Glycine amidinotransferase, mitochondrial

Overview
NameGlycine amidinotransferase, mitochondrial
Smed IDSMED30018353
Uniprot Best hitGlycine amidinotransferase, mitochondrial OS=Mus musculus GN=Gatm PE=1 SV=1 (E=5.53284e-124)
Length (bp)1408
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine amidinotransferase, mitochondrial (SMED30018353) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30018353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine amidinotransferase, mitochondrial (SMED30018353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine amidinotransferase, mitochondrial (SMED30018353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Glycine amidinotransferase, mitochondrial ( AGAT-1 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 3 cell and integumental system

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 362.073 bits (928), Expect = 1.109e-119
Identity = 183/367 (49.86%), Postives = 244/367 (66.49%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PG+ ++ P+RPC QI + KKAGW ++  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GIT +KV  ++  S+GGG HCWT DVRRRG LQ+Y D
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 313.923 bits (803), Expect = 2.363e-101
Identity = 161/332 (48.49%), Postives = 218/332 (65.66%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGI 1157
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PG+ ++ P+RPC QI + KKAGW ++  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK G+
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGM 388          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Match: GATM (glycine amidinotransferase [Source:HGNC Symbol;Acc:HGNC:4175])

HSP 1 Score: 121.709 bits (304), Expect = 1.400e-31
Identity = 59/137 (43.07%), Postives = 86/137 (62.77%), Query Frame = 3
Query:  267 AKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY 677
            ++A   E  + F  K  G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y
Sbjct:   22 SRANTYEKYWPFYQKQGGHYFPK----DHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDY 154          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:ZFIN;Acc:ZDB-GENE-021015-1])

HSP 1 Score: 368.622 bits (945), Expect = 1.665e-122
Identity = 181/363 (49.86%), Postives = 240/363 (66.12%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            PV A NEWDPLEE+++G  + AC P    E KA   E  + F  ++ G+ +      EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQV+N  GIEW+RRHL+P   ++H ++F DP PMHID T     PGL ++ P+RPC QI M KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI  VKV  +H  S+GGG HCWT+DVRRRG LQ+YF
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQTFPK----EHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:ZFIN;Acc:ZDB-GENE-021015-1])

HSP 1 Score: 368.622 bits (945), Expect = 1.817e-122
Identity = 181/363 (49.86%), Postives = 240/363 (66.12%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            PV A NEWDPLEE+++G  + AC P    E KA   E  + F  ++ G+ +      EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQV+N  GIEW+RRHL+P   ++H ++F DP PMHID T     PGL ++ P+RPC QI M KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI  VKV  +H  S+GGG HCWT+DVRRRG LQ+YF
Sbjct:   62 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQQYGGQTFPK----EHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPT-YKIHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCRQIEMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQSYF 419          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:ZFIN;Acc:ZDB-GENE-021015-1])

HSP 1 Score: 198.364 bits (503), Expect = 1.027e-58
Identity = 101/226 (44.69%), Postives = 135/226 (59.73%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLA 848
            PV A NEWDPLEE+++G  + AC P    E K                 Y       EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQV+N  GIEW+RRHL+
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVK-----------------YGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLS 272          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:ZFIN;Acc:ZDB-GENE-021015-1])

HSP 1 Score: 176.792 bits (447), Expect = 7.115e-51
Identity = 91/211 (43.13%), Postives = 123/211 (58.29%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQ 803
            PV A NEWDPLEE+++G  + AC P    E K                +Y       EH +  + E +    ILQ EGV V  PEP+D++    TP+F++ G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ LIK+Y+ RGA+WT APKP   + L+ ++Y  R  ED      +   + TE EP FDAADFIR G DIF   SQ
Sbjct:   64 PVCAHNEWDPLEEVIVGRAENACVPPFTVEVK----------------QYGGQTFPKEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMYAAMPRDILMVVGNEIIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGTDIFVQRSQ 258          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Match: gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:Xenbase;Acc:XB-GENE-974514])

HSP 1 Score: 370.163 bits (949), Expect = 2.399e-123
Identity = 190/395 (48.10%), Postives = 250/395 (63.29%), Query Frame = 3
Query:   81 IARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            + RS     +  V  K  A     +    +  PV ++NEWDPLEE+++G P+ A  P    E KA   E  + F  KH G+ +      EH K   +E +    +L+ EGV V  PE ID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+ LIKDY+ RGAKWT APKP   + L+ ++Y  R  ED          + TE EP FDAADF+R GRDIFA  SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FEK GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YF
Sbjct:   32 VQRSFQSTQAAAVSEKPCAADEKVSDTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Match: Gatm (glycine amidinotransferase (L-arginine:glycine amidinotransferase) [Source:MGI Symbol;Acc:MGI:1914342])

HSP 1 Score: 374.785 bits (961), Expect = 7.104e-125
Identity = 186/367 (50.68%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ +NY   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q9D964|GATM_MOUSE (Glycine amidinotransferase, mitochondrial OS=Mus musculus GN=Gatm PE=1 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 5.533e-124
Identity = 186/367 (50.68%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ +NY   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q9I9K9|GATM_CHICK (Glycine amidinotransferase, mitochondrial OS=Gallus gallus GN=GATM PE=2 SV=2)

HSP 1 Score: 373.629 bits (958), Expect = 1.561e-123
Identity = 190/397 (47.86%), Postives = 258/397 (64.99%), Query Frame = 3
Query:   81 IARSLHD-QISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            + RSL   Q +    N+ +A   + +P   K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K  G+ +      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+++IKDY++ GAKWT APKP   + L+ ++Y  R+ ED      +   + TE EP FDAADFIR GRDIF   SQV+N  GIEW+RRHLAP   RVH ++F DP PMHIDTT     PGL ++ P+RPC QI + KKAGW V+  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FE  GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YFD
Sbjct:   32 VQRSLQSTQAAAASQNRCAAEDKAQSPA-PKECPVCSYNEWDPLEEVIVGRAENACVPPFSVEVKANTYEKYWGFYQKFGGESFPK----DHVKKAIAEIEEMCNILKKEGVIVKRPDPIDWSVKYRTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRRIIKDYFNNGAKWTTAPKPTMADELYDQDYPIRSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFVQRSQVTNYMGIEWMRRHLAPD-YRVHVISFKDPNPMHIDTTFNIIGPGLVLSNPDRPCHQIELFKKAGWTVIHPPVPLIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFENLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYFD 422          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|P50442|GATM_RAT (Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus GN=Gatm PE=1 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 3.219e-123
Identity = 185/367 (50.41%), Postives = 245/367 (66.76%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL  EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WRSR+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+RRHLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +KV  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPK----DHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|P50441|GATM_PIG (Glycine amidinotransferase, mitochondrial OS=Sus scrofa GN=GATM PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 1.429e-122
Identity = 182/367 (49.59%), Postives = 246/367 (67.03%), Query Frame = 3
Query:  168 KHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFD 1262
            K  PV ++NEWDPLEE+++G  + AC P    E KA   E  + F  K+ G Y+      +H K  + E +    IL+ EGV V  P+PID++    TP+F + G+  AMPRD L++VGNE+IE+ M WR+R+FE+  Y+ +IKDY+ RGAKWT APKP   + L+ ++Y   + ED      +   + TE EP FDAADFIR GRDIFA  SQV+N  GIEW+R+HLAP   RVH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW +V  P P I  + P ++SS+WLS+NV+MLDE RV+V+ +E+ IQK+FEK GI+ +K+  ++  S+GGG HCWT DVRRRG LQ+YFD
Sbjct:   62 KDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKYGGHYFPK----DHLKKAVAEIEEMCNILKMEGVTVRRPDPIDWSVKYKTPDFESTGLYGAMPRDILIVVGNEIIEAPMAWRARFFEYRAYRSIIKDYFRRGAKWTTAPKPTMADELYDQDYPIYSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYMGIEWMRKHLAPD-YRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPIPVIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKISIRNANSLGGGFHCWTCDVRRRGTLQSYFD 423          
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Match: sp|Q6P832|GATM_XENTR (Glycine amidinotransferase, mitochondrial OS=Xenopus tropicalis GN=gatm PE=2 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 3.903e-122
Identity = 190/395 (48.10%), Postives = 250/395 (63.29%), Query Frame = 3
Query:   81 IARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENY--RADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYF 1259
            + RS     +  V  K  A     +    +  PV ++NEWDPLEE+++G P+ A  P    E KA   E  + F  KH G+ +      EH K   +E +    +L+ EGV V  PE ID++    TP+F + G+  AMPRD LL+VGNE+IE+ M WR+R+FE+  Y+ LIKDY+ RGAKWT APKP   + L+ ++Y  R  ED          + TE EP FDAADF+R GRDIFA  SQV+N  GIEW+RRHLAP   +VH ++F DP PMHID T     PGL ++ P+RPC QI + KKAGW VV  P P I  N P ++SS+WLS+NV+MLDE RV+V+ +E  IQK+FEK GI+ +KV  +H  S+GGG HCWT D+RRRG LQ+YF
Sbjct:   32 VQRSFQSTQAAAVSEKPCAADEKVSDTAVQECPVCSYNEWDPLEEVIVGRPENANVPPFSVEVKANTYEKYWPFYQKHGGQSFP----VEHVKKATEEIEEMCNVLRHEGVVVQRPEVIDWSVKYKTPDFESTGMYAAMPRDILLVVGNEIIEAPMAWRARFFEYRAYRPLIKDYFRRGAKWTTAPKPTMADELYDQDYPIRTVEDRHKLAAMGKFVTTEFEPCFDAADFMRAGRDIFAQRSQVTNYLGIEWMRRHLAPD-YKVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIELFKKAGWTVVTPPIPLIPDNHPLWMSSKWLSMNVLMLDEKRVMVDANETSIQKMFEKLGISTIKVNIRHANSLGGGFHCWTCDIRRRGTLQSYF 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: tr|A0A183AH38|A0A183AH38_9TREM (Uncharacterized protein OS=Echinostoma caproni PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 4.275e-142
Identity = 195/364 (53.57%), Postives = 259/364 (71.15%), Query Frame = 3
Query:  177 PVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLF-KENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            PV +WNEWDPLEEI++G+PD A  P ++PE K C++E+ + F  K+ GKYW D +  +H+ ++  +   F++ L+ EGVKV+ PEP+D  K+     F + G   AMPRDFLL+VG+E+IE+TMTWR+RYFE++ Y+ +I DYW RGAKWT APKP   + L  +E  +  E+  +       I TE EP FDAADFIR GRDIF   SQV+N AGIEWVRRHL P+GIRVH + F DP+PMHID T    +PG+A+  P+R C +I + K AGWDVV  P P I+K+ P ++ S WLS+NV+MLD  RV+VE++E+GIQ+++ K G+TPV V  +H  SIGGG HCWT DVRRRG LQ+YFDW
Sbjct:   14 PVNSWNEWDPLEEIIVGIPDYATVPHLVPEVKICVAESNWAFFEKNAGKYWADAMPRDHWDLLCRQINEFVRKLELEGVKVIRPEPVDHRKSYSLLGFQSQGFYSAMPRDFLLVVGDELIEATMTWRARYFEYVSYRPIIMDYWKRGAKWTVAPKPTDYQKLINQETAKHLENHVSDKSNIGHITTESEPCFDAADFIRAGRDIFVQRSQVTNLAGIEWVRRHLEPRGIRVHRLTFEDPRPMHIDATFSLVKPGVALQNPDRQCHEIDLFKAAGWDVVDVPRPLISKSHPLWLGSNWLSMNVLMLDPTRVMVEEEEVGIQEMYRKIGVTPVPVKIRHANSIGGGFHCWTCDVRRRGGLQSYFDW 377          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: tr|A0A095AQE5|A0A095AQE5_SCHHA (Glycine amidinotransferase, mitochondrial OS=Schistosoma haematobium GN=MS3_04855 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.136e-141
Identity = 195/372 (52.42%), Postives = 265/372 (71.24%), Query Frame = 3
Query:  162 NKKHSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKT----SILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            NK  SPV +WNEWDPLEEI++G P+ A  P +LPE K C +  K +F +++ GKYW DVI  EH++++  + ++F+K+L+ EG+KVV P+P+D  K+    +F   G   AMPRDFLLIVG+E+IE+TMTWRSRYFE++ Y+ L  +YW +GAKWT  PKP    T F +  R +  +    DE       + TE EP FDAADFIR GRDIFA  SQV+N +GIEWVRRHL P+GI+VH ++FVDP+PMHID T    +PG+AI  P+RPC Q+  ++KAGW V+ AP P + K+   ++ S WLS+NV+MLD+NRV+VE +E GIQ++++  GI P+ V FK+  SIGGG HCWT D+RR+  L++YFDW
Sbjct:   41 NKLTSPVNSWNEWDPLEEIIVGTPEYATVPHLLPEVKTCAASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKMLELEGIKVVRPDPVDHRKSYKLLDFETQGFYAAMPRDFLLIVGDEIIEATMTWRSRYFEYLAYRPLALNYWKQGAKWTIGPKP----TNFSKLIRDEPINVGLSDEHNPDYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLSFVDPRPMHIDATFTLVKPGIAIQNPDRPCHQVDFIRKAGWQVINAPQPLMKKDHEMWLGSNWLSMNVLMLDQNRVIVESEETGIQEMYKSIGIKPINVKFKYANSIGGGFHCWTCDIRRQSKLESYFDW 408          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: tr|H2KUH6|H2KUH6_CLOSI (Glycine amidinotransferase mitochondrial OS=Clonorchis sinensis GN=CLF_109091 PE=4 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 1.787e-141
Identity = 201/405 (49.63%), Postives = 270/405 (66.67%), Query Frame = 3
Query:   69 MLTKIARSLHDQISINVVNKLSARLCSYTPGNKK-----HSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTS-ILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            +L K+  S +  +S    +++  R  S T GN K      SPVW+WNEWDPLEEI++G P+ A  P  LPE K C   + ++F  K+ G+YW D I  EH++ ++ E + ++++LQ EGVKV+ P  +D + T     F + G   AMPRDFLL++GNE+IE+TMTWRSRYFE++ Y+ LI +YW +GAKWT APKP   + +  +      DS          I TE EP FDAADF R GRDIF   SQV+N AGIEWVRRH+ P GIRVH + F DP+PMHID T    +PG+AI  P+RPC Q  ++K AGWDV+ AP P++ K+ PY++ S WLS+NV+MLD  RVLVEK E  I +++ + GITP+ V  +H  SIGG  HCWTSD++RRG+L++YFDW
Sbjct:    6 LLAKLGSSRNHLLS---SSQIFHRKFSDTGGNSKTPVNSSSPVWSWNEWDPLEEIIVGTPEGAVVPRPLPEVKMCTPMDTWEFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVDHSSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLILEYWKQGAKWTVAPKPTDFDAIINKEVTKKLDSGVSDKSNIGFITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVIDAPTPNVPKSHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIKRRGNLESYFDW 407          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: tr|A0A074ZTV3|A0A074ZTV3_9TREM (Uncharacterized protein OS=Opisthorchis viverrini GN=T265_04080 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.907e-141
Identity = 200/392 (51.02%), Postives = 264/392 (67.35%), Query Frame = 3
Query:  123 NKLSARLCSYTPGNKK-----HSPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKP------MCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            +++  R  S   GN K      SPVW+WNEWDPLEEI++G P+ A  P +LPE K C   +K+DF  K+ G+YW D I  EH++ ++ E + ++++LQ EGVKV+ P  ++   T     F + G   AMPRDFLL++GNE+IE+TMTWRSRYFE++ Y+ L+ +YW +GAKWT APKP      + KE + K +    + S   F     I TE EP FDAADF R GRDIF   SQV+N AGIEWVRRH+ P GIRVH + F DP+PMHID T    +PG+AI  P+RPC Q  ++K AGWDV+ AP P++ K  PY++ S WLS+NV+MLD  RVLVEK E  I +++ + GITP+ V  +H  SIGG  HCWTSD+RRRG L++YFDW
Sbjct:   35 SQIFHRKSSDVAGNSKAPVDSSSPVWSWNEWDPLEEIIVGTPEGAVVPRLLPEVKMCTPMDKWDFYEKNAGRYWADCIPKEHWEKVVKEVEEYVRVLQMEGVKVLRPSKVNHLSTFKLLGFESQGFYAAMPRDFLLVIGNELIEATMTWRSRYFEYLAYRPLLLEYWKQGAKWTVAPKPTDFDAIINKEVVKKLDSGVSDKSNIGF-----ITTESEPCFDAADFTRAGRDIFCQRSQVTNLAGIEWVRRHVEPLGIRVHQLTFTDPRPMHIDATFVFAKPGIAIQNPDRPCDQTELIKAAGWDVINAPTPNVPKTHPYWLGSPWLSMNVLMLDPERVLVEKGETAIHEMYRRIGITPIPVALRHANSIGGSFHCWTSDIRRRGKLESYFDW 421          
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Match: tr|Q5DBC6|Q5DBC6_SCHJA (SJCHGC09313 protein OS=Schistosoma japonicum PE=2 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 4.431e-141
Identity = 194/364 (53.30%), Postives = 255/364 (70.05%), Query Frame = 3
Query:  174 SPVWAWNEWDPLEEIVLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIMLDEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLIVGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFKENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNAGIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCLQIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKDEIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDW 1265
            SPV +WNEWD LEEI++G P+ +  P +LPE K C++  K +F +++ GKYW DVI  EH++++  + ++F+KIL+ EG+KVV P PID   +    +F   G   AMPRDFLLIVG+EMIE+TMTWRSRYFEF+ Y+ L  +YW  GAKWT APKP     L K+N    + +         + TE EP FDAADFIR GRDIFA  SQV+N +GIEWVRRHL P+GI+VH + F DP+PMHID T    +PG+AI  PERPC Q  +L+KAGW ++ AP P I K+   ++ S WLS+NV+MLD NRV+VE +E G+Q+L++  GI P+ V  +H  SIGGG HCWT D+RRR  L++YFDW
Sbjct:   28 SPVNSWNEWDSLEEIIVGTPEYSVVPHLLPEVKPCVASAKHNFYIQNGGKYWADVIPKEHWQLLCKQVEDFVKILELEGIKVVRPVPIDHKNSYKILDFETQGFYAAMPRDFLLIVGDEMIEATMTWRSRYFEFLAYRPLTLNYWRHGAKWTIAPKPTNFSKLIKDNPINGDIANKSSSYYGKVTTESEPCFDAADFIRAGRDIFAQRSQVTNLSGIEWVRRHLEPRGIKVHRLTFTDPRPMHIDATFTLVKPGIAIQNPERPCHQADILRKAGWKIIDAPEPLIKKDHEMWLGSNWLSMNVLMLDPNRVIVESEETGMQELYKSLGIQPIPVKLRHANSIGGGFHCWTCDIRRRSKLESYFDW 391          
The following BLAST results are available for this feature:
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 3
Match NameE-valueIdentityDescription
GATM1.109e-11949.86glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM2.363e-10148.49glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
GATM1.400e-3143.07glycine amidinotransferase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 4
Match NameE-valueIdentityDescription
gatm1.665e-12249.86glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm1.817e-12249.86glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm1.027e-5844.69glycine amidinotransferase (L-arginine:glycine ami... [more]
gatm7.115e-5143.13glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 1
Match NameE-valueIdentityDescription
gatm2.399e-12348.10glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 1
Match NameE-valueIdentityDescription
Gatm7.104e-12550.68glycine amidinotransferase (L-arginine:glycine ami... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D964|GATM_MOUSE5.533e-12450.68Glycine amidinotransferase, mitochondrial OS=Mus m... [more]
sp|Q9I9K9|GATM_CHICK1.561e-12347.86Glycine amidinotransferase, mitochondrial OS=Gallu... [more]
sp|P50442|GATM_RAT3.219e-12350.41Glycine amidinotransferase, mitochondrial OS=Rattu... [more]
sp|P50441|GATM_PIG1.429e-12249.59Glycine amidinotransferase, mitochondrial OS=Sus s... [more]
sp|Q6P832|GATM_XENTR3.903e-12248.10Glycine amidinotransferase, mitochondrial OS=Xenop... [more]
back to top
BLAST of Glycine amidinotransferase, mitochondrial vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A183AH38|A0A183AH38_9TREM4.275e-14253.57Uncharacterized protein OS=Echinostoma caproni PE=... [more]
tr|A0A095AQE5|A0A095AQE5_SCHHA1.136e-14152.42Glycine amidinotransferase, mitochondrial OS=Schis... [more]
tr|H2KUH6|H2KUH6_CLOSI1.787e-14149.63Glycine amidinotransferase mitochondrial OS=Clonor... [more]
tr|A0A074ZTV3|A0A074ZTV3_9TREM1.907e-14151.02Uncharacterized protein OS=Opisthorchis viverrini ... [more]
tr|Q5DBC6|Q5DBC6_SCHJA4.431e-14153.30SJCHGC09313 protein OS=Schistosoma japonicum PE=2 ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.532
NoneNo IPR availablePFAMPF02274Amidinotransfcoord: 110..407
e-value: 4.5E-5
score: 22.7
NoneNo IPR availableGENE3DG3DSA:3.75.10.10coord: 55..415
e-value: 2.8E-123
score: 411.2
NoneNo IPR availableSUPERFAMILYSSF55909Penteincoord: 54..416

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015067amidinotransferase activity
GO:0016740transferase activity
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000007Stage 7
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0004529integumental system
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018353 ID=SMED30018353|Name=Glycine amidinotransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1408bp
CAAGGGTAGTTTGATTATTTAGAAAAAAAGGATTTCCACCGGTTTTCTGT
GATAAAAATTGTACAAAAATGCTTACCAAAATTGCTAGATCTCTGCACGA
TCAGATTTCCATAAACGTTGTCAACAAATTGTCAGCTAGGTTATGCTCGT
ATACACCTGGTAACAAAAAACACAGCCCGGTTTGGGCCTGGAATGAATGG
GACCCATTAGAAGAAATCGTTTTGGGACTTCCAGATATGGCATGTTGTCC
AGAGATTTTACCAGAAGCCAAAGCTTGCATTTCGGAAAACAAATTTGATT
TCCTTTTAAAACACAAAGGAAAATATTGGAAGGATGTAATTGAACCAGAA
CACTACAAAATAATGCTAGATGAGCACAAGAACTTCATAAAGATTCTACA
AGGAGAAGGAGTTAAAGTCGTCCATCCAGAACCGATTGATTTCGCTAAAA
CGCTCTGTACTCCAAACTTTACTGCCCATGGAGTCGACTGTGCGATGCCG
AGAGATTTTCTATTAATTGTCGGAAATGAAATGATTGAGTCCACCATGAC
TTGGAGATCGAGATATTTTGAATTTATGTGCTATAAAAAATTAATTAAAG
ATTACTGGAGCCGGGGCGCTAAATGGACAGCGGCACCAAAGCCGATGTGT
AAAGAAACACTTTTTAAAGAAAATTATCGTGCTGACGAAGATTCAACAGC
ATTTTTCGATGAAAAGACTTCGATTCTAACGGAAGAGGAACCAGTTTTCG
ACGCCGCAGATTTCATTCGATGTGGTAGGGATATATTTGCGCATGTCAGT
CAGGTTAGCAACAATGCAGGAATTGAATGGGTACGTAGACATTTGGCACC
GAAAGGAATTAGAGTTCATTCAATGAATTTCGTTGACCCTAAACCAATGC
ATATTGACACGACACTTTTCACACCTCGGCCAGGCCTCGCGATAACATGC
CCAGAAAGACCATGCTTACAAATTGGTATGCTTAAAAAAGCCGGCTGGGA
TGTTGTCGTTGCTCCTTATCCAGATATTGCAAAGAATTTCCCATACTATA
TCAGCTCTCAATGGTTGTCTCTTAATGTTGTCATGTTGGATGAAAACCGA
GTTCTCGTAGAGAAAGATGAAATTGGAATTCAAAAACTGTTTGAAAAGTG
TGGCATTACTCCTGTAAAAGTTCCATTCAAACACTGCTTTTCCATAGGAG
GTGGTATTCATTGCTGGACATCGGATGTTAGAAGGCGAGGAGACCTTCAA
AACTATTTTGACTGGCCTCAAGAAATCTTGGAGAAATTTGAAACTCACTG
AATATCACAATTGAAAATATAAAGAACATAACTTTTCCAACGTATATTAA
TTATTTGTAATAAAATACACTGCTTACATCGTGTCAATTTTATTTACTGA
TTAATTAC
back to top

protein sequence of SMED30018353-orf-1

>SMED30018353-orf-1 ID=SMED30018353-orf-1|Name=SMED30018353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MLTKIARSLHDQISINVVNKLSARLCSYTPGNKKHSPVWAWNEWDPLEEI
VLGLPDMACCPEILPEAKACISENKFDFLLKHKGKYWKDVIEPEHYKIML
DEHKNFIKILQGEGVKVVHPEPIDFAKTLCTPNFTAHGVDCAMPRDFLLI
VGNEMIESTMTWRSRYFEFMCYKKLIKDYWSRGAKWTAAPKPMCKETLFK
ENYRADEDSTAFFDEKTSILTEEEPVFDAADFIRCGRDIFAHVSQVSNNA
GIEWVRRHLAPKGIRVHSMNFVDPKPMHIDTTLFTPRPGLAITCPERPCL
QIGMLKKAGWDVVVAPYPDIAKNFPYYISSQWLSLNVVMLDENRVLVEKD
EIGIQKLFEKCGITPVKVPFKHCFSIGGGIHCWTSDVRRRGDLQNYFDWP
QEILEKFETH*
back to top
Aliases
The feature 'Glycine amidinotransferase, mitochondrial' has the following synonyms
Synonym
AGAT-1