGVFLKNPKYPLVEMDNFTNCGWEFVDVPTPLLSEE-RLYMSSNYLAMNTLMMDPGRVFIEKEETGTQKLFESIGVKSIPVSMKHCFSIGGGFHCWTSDIKRRGTLENYFNWSKPFLDKY 415          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000051929.1 (SMESG000051929.1)

HSP 1 Score: 377.096 bits (967), Expect = 5.338e-128
Identity = 178/371 (47.98%), Postives = 241/371 (64.96%), Query Frame = 3
Query:  180 VWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKFE 1292
            V  WNEWDPLEEIV+G+PD A  P I  E K CI  + + F  ++ GKYW DV+    +  +L EHK+F   L+ EGVKVV+PE  +F       +    G+ CAMPRD LL +GNE+IE+ MTWRSRYFE   Y+KLI DYW RGA W AAPKP     LF+E+ ++D  S         + +E EP FDAADF+R G DIFA  SQV+NN GI+WVR H+  K IRV +++F DP+PMHID T    +PG+ ++ P+R C QI     AGW V+           PYY+SS W+++NV+M++EN+V+V+ D++ +Q LF    I  + V F+HC SIGGG HCW+ D+RR+GDLQ+YF+W   +++ + 
Sbjct:   22 VQVWNEWDPLEEIVVGIPDNAVIPPITIETKPCIHNSMWPFFKENSGKYWSDVLGQRFWSALLKEHKSFSDALKNEGVKVVNPETQNFENKYKIRDHETTGMYCAMPRDILLPIGNEIIEAPMTWRSRYFEINSYRKLIIDYWKRGASWVAAPKP-TYNNLFEESNKSDLISF--------VTSEAEPTFDAADFVRAGTDIFAQRSQVTNNLGIQWVRNHVKSKNIRVWTLSFDDPRPMHIDATFMPLKPGIILSNPDRKCHQIQNFLDAGWKVIYGIPRTNNNGHPYYLSSPWITMNVLMVNENKVIVDADDLEMQNLFRTLNIEVIPVKFRHCNSIGGGFHCWSVDIRRKGDLQSYFNWKSSVIDNYN 383          
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000043142.1 (SMESG000043142.1)

HSP 1 Score: 337.035 bits (863), Expect = 4.723e-112
Identity = 164/375 (43.73%), Postives = 233/375 (62.13%), Query Frame = 3
Query:  165 KKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWPQEILEKF 1289
            K+ SPVWAWNEWDPLEE+V+G+P+ A  P    E  A     +  F  KH GK + +V+  E +  + +E K  +++L+GEGVKVV PE ID+ +   TP F++ G+  AMPRDFLLIVG+E+IES M WR RYFE+  Y+ LI+ Y++ GA+WT+APK   ++ L+   +   ++    +     + TE EP FDAADF R GRDIF   S V+N   I+W+RRHLAP G+RVH + F     MHIDT  F  +PG+ +      C    +LKK+ WD+V+ P          +++   L  N++ +D  RVLVEK E  + K  ++ G  P+ V  K   ++GGG HCWT+D+RR+G L++YF+WP EILE+ 
Sbjct:   38 KQTSPVWAWNEWDPLEEVVVGVPNNATLPFPSQEVAATFGPPRLPFFQKHGGKKFSEVMGQEMWMKIENEIKELVRVLEGEGVKVVQPEAIDYDQKWTTPKFSSTGLYAAMPRDFLLIVGDEIIESPMAWRCRYFEYEAYRPLIRKYFNEGARWTSAPKCTMEDALYDMEFDVAQEKPYVY-----VTTELEPCFDAADFTRIGRDIFGQRSHVTNKKAIQWLRRHLAPSGVRVHDIEFDSLYSMHIDTNFFPVKPGMFLLKDGLNCKTPDLLKKSKWDIVIMPKGPHRDEHYKWMNYHGLPNNMLSIDTERVLVEKTEEYMIKFMQEIGFKPIPVSLKFANNLGGGFHCWTADIRRQGKLESYFEWPDEILERL 407          
The following BLAST results are available for this feature:
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GATM2.810e-12149.86glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM7.493e-10348.49glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM5.631e-3243.07glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gatm4.433e-12449.86glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm7.903e-6044.69glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm7.219e-5243.13glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem2229.434e-12548.10transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
tmem2221.681e-12448.10transmembrane protein 222 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Gatm1.768e-12650.68glycine amidinotransferase (L-arginine:glycine ami... [more]
Gatm1.768e-12650.68glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D964|GATM_MOUSE1.236e-12550.68Glycine amidinotransferase, mitochondrial OS=Mus m... [more]
sp|Q9I9K9|GATM_CHICK3.505e-12547.86Glycine amidinotransferase, mitochondrial OS=Gallu... [more]
sp|P50442|GATM_RAT7.255e-12550.41Glycine amidinotransferase, mitochondrial OS=Rattu... [more]
sp|P50441|GATM_PIG3.245e-12449.59Glycine amidinotransferase, mitochondrial OS=Sus s... [more]
sp|Q6P832|GATM_XENTR8.903e-12448.10Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203158910.000e+0100.00tr|A0A1S6KMF4|A0A1S6KMF4_SCHMD Uncharacterized pro... [more]
gnl|BL_ORD_ID|228507584.197e-14549.64tr|A0A3Q0KNU0|A0A3Q0KNU0_SCHMA Glycine amidinotran... [more]
gnl|BL_ORD_ID|162766531.809e-14353.57tr|A0A183AH38|A0A183AH38_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|227113114.895e-14352.42tr|A0A095AQE5|A0A095AQE5_SCHHA Glycine amidinotran... [more]
gnl|BL_ORD_ID|203552627.703e-14349.63tr|H2KUH6|H2KUH6_CLOSI Glycine amidinotransferase ... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm1.339e-12450.69glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359681.387e-11849.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gatm5.813e-12348.79glycine amidinotransferase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051964.10.000e+099.51SMESG000051964.1[more]
SMESG000051953.11.085e-15151.68SMESG000051953.1[more]
SMESG000068402.18.487e-14050.93SMESG000068402.1[more]
SMESG000051929.15.338e-12847.98SMESG000051929.1[more]
SMESG000043142.14.723e-11243.73SMESG000043142.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018353 ID=SMED30018353|Name=Glycine amidinotransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1408bp
CAAGGGTAGTTTGATTATTTAGAAAAAAAGGATTTCCACCGGTTTTCTGT
GATAAAAATTGTACAAAAATGCTTACCAAAATTGCTAGATCTCTGCACGA
TCAGATTTCCATAAACGTTGTCAACAAATTGTCAGCTAGGTTATGCTCGT
ATACACCTGGTAACAAAAAACACAGCCCGGTTTGGGCCTGGAATGAATGG
GACCCATTAGAAGAAATCGTTTTGGGACTTCCAGATATGGCATGTTGTCC
AGAGATTTTACCAGAAGCCAAAGCTTGCATTTCGGAAAACAAATTTGATT
TCCTTTTAAAACACAAAGGAAAATATTGGAAGGATGTAATTGAACCAGAA
CACTACAAAATAATGCTAGATGAGCACAAGAACTTCATAAAGATTCTACA
AGGAGAAGGAGTTAAAGTCGTCCATCCAGAACCGATTGATTTCGCTAAAA
CGCTCTGTACTCCAAACTTTACTGCCCATGGAGTCGACTGTGCGATGCCG
AGAGATTTTCTATTAATTGTCGGAAATGAAATGATTGAGTCCACCATGAC
TTGGAGATCGAGATATTTTGAATTTATGTGCTATAAAAAATTAATTAAAG
ATTACTGGAGCCGGGGCGCTAAATGGACAGCGGCACCAAAGCCGATGTGT
AAAGAAACACTTTTTAAAGAAAATTATCGTGCTGACGAAGATTCAACAGC
ATTTTTCGATGAAAAGACTTCGATTCTAACGGAAGAGGAACCAGTTTTCG
ACGCCGCAGATTTCATTCGATGTGGTAGGGATATATTTGCGCATGTCAGT
CAGGTTAGCAACAATGCAGGAATTGAATGGGTACGTAGACATTTGGCACC
GAAAGGAATTAGAGTTCATTCAATGAATTTCGTTGACCCTAAACCAATGC
ATATTGACACGACACTTTTCACACCTCGGCCAGGCCTCGCGATAACATGC
CCAGAAAGACCATGCTTACAAATTGGTATGCTTAAAAAAGCCGGCTGGGA
TGTTGTCGTTGCTCCTTATCCAGATATTGCAAAGAATTTCCCATACTATA
TCAGCTCTCAATGGTTGTCTCTTAATGTTGTCATGTTGGATGAAAACCGA
GTTCTCGTAGAGAAAGATGAAATTGGAATTCAAAAACTGTTTGAAAAGTG
TGGCATTACTCCTGTAAAAGTTCCATTCAAACACTGCTTTTCCATAGGAG
GTGGTATTCATTGCTGGACATCGGATGTTAGAAGGCGAGGAGACCTTCAA
AACTATTTTGACTGGCCTCAAGAAATCTTGGAGAAATTTGAAACTCACTG
AATATCACAATTGAAAATATAAAGAACATAACTTTTCCAACGTATATTAA
TTATTTGTAATAAAATACACTGCTTACATCGTGTCAATTTTATTTACTGA
TTAATTAC
back to top

protein sequence of SMED30018353-orf-1

>SMED30018353-orf-1 ID=SMED30018353-orf-1|Name=SMED30018353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEI
VLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIML
DEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLI
VGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFK
ENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNA
GIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCL
QIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKD
EIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWP
QEILEKFETH*
back to top
Aliases
The feature 'Glycine amidinotransferase, mitochondrial' has the following synonyms
Synonym
AGAT-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000033epidermal progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0000035Category 3 cell
PLANA:0004529integumental system
Vocabulary: INTERPRO
TermDefinition
IPR033195AmidinoTrfase
Vocabulary: molecular function
TermDefinition
GO:0015067amidinotransferase activity
GO:0016740transferase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000006Stage 6
PLANA:0000007Stage 7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 36..398
e-value: 4.6E-109
score: 366.8
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 36..398
IPR033195Glycine/inosamine-phosphate amidinotransferasePANTHERPTHR10488GLYCINE AMIDINOTRANSFERASE, MITOCHONDRIALcoord: 33..398