Peptidase inhibitor 16

Overview
NamePeptidase inhibitor 16
Smed IDSMED30018331
Length (bp)764
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase inhibitor 16 (SMED30018331) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase inhibitor 16 (SMED30018331) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase inhibitor 16 (SMED30018331) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase inhibitor 16 (SMED30018331) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018331

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30018331h1SMcG0009056 SmedASXL_017332SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30018331h1SMcG0009056 SmedASXL_017331SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30018331h1SMcG0009056 SmedASXL_017330SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30018331h1SMcG0009055 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30018331h1SMcG0009076 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30018331h1SMcG0009011 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30018331h1SMcG0009056 dd_940dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
secretory systemSMED30018331h1SMcG0009055 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30018331h1SMcG0009011 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30018331h1SMcG0009056 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30018331h1SMcG0009076 dd_Smed_v6_940_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 113.62 bits (283), Expect = 2.413e-28
Identity = 69/188 (36.70%), Postives = 104/188 (55.32%), Query Frame = 2
Query:   53 GDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESP--TCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            G LTD +K+ +++ HN  RA V+       P+A++ML ++W +E A+ A+  A QC +      +   G     G N   I    +  P L ++E   E + Y++S  TC SP   C HYTQ+VWA ++ +GCG   C+  Q ++++    ++C Y P G+VK K PY  G PCSQCP G  C +SLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWG----HNKERGRR---GENLFAITDEGMDVP-LAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 113.62 bits (283), Expect = 2.413e-28
Identity = 69/188 (36.70%), Postives = 104/188 (55.32%), Query Frame = 2
Query:   53 GDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESP--TCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            G LTD +K+ +++ HN  RA V+       P+A++ML ++W +E A+ A+  A QC +      +   G     G N   I    +  P L ++E   E + Y++S  TC SP   C HYTQ+VWA ++ +GCG   C+  Q ++++    ++C Y P G+VK K PY  G PCSQCP G  C +SLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWG----HNKERGRR---GENLFAITDEGMDVP-LAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 113.62 bits (283), Expect = 2.413e-28
Identity = 69/188 (36.70%), Postives = 104/188 (55.32%), Query Frame = 2
Query:   53 GDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESP--TCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            G LTD +K+ +++ HN  RA V+       P+A++ML ++W +E A+ A+  A QC +      +   G     G N   I    +  P L ++E   E + Y++S  TC SP   C HYTQ+VWA ++ +GCG   C+  Q ++++    ++C Y P G+VK K PY  G PCSQCP G  C +SLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWG----HNKERGRR---GENLFAITDEGMDVP-LAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 100.138 bits (248), Expect = 7.852e-25
Identity = 63/179 (35.20%), Postives = 87/179 (48.60%), Query Frame = 2
Query:   80 DLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKS---VGNNSLL--IESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            + ++AHN+ R  V        P AA+M  + W    A  A+  A+QCKF+     D SY  Y +   VG N  L  I+SF    P   +     E  FYD  + +C S  C HYTQ+VWA+S  +GC ++ C        +  +C YGP G+    PPY+ G  CS C     CV +LC
Sbjct:   36 NCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSF---TPRHAITAWYNETQFYDFDSLSC-SRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Match: GLIPR1L1 (GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392])

HSP 1 Score: 99.7525 bits (247), Expect = 1.328e-24
Identity = 63/179 (35.20%), Postives = 87/179 (48.60%), Query Frame = 2
Query:   80 DLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKS---VGNNSLL--IESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            + ++AHN+ R  V        P AA+M  + W    A  A+  A+QCKF+     D SY  Y +   VG N  L  I+SF    P   +     E  FYD  + +C S  C HYTQ+VWA+S  +GC ++ C        +  +C YGP G+    PPY+ G  CS C     CV +LC
Sbjct:   36 NCIEAHNEWRGKV-------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSF---TPRHAITAWYNETQFYDFDSLSC-SRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLC 203          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-8 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18540])

HSP 1 Score: 92.4337 bits (228), Expect = 1.321e-22
Identity = 67/206 (32.52%), Postives = 98/206 (47.57%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVA----RQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKR--------EIDFYDISTNTCE----SPTCEHYTQIVWADSQELGCGMSNCDT-------FQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDS--LCS 601
             ++G K+ +L+AHND+R+ +A GN      R+ SA NMLK+KW       AQN A+ C     T +       K++G N L  E  +  +P   L +  +        E + +  ++N       +    H TQI WA + ++GCG+ NC         FQ+    I+C Y   G+   K  Y SG  CS CP GTSC  S  LC+
Sbjct:   18 FSEGGKQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHSTND-------KTIGEN-LYWE--WSGDPFSDLDKFGKIATVAWDHEFEQFGWNSNKFSLALFNTGVAHATQIAWAPTGKIGCGVKNCGRDARRGGLFQVA---IVCQYRVRGNFFFKNIYNSGATCSACPAGTSCEQSTGLCA 210          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-14 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93444])

HSP 1 Score: 89.7373 bits (221), Expect = 1.095e-21
Identity = 60/190 (31.58%), Postives = 94/190 (49.47%), Query Frame = 2
Query:   47 AQGDLTDGQKKDLLDAHNDLRAAVASGN-VAR---QPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLL-IESFFISNPALILKELKREIDFYDISTNTCE----SPTCEHYTQIVWADSQELGCGMSNC--DTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSC 583
            A    T   +  +L+ HN LR+ +A G  VAR   + +A++MLK+KW    A+ +Q  A++C      M  +    Y    + ++  I+ F     A+     ++E   Y  S+NT      +    H TQ+ WA +  +GCG+ NC  DT  + K  ++C Y P G+   +  Y SG  CS+CP GTSC
Sbjct:   15 AYTQFTANGQAAILNVHNTLRSRIAKGTYVARGTVKHAASDMLKMKWLRSLATSSQIYANRCPTGHSNMIGVGENLYWYWTSGTITNIDQF----GAMASAAWEKEFQDYGWSSNTLTMSLFNSGVGHATQMAWAKTNLIGCGVKNCGMDTNGMNKVAVVCHYQPQGNYLNQNIYTSGTTCSKCPAGTSC 200          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-7 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18539])

HSP 1 Score: 89.7373 bits (221), Expect = 1.336e-21
Identity = 64/218 (29.36%), Postives = 101/218 (46.33%), Query Frame = 2
Query:   23 LYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNV----ARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREI---------DFYDISTNTCESPTC------EHYTQIVWADSQELGCGMSNCDTFQIQ----KSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDS--LCS 601
            L  +C   A    ++G K+ +++AHN +R+++A G       ++ SA NMLK+KW +  A  AQN A+ C        D SYG            E+ F +  +  + +L + +         +F     N+ +  T        H TQ+ W+ + ++GCG  NC    ++    K+ I+C Y   G+   K  Y SG  CS CP GTSC  S  LC+
Sbjct:    7 LALVCV-GAHAQFSEGGKQSMVNAHNAVRSSIAKGEYVAKGTKKDSATNMLKMKWDNSLAQSAQNYANGCPMQH--SPDKSYG------------ENLFWAYSSSPITDLDKYVQSAVDTWVSEFQMFGWNSNKFTTALWNTGIGHATQVAWSATGQVGCGAKNCGADSVRVGSYKATIVCQYKVPGNYLFKNIYNSGAKCSACPAGTSCEQSSGLCA 209          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 89.3521 bits (220), Expect = 1.661e-21
Identity = 65/196 (33.16%), Postives = 97/196 (49.49%), Query Frame = 2
Query:   65 DGQKKDLLDAHNDLRAAVASGN-VAR---QPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDIS-----YGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE----SPTCEHYTQIVWADSQELGCGMSNC--DTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSC--VDSLCS 601
            +GQ   +L+ HN LR+ +A G  VA+   +P+A++MLK+KW    A+ AQ  A++C         +      Y T  ++ N    I+ F  +  A   KE +     Y  S+NT      +    H TQ+ WA +  +GCG+ NC  DT    K  ++C Y P G+   +  Y SG  CS+CP GTSC     LC+
Sbjct:   22 NGQAA-ILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGHSGAAGLGENLYWYWTSATITN----IDQFGATGSAAWEKEFQD----YGWSSNTLSMSLFNTGIGHATQMAWAKTNLIGCGVKNCGKDTNGFNKVTVVCQYKPQGNYLNQNIYTSGTTCSKCPSGTSCEAATGLCA 208          
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Match: scl-11 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q93746])

HSP 1 Score: 84.3445 bits (207), Expect = 1.324e-19
Identity = 64/210 (30.48%), Postives = 100/210 (47.62%), Query Frame = 2
Query:   23 LYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGN-VAR---QPSAANMLKLKWSDESASKAQNLADQC-----KFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCE----HYTQIVWADSQELGCGMSNCD---TFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDS-LCS 601
            L   C        T   ++ ++DAHN LR+++A G  VA+   Q S +NM K+KW    A+ AQN A+ C     +   +      Y T  ++GN    +++F    PA      + E   Y  ++NT +  T      H TQ+ WA++  +GCG+ NC    +    K  ++C Y   G+   +P Y  G  C+ CP GT+C  S LC+
Sbjct:    6 LLVCCIAGVFSQFTSTGQQAIVDAHNKLRSSIAKGTYVAKGTTQKSGSNMRKIKWDATVATSAQNYANTCPTGHSQGSGYGENLYWYWTSGTIGN----LDTF---GPA-ASSSWESEFQQYGWTSNTLDMNTFNTGIGHATQMAWANTFAIGCGVKNCGKDPSNGYNKVAVVCQYKTPGNYLNQPIYQQGTTCAACPSGTACDSSGLCA 207          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 85.5001 bits (210), Expect = 7.512e-19
Identity = 62/198 (31.31%), Postives = 90/198 (45.45%), Query Frame = 2
Query:    2 VLILISSLYFICFQS--AQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESF---------FISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPP-CS 559
            ++I+   + F C     A G +T  ++  +L  HN LR  VA+G    QP A NM ++ W DE A++AQ  AD C+F       I+  T   +G N  +I S          F S       E+++       S     SP   HY+Q+VW ++  +GCG +            +C YGPGG+V    PY  G P CS
Sbjct:   12 IMIISCEVAFACNGKIIASG-ITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPHRTINRFT---MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQK------YSFGDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCS 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG34002 (gene:FBgn0054002 transcript:FBtr0302155)

HSP 1 Score: 56.225 bits (134), Expect = 6.371e-9
Identity = 43/160 (26.88%), Postives = 67/160 (41.88%), Query Frame = 2
Query:   56 DLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDD----FTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYD-------ISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIY 502
            D+    KK +L+ HN  R  VA G + R P AA MLKLKW  E A  A  L  +C         + E+ S  +Y +V N     E  F     ++  +L    D Y        I   +       H+ +++   S  LGC +++ +       ++ C+Y
Sbjct:   63 DVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSYHAVYNKFKAKEDTF----RIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLY 218          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 52.373 bits (124), Expect = 7.699e-8
Identity = 46/188 (24.47%), Postives = 76/188 (40.43%), Query Frame = 2
Query:   65 DGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREID-FYDISTNTCE------SPTCEHYTQIVWADSQELGCGMSN-CDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIG-TSCVDSLCS 601
            D     +L  HN+ R  +A G V+  PSA  M  + W    A  A   A QC+       + +  TY+  G N  ++ +  +     + + +    D   D ++   E       P   H+T +V   +  +GC ++   D   +Q + + C Y     V   P Y +G   S+C  G  S   +LCS
Sbjct:   58 DAHIPLILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDECRNTN--TYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDATSGDMEDYQMRGGPAIGHFTTMVNERNNRVGCAIARFTDANNVQATLLACNYAVTNVVN-NPVYRAGTAASECTTGRNSNYPNLCS 242          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG9400 (gene:FBgn0030562 transcript:FBtr0073920)

HSP 1 Score: 50.8322 bits (120), Expect = 3.572e-7
Identity = 45/183 (24.59%), Postives = 82/183 (44.81%), Query Frame = 2
Query:   56 DLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDD----------FTMEDISY-GTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGC-GMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCP 568
            ++++ +++ LLD HN  R+ +ASGN+    SAA+M  L+W  E    A   A +C+F            F+ ++I Y    +   ++S  ++SF I+      +       F D      +     H+T +V      +GC G+   +    +  F++       ++  +P Y SGP  S+CP
Sbjct:   90 EMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN---WFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCP 269          
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Match: CG30486 (gene:FBgn0050486 transcript:FBtr0087817)

HSP 1 Score: 48.521 bits (114), Expect = 1.925e-6
Identity = 47/187 (25.13%), Postives = 78/187 (41.71%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKF-DDF--TMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCE-----HYTQIVWADSQELGCGM--SNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGT-SCVDSLCS 601
            +  LL   ND R  VA G       A+ M  L+W +E A  A+    +C + DD+    ++ SY +Y       L +E   IS    +L+    ++    ++    E P  +     ++TQ+V   +  +GC M      T  + +  ++C +  G          S  P S+C  GT S  + LCS
Sbjct:   61 RAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCS 247          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 92.8189 bits (229), Expect = 1.794e-22
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            +++++D HN  R AV       QPSA+NMLK+ WSD  A  A+   ++C              Y+ +G N  L ++  IS+   ++     E++ Y     +       HYTQ+VW  S E+GC ++ C +      F  C Y   G+ +  PPY  G PC+ CP   +C D+LC+
Sbjct:    9 QQEIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYE-MGEN--LFKATGISSWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQCGS----NYFYGCHYYRAGNFRTVPPYSLGSPCASCP--NNCEDNLCT 168          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 90.1225 bits (222), Expect = 3.138e-20
Identity = 56/192 (29.17%), Postives = 87/192 (45.31%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIS---------TNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            ++++L  HN LR  V        P+A+NM  + W DE    A + A+QC+++    + +      S+G N L +      +PA  ++    E+  Y               C  P C HYTQ+VWA +  +GC +  C    +         +++C Y P G+   + PY  G PCSQCP   G  C D+LC
Sbjct:   65 REEILKLHNKLRGEV-------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLL-----MSIGQN-LAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVCRDNLC 243          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 80.8777 bits (198), Expect = 1.063e-17
Identity = 52/189 (27.51%), Postives = 84/189 (44.44%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNT---------CESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            +LD HN +R  V        P A+NM  + W D  A  A+  A  C ++      + +     +G N L + +    +   ++K    E+  Y               C  P C HYTQ+VWA S ++GC ++ C    +      + ++++C Y P G+   + PY  G PCS CP   G SC +++C
Sbjct:   72 ILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRNLLRF-----LGQN-LSVRTGRYRSILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWGSVWKRATYLVCNYSPKGNWIGEAPYKVGVPCSMCPPSYGGSCSNNMC 247          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 79.7221 bits (195), Expect = 1.902e-17
Identity = 56/194 (28.87%), Postives = 86/194 (44.33%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISY---------GTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTN-----TCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            +LD HN +RA V        P AANM  + W D  A  A+  A  C ++      + Y         G Y+S+     L++ ++         E++  +  Y    N      C  P C HYTQ+VWA S  +GC +  C    +      + ++++C Y P G+   + PY  G PCS CP   G SC +++C
Sbjct:   54 ILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYLGQNLSVRTGNYRSILQ---LVKPWY--------DEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 229          
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 80.1073 bits (196), Expect = 2.063e-17
Identity = 56/194 (28.87%), Postives = 86/194 (44.33%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISY---------GTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTN-----TCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            +LD HN +RA V        P AANM  + W D  A  A+  A  C ++      + Y         G Y+S+     L++ ++         E++  +  Y    N      C  P C HYTQ+VWA S  +GC +  C    +      + ++++C Y P G+   + PY  G PCS CP   G SC +++C
Sbjct:   69 ILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHGPPYLLRYLGQNLSVRTGNYRSILQ---LVKPWY--------DEVRDYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAIQTCFNMVVWGAVWREATYLVCNYSPKGNWIGEAPYRVGVPCSACPPSYGGSCSNNMC 244          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: ENSXETT00000036788.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464547.1:593:5826:1 gene:ENSXETG00000015856.1 transcript:ENSXETT00000036788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 2.291e-20
Identity = 55/181 (30.39%), Postives = 94/181 (51.93%), Query Frame = 2
Query:   71 QKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQ----IQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            +K+ +LD HN  R+         +PSA++M+KL W     + A++ A++C ++    +D  +     +G N L + S    + AL L +  +E  +Y+ +T  C E   C HYTQ+VWA ++ +GCG + C   +         ++C Y P G+ + + PY  G  C++CP    C+ SLC
Sbjct:   34 EKRIILDKHNFYRSQT-------EPSASDMIKLTWDSALEAMAKSYAEKCIWEH--NKDRGF-----IGEN-LFVMSGSSLDVALGLDDWHKERGYYNFTTGMCQEGQMCGHYTQMVWAGTERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCTECPSDHVCIGSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 87.4261 bits (215), Expect = 4.246e-20
Identity = 58/189 (30.69%), Postives = 86/189 (45.50%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIST---------NTCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            LLD HN +R+ V        P AANM  + W +  A  A++ A+QCK+D    + + Y     +G N L + S    +   ++K    E   Y             N C    C HYTQ+VWA S  +GC ++ C    +      Q S+++C Y   G+   + PY  G PCS CP   G  C +++C
Sbjct:   61 LLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQN-LSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 236          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 87.0409 bits (214), Expect = 6.567e-20
Identity = 58/189 (30.69%), Postives = 86/189 (45.50%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIST---------NTCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            LLD HN +R+ V        P AANM  + W +  A  A++ A+QCK+D    + + Y     +G N L + S    +   ++K    E   Y             N C    C HYTQ+VWA S  +GC ++ C    +      Q S+++C Y   G+   + PY  G PCS CP   G  C +++C
Sbjct:   66 LLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGPNQLMRY-----IGQN-LSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLGRPCSACPPSYGGVCSNNMC 241          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 88.9669 bits (219), Expect = 1.142e-19
Identity = 56/192 (29.17%), Postives = 87/192 (45.31%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIS---------TNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            K++++  HN LR  V        PSA+NM  + W DE    A+  A++C +     E        S+G N L +       PA  ++    E+  Y               C  P C HYTQIVWA + ++GC ++ C    +         +++C Y P G+   + PY +G PCS+CP   G +C ++LC
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIW-----EHGPTALLMSIGQN-LAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 88.9669 bits (219), Expect = 1.188e-19
Identity = 56/192 (29.17%), Postives = 87/192 (45.31%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIS---------TNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            K++++  HN LR  V        PSA+NM  + W DE    A+  A++C +     E        S+G N L +       PA  ++    E+  Y               C  P C HYTQIVWA + ++GC ++ C    +         +++C Y P G+   + PY +G PCS+CP   G +C ++LC
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIW-----EHGPTALLMSIGQN-LAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHECNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYLVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGNCQNNLC 235          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 116.701 bits (291), Expect = 2.364e-31
Identity = 65/186 (34.95%), Postives = 103/186 (55.38%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE-SPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            LT+ +K+ ++D HN  RA V+       P A++ML+++W DE A+ A+  A +C +                G N   I    +  P L +     E ++Y+ ST TC+ +  C HYTQ+VW+ ++ +GCG   C+T Q ++++    ++C Y P G+VK + PY  G PCSQCP+G SC +SLC 
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERG-------RRGENLFAITDEGMDVP-LAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLCG 200          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 116.316 bits (290), Expect = 7.319e-31
Identity = 65/185 (35.14%), Postives = 103/185 (55.68%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE-SPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            LT+ +K+ ++D HN  RA V+       P A++ML+++W DE A+ A+  A +C +                G N   I    +  P L +     E ++Y+ ST TC+ +  C HYTQ+VW+ ++ +GCG   C+T Q ++++    ++C Y P G+VK + PY  G PCSQCP+G SC +SLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERG-------RRGENLFAITDEGMDVP-LAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 116.316 bits (290), Expect = 7.319e-31
Identity = 65/185 (35.14%), Postives = 103/185 (55.68%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE-SPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            LT+ +K+ ++D HN  RA V+       P A++ML+++W DE A+ A+  A +C +                G N   I    +  P L +     E ++Y+ ST TC+ +  C HYTQ+VW+ ++ +GCG   C+T Q ++++    ++C Y P G+VK + PY  G PCSQCP+G SC +SLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERG-------RRGENLFAITDEGMDVP-LAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 115.931 bits (289), Expect = 3.249e-29
Identity = 66/185 (35.68%), Postives = 105/185 (56.76%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE-SPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            LT+ +K+ ++D HN  RA V+       P A++ML+++W DE A+ A+  A +C +      +   G     G N   I    +  P L +     E ++Y+ ST TC+ +  C HYTQ+VW+ ++ +GCG   C+T Q ++++    ++C Y P G+VK + PY  G PCSQCP+G SC +SLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRR---GENLFAITDEGMDVP-LAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Match: Glipr1 (GLI pathogenesis-related 1 (glioma) [Source:MGI Symbol;Acc:MGI:1920940])

HSP 1 Score: 91.2781 bits (225), Expect = 1.579e-21
Identity = 58/175 (33.14%), Postives = 84/175 (48.00%), Query Frame = 2
Query:   77 KDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKF-DDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            K+ +  HN LR+ V+       P A NML + W  + A  A+     C+F  +  +    +  + ++G N + + S  I + +  +     EI  YD ST  C    C HYTQ+VWADS +LGC +  C       +  IC YGP G+     PY  G  CS CP    C++SLC
Sbjct:   35 KECVQVHNQLRSKVS-------PPARNMLYMSWDPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGEN-IWLGSLSIFSVSSAISAWYEEIKHYDFSTRKCRH-VCGHYTQVVWADSYKLGCAVQLCPN----GANFICDYGPAGNYPTW-PYKQGATCSDCPKDDKCLNSLC 195          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q9ET66|PI16_MOUSE (Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN=Pi16 PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.272e-28
Identity = 66/185 (35.68%), Postives = 105/185 (56.76%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCE-SPTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            LT+ +K+ ++D HN  RA V+       P A++ML+++W DE A+ A+  A +C +      +   G     G N   I    +  P L +     E ++Y+ ST TC+ +  C HYTQ+VW+ ++ +GCG   C+T Q ++++    ++C Y P G+VK + PY  G PCSQCP+G SC +SLC
Sbjct:   30 LTEDEKQTMVDLHNQYRAQVS-------PPASDMLQMRWDDELAAFAKAYAQKCVWGH----NKERGRR---GENLFAITDEGMDVP-LAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYSCENSLC 199          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q6UXB8|PI16_HUMAN (Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=PI16 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.159e-27
Identity = 69/188 (36.70%), Postives = 104/188 (55.32%), Query Frame = 2
Query:   53 GDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESP--TCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            G LTD +K+ +++ HN  RA V+       P+A++ML ++W +E A+ A+  A QC +      +   G     G N   I    +  P L ++E   E + Y++S  TC SP   C HYTQ+VWA ++ +GCG   C+  Q ++++    ++C Y P G+VK K PY  G PCSQCP G  C +SLC
Sbjct:   26 GALTDEEKRLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWG----HNKERGRR---GENLFAITDEGMDVP-LAMEEWHHEREHYNLSAATC-SPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.505e-27
Identity = 73/209 (34.93%), Postives = 102/209 (48.80%), Query Frame = 2
Query:    8 ILISSLYFI------------CFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREID-FYDISTNTCES-----PTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTS 580
            IL+SS  F+            C    +G L    KK +LD HN  R  VA+G  + QPSAANM +L W+DE A+ AQ  A+ C F+           Y  +G N      +  S P  I + +    D   D++    +S     P   HYTQ+VWA+++ LGCG+    T   + S++ C YGPGG+ + +P Y  GPP S C  G S
Sbjct:    3 ILLSSTLFVLLMFQIIGSGMGCDMKVRG-LDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGEN-----IYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALGCGLV---TASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKS 202          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.585e-25
Identity = 64/175 (36.57%), Postives = 90/175 (51.43%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREID-FYDISTNTCES-----PTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTS 580
            KK +LD HN  R  VA+G  + QPSAANM +L W+DE A+ AQ  A+ C F+           Y  +G N      +  S P  I + +    D   D++    +S     P   HYTQ+VWA+++ L CG+    T   + S++ C YGPGG+ + +P Y  GPP S C  G S
Sbjct:   36 KKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGEN-----IYKGSYPDPIPRSVNAWYDEVKDVTPAVVKSFSSGGPMIGHYTQMVWANTEALDCGLV---TASDRNSYLFCQYGPGGNYRSQPIYKQGPPASDCKNGKS 202          
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.109e-24
Identity = 61/184 (33.15%), Postives = 99/184 (53.80%), Query Frame = 2
Query:   62 TDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCES-PTCEHYTQIVWADSQELGCGMSNCDTFQ-IQKS---FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLC 598
            ++ +K  +++ HN  R  V+       P A NML+++W +E A+ A+  A QC +      +   G     G N   I    +  P L ++E   E + Y++S  +C +   C HYTQ+VWA ++ +GCG   C+  Q ++++    ++C Y P G+VK + PY  G PCSQCP+G  C +SLC
Sbjct:   29 SEEEKHVMVELHNLYRTQVS-------PPATNMLQMRWDEELAAFAKAYAQQCVWGH----NKERGRR---GENLFAITGEGLDVP-LAMEEWHHEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTPCSQCPLGYHCKNSLC 197          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: W4ZGC0 (SCP domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 9.212e-30
Identity = 76/193 (39.38%), Postives = 104/193 (53.89%), Query Frame = 2
Query:   41 QSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQ----IQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIG-TSCVD-SLCS 601
            Q     LT   K+  L+AHND R+ V S      P+AANM+++KW D  A  AQ  +DQC F      +IS   Y  VG N          +  +I ++   E+  Y+  +N+C S  C HYTQIVWA+S  +GC ++ C T Q       + ++C YG GG+   K PY+SGPPCSQCP    +CVD  LC+
Sbjct:  787 QVNSNGLTSELKELFLNAHNDFRSRVHS------PNAANMVQMKWDDTLAEMAQGWSDQCVFTHGNPPNIS--PYSWVGQNIWAGSGTGWDHYGMI-EDWYNEVSDYNYQSNSC-SGICGHYTQIVWAESTRVGCAITTCTTIQNLGWSPATILVCNYGEGGNYVGKKPYVSGPPCSQCPSNHPTCVDGKLCA 969          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: F7A2L3 (SCP domain-containing protein OS=Ciona intestinalis OX=7719 PE=3 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.499e-29
Identity = 79/208 (37.98%), Postives = 106/208 (50.96%), Query Frame = 2
Query:    2 VLILISSLYFICFQSA----QGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL--ILKELKREIDFYDISTNTCES-PTCEHYTQIVWADSQELGCGMSNC-DTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGT-SCVDSLC 598
            V I++ +L  I   +A    Q  L        +DAHN  RA V        P A+NMLK+ W+      AQN A+ C +   +    + G++  VG N  L   F   + AL   +   + E D Y+   N C S   C HYTQ+VWADS  LGCG++NC +T Q+    +IC YGPGG+V    PY SG  CS CP GT +C + LC
Sbjct:    3 VFIVLVTLSLIIGSNARAVNQPPLNIFDANHAVDAHNFNRANVI-------PRASNMLKMSWNSSLGKLAQNYANNCVYKH-SKNRTNIGSFWYVGENMYLQSYFDTRSKALDNAIGSWQSESDNYNYQINRCSSGELCGHYTQMVWADSHALGCGVANCRNTAQL----VICNYGPGGNVNRARPYQSGSSCSNCPYGTVTCSNRLC 198          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: C3YGV0 (SCP domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_220379 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 2.433e-29
Identity = 69/187 (36.90%), Postives = 94/187 (50.27%), Query Frame = 2
Query:   56 DLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCES-PTCEHYTQIVWADSQELGCGMSNCDTFQI----QKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGT-SCVDSLC 598
            DL+  Q   +L+AHN  R AV        P+A NM  ++W D  A+ AQ  AD C F   +     Y    SVG N       F++      +    E+  Y  S+N+C S   C HYTQ+VWA S++LGCG+  C T         + ++C Y P G+   + PYISG PC+QC  G   CVD+LC
Sbjct:    3 DLSHEQINTILEAHNYYRKAV-------NPTATNMEHMEWDDSLATIAQGWADGCDFAHNSHRGDGYA--GSVGENIYADTGRFVTVRVGETENWHNEVSDYTYSSNSCRSGAVCGHYTQVVWATSKKLGCGVKLCSTLGTVNWSNANLVVCNYAPSGNFVGQKPYISGTPCTQCANGNDDCVDNLC 180          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A1W2WKG4 (peptidase inhibitor 16-like OS=Ciona intestinalis OX=7719 GN=LOC101242100 PE=3 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.601e-29
Identity = 77/214 (35.98%), Postives = 104/214 (48.60%), Query Frame = 2
Query:    2 VLILISSLYFICFQSA----QGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL--ILKELKREIDFYDISTNTCES-PTCEHYTQIVWADSQELGCGMSNCDTFQI-------QKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGT-SCVDSLC 598
            V I++ +L  I   +A    Q  L        +DAHN  RA V        P A+NMLK+ W+      AQN A+ C +   +    + G++  VG N  L   F   + AL   +   + E D Y+   N C S   C HYTQ+VWADS  LGCG++NC   ++           +IC YGPGG+V    PY SG  CS CP GT +C + LC
Sbjct:    8 VFIVLVTLSLIIGSNARAVNQPPLNIFDANHAVDAHNFNRANVI-------PRASNMLKMSWNSSLGKLAQNYANNCVYKH-SKNRTNIGSFWYVGENMYLQSYFDTRSKALDNAIGSWQSESDNYNYQINRCSSGELCGHYTQMVWADSHALGCGVANCRNVRVGSKDIWKTAQLVICNYGPGGNVNRARPYQSGSSCSNCPYGTVTCSNRLC 213          
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Match: A0A093RUZ0 (Peptidase inhibitor 16 (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_03369 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.887e-29
Identity = 69/190 (36.32%), Postives = 102/190 (53.68%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILK----ELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKS----FIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            L++ +KK +LD HN  R+ V+       P A  M+KL W  E  S AQ+ A++C +D            K  G      E+ F   P L L+    +   E  FY+++T+TC     C HYTQ+VW+D++++GCG   C+  +  ++     ++C Y P G+VK K PY  GPPCS CP GT CV++LC 
Sbjct:   17 LSEEEKKIILDEHNRYRSQVS-------PPARAMMKLTWDKELESLAQSYAEKCIWDH----------NKERGRRG---ENLFAMAPMLELEFAVEDWNGEEKFYNLTTSTCVPGQMCGHYTQVVWSDTKQIGCGAKFCEKIEGIETENMHLLVCNYYPAGNVKGKKPYWEGPPCSTCPEGTVCVNNLCE 186          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 93.2041 bits (230), Expect = 2.317e-21
Identity = 56/192 (29.17%), Postives = 87/192 (45.31%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIS---------TNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKS------FIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            ++++L  HN LR  V        P+A+NM  + W DE    A + A+QC+++    + +      S+G N L +      +PA  ++    E+  Y               C  P C HYTQ+VWA +  +GC +  C    +         +++C Y P G+   + PY  G PCSQCP   G  C D+LC
Sbjct:   61 REEILALHNKLREGV-------YPTASNMEYMVWDDELERSATHWAEQCQWEHGPQDLL-----MSIGQN-LAVHWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQLVWATTSRVGCAVHTCSRMNVWGEIWENAIYLVCNYSPKGNWIGEAPYAHGRPCSQCPPSYGGGCRDNLC 239          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 89.7373 bits (221), Expect = 3.396e-21
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL----ILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQI----QKSFIICIYGPGGDVKLKPPYISGPPCSQCPIG-TSCVDSLC 598
            LI +  ++     +G      ++ +++ HN  R+ V       +P AA+M+ +KWS E A  A+  A +C ++             +  + +++ E+ FI+   L     L +   E   Y    NTC E+  C HYTQ+VWA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CVD  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWE------------HNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 89.7373 bits (221), Expect = 4.551e-21
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL----ILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQI----QKSFIICIYGPGGDVKLKPPYISGPPCSQCPIG-TSCVDSLC 598
            LI +  ++     +G      ++ +++ HN  R+ V       +P AA+M+ +KWS E A  A+  A +C ++             +  + +++ E+ FI+   L     L +   E   Y    NTC E+  C HYTQ+VWA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CVD  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWE------------HNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000032496.1 (pep primary_assembly:Astyanax_mexicanus-2.0:18:32321795:32342374:-1 gene:ENSAMXG00000031919.1 transcript:ENSAMXT00000032496.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.3521 bits (220), Expect = 5.695e-21
Identity = 59/182 (32.42%), Postives = 86/182 (47.25%), Query Frame = 2
Query:   56 DLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            D+T  Q  ++++ HN  R  V+       PSA NMLK+ WS E+A  AQN A+ C            GTY+ +G N  L +S  +     ++     E+  Y   T +  +    HYTQ+VW  S  +GCG + C +      F +C Y   G+ K   PY  G  C+ CP   +C D LC+
Sbjct:   38 DVTSVQD-EIVNLHNVFRRGVS-------PSATNMLKMNWSREAAVSAQNWANTCSMVHGDPSTRMLGTYQ-MGEN--LFKSTGMVKWTSVVTAWHNEVANYVYPTGSANTQPIGHYTQVVWYSSYSVGCGAAKCGS----NYFYVCHYYRAGNFKGVAPYTQGQSCAACP--GACDDKLCT 202          
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 89.3521 bits (220), Expect = 7.727e-21
Identity = 59/206 (28.64%), Postives = 99/206 (48.06%), Query Frame = 2
Query:   11 LISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL----ILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQI----QKSFIICIYGPGGDVKLKPPYISGPPCSQCPIG-TSCVDSLC 598
            LI +  ++     +G      ++ +++ HN  R+ V       +P AA+M+ +KWS E A  A+  A +C ++             +  + +++ E+ FI+   L     L +   E   Y    NTC E+  C HYTQ+VWA ++E+GCG   C+T +       + ++C Y P G+   + PY  G  CS+CP    +CVD  C
Sbjct:    9 LICAGLWMLLAPGRGQFPKEDQQRIVNLHNHHRSTV-------EPPAADMIHMKWSGELALIAKEYATKCIWE------------HNPDSQNIMGENLFITTGPLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLCETVEALGFKNATLLVCNYLPLGNYMGQKPYQVGEQCSKCPDDLKNCVDQAC 195          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.099e-22
Identity = 60/194 (30.93%), Postives = 90/194 (46.39%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDF---TMEDISYGTYKSVGNNSLL---IESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNC------DTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            + D +++ L + HN LRA+V        P AA+M  + W  E A  A+  A QCK+       ++ I       VG+   L   ++++F         E   E +      +TC  P C HYTQ+VWA+S+ +GC +  C      D       +++C Y P G+   + PY  G PCS+CP   G SC   LC
Sbjct:    1 IADDERRALTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPSDQLDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQYPE---EKECSPECPHTCRGPICTHYTQLVWAESRRVGCAVHTCLDISVWDAVWPYALYLVCNYSPKGNWIGEAPYRQGTPCSRCPPRYGGSCRGGLC 184          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 77.0258 bits (188), Expect = 3.391e-17
Identity = 55/177 (31.07%), Postives = 87/177 (49.15%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL--ILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNC-DTFQIQKSFIICIYGPGGDV--KLKPPYISGPPCSQCPIGTSCVDSLC 598
            ++D HNDLR  V        PSA NML++ W  E+   A + A+ C F   + +     T  + G N  +  + F  N A+     E+      YD+ + T  +    HYTQ+VW +S +LGC ++ C     + K   +C Y P G++  ++  PY  G  C+ CP   +CV++LC
Sbjct:   47 IVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGH-SPDARRKTTQWTCGENIFMSSAPFTWNYAIRDWYNEVISPGFQYDVGSTT--TGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTSCASCP--KNCVNNLC 211          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002250.1 (pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 gene:ENSPMAG00000002049.1 transcript:ENSPMAT00000002250.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 2.158e-12
Identity = 47/189 (24.87%), Postives = 76/189 (40.21%), Query Frame = 2
Query:   89 DAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISN--PALILKELKREIDFYDISTN---------TCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            + HN LR  V        P ++NM  + W  +   +A     +C      M  I +           L +  ++S+  P+  ++    E   Y               C    C HYTQ+VWA +  +GC ++ C    +      +  +++C Y P G+     PY SG  CS+CP   G SC ++LC
Sbjct:    1 ELHNKLRGEV-------HPPSSNMEYMAWVKKLIKEAARYPGRCLRLMQPMAMIHF-----------LGQPHWLSHRPPSFHVQAWYDEAKDYQYPYEQECNPWCPFRCNGAVCTHYTQLVWATTNRVGCAINTCYNMNVWGQIWEKAVYLVCNYSPKGNWIGLSPYKSGRACSECPPSYGGSCRNNLC 171          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 61.2326 bits (147), Expect = 3.513e-11
Identity = 49/165 (29.70%), Postives = 65/165 (39.39%), Query Frame = 2
Query:   83 LLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNN----------------SLLIESFFISNPALILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKL 526
            L   HN LRA V       QPSAANM K++W D  A  A   A     +    E  S    +  G                  +L       ++ A +L     E   YD +   C  + TC HYTQ+VWA +  +GC    C     +     C+Y PG DV+L
Sbjct:   53 LESLHNKLRATV-------QPSAANMEKMEWDDSLAQVAHEWAAVACENPRAAEGTSAEIPEKPGIQGTGAGGRGGGQRRLGVNLHRAPHGATSFASVLASWFSEGQNYDYARPGCAHNRTCRHYTQMVWASASRVGCAKRWCRDPGSRVEAFACVYLPGNDVRL 210          
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 52.373 bits (124), Expect = 5.446e-9
Identity = 29/69 (42.03%), Postives = 38/69 (55.07%), Query Frame = 2
Query:  401 HYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDV--KLKPPYISGPPCSQCPIGTSCVDSLCS 601
            HYTQ+VW  S +LGC ++ C    I K   +C Y P G++  +L  PY  G PC  CP    C + LCS
Sbjct:   44 HYTQVVWYSSFQLGCAVNYCPE-AIYKYVYVCHYCPAGNLNTRLSRPYNEGSPCRSCP--NDCENDLCS 109          
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 57.3806 bits (137), Expect = 5.912e-10
Identity = 47/151 (31.13%), Postives = 71/151 (47.02%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQ--CKFDDFTMEDISYGTYKSVG-NNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGD 517
            + D+L+ HN  RA     +V   P       L WSD  A+ AQN ADQ  C     T  D  YG   ++G  ++  +++++             EI  Y+ S N   S +  H+TQ+VW  + E+GCG   C T     ++I+C Y P G+
Sbjct:   26 ESDVLNEHNKFRAL----HVDTAP-------LTWSDTLATYAQNYADQYDCS-GVLTHSDGPYGENLALGYTDTGAVDAWY------------GEISKYNYS-NPGFSESTGHFTQVVWKSTAEIGCGYKYCGT--TWNNYIVCSYNPPGN 149          
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 48.9062 bits (115), Expect = 2.404e-7
Identity = 38/119 (31.93%), Postives = 51/119 (42.86%), Query Frame = 2
Query:  167 LKWSDESASKAQNLADQ--CKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGD 517
            L WSD  AS AQ+ AD   C     T     YG   ++G             PA +      EI  YD S N   S    H+TQ+VW  + ++GCG+  C        ++IC Y P G+
Sbjct:  183 LSWSDTLASYAQDYADNYDCS-GTLTHSGGPYGENLALG----------YDGPAAV-DAWYNEISNYDFS-NPGFSSNTGHFTQVVWKSTTQVGCGIKTCG--GAWGDYVICSYDPAGN 286          
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 46.9802 bits (110), Expect = 9.418e-7
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 2
Query:  167 LKWSDESASKAQNLADQ--CKFDDFTMEDISYGTYKSVG-NNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDV 520
            L WSD  A+ AQN AD   C   +       YG   ++G   +  +++++             EI  YD S N   S +  H+TQ+VW  + E+GCG+ +C        +IIC Y   G+V
Sbjct:  213 LTWSDTLATYAQNYADSYDCS-GNLVHSGGPYGENLALGYGTTGSVDAWY------------NEITSYDYS-NPGFSESAGHFTQVVWKGTSEVGCGLKSCG--GEWGDYIICSYKAAGNV 317          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO31682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX85])

HSP 1 Score: 53.5286 bits (127), Expect = 3.497e-9
Identity = 40/155 (25.81%), Postives = 68/155 (43.87%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQ-CKFDDFTMEDISYGTYKSVGNNSLLIESFFISNP----ALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVK 523
            +K  LDAHN+ R    +G            KL WS E AS+AQ  A+     D    + ++ G     G N   +   +  NP       ++   +E+  YD   N    P+  H++Q+VW  +++LG G +   +      F++  Y P G+++
Sbjct:    4 QKQCLDAHNEFRTRHGAG------------KLAWSGELASEAQKWANHLASIDQMERDPLTNG-----GENIFYM---YGGNPREACERAVRNWYQEVKNYDFK-NPHSDPSTSHFSQLVWKGTKKLGVGEAQSKSGNF---FLVARYHPKGNME 134          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 48.9062 bits (115), Expect = 1.367e-7
Identity = 39/158 (24.68%), Postives = 67/158 (42.41%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESP----TCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPP 535
            K D+L  HND RA   +              LKW+   AS+AQ+ A+           I + + +  G      ES    + A++      ++ + ++     E+P    +  H+TQ+VWA S E+G G +   +      F++  Y P G+V  + P
Sbjct:    3 KNDILKTHNDYRAQHGT------------KALKWNARLASEAQSWAENLA----QRNAIQHSSSREYG------ESIAYMSGAVLTGRKATDMWYGEVDKYRFENPGFSTSSGHFTQVVWAGSTEMGAGKATSSS---GAHFVVARYTPPGNVMGQFP 135          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO35287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ5])

HSP 1 Score: 48.1358 bits (113), Expect = 1.591e-6
Identity = 29/119 (24.37%), Postives = 58/119 (48.74%), Query Frame = 2
Query:  167 LKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVK 523
            LKWSD+ A KAQ LA     D    +D +Y   +  G N  + +  +        ++   E++ Y   +      T +H++Q+VW  ++ +G G++        +++++ +Y P G+V+
Sbjct:  721 LKWSDKLAKKAQKLAQSMAADSNHTDDEAYSQNELPGENIAVFKHDYDIAAERATRKWYEEVEGYRFGSPVLGEAT-KHFSQLVWKGTKSVGIGVARGAR---DRTYVVALYDPPGNVE 835          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 45.8246 bits (107), Expect = 2.088e-6
Identity = 40/151 (26.49%), Postives = 65/151 (43.05%), Query Frame = 2
Query:   77 KDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALI--LKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVK 523
            K+ L+AHN+ R         ++  A  M    WS   A+ AQ  AD+    D    D +    KS G N         +N A++        E   YD + N   S    H+TQ+VW  +Q++G G +     +  K +++  + P G++K
Sbjct:    3 KNCLEAHNEYR---------KRHGAKEMT---WSASLAADAQKWADKLSQTDAFKHDYASINSKSQGENLAYFTPQKPNNTAIMDAFDAWYDESSKYDYA-NAKFSKETGHFTQLVWKATQKMGIGTAK--NAKGDKEYVVARFSPAGNIK 138          
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Match: EDO48663 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI98])

HSP 1 Score: 45.0542 bits (105), Expect = 4.329e-6
Identity = 37/149 (24.83%), Postives = 62/149 (41.61%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDV 520
            K   +D HN  RA  ++              LKWSDE A +AQ  A++      +M+  S  +    G N  +    + +   +  +    E   Y       +  T  H+TQ+VW  S+EL  GM    T   + ++++  Y P G++
Sbjct:    4 KNQCVDNHNKYRAMHSA------------PPLKWSDELAREAQYYAEKLA-QQRSMQHSSKCSRNDAGENLAMFSGRYDTAGDMACEMWYEESKKYSFVRGGSQMGT-GHFTQMVWKGSKEL--GMGRAKTSDGRCTYVVARYQPAGNI 136          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 92.0485 bits (227), Expect = 6.740e-21
Identity = 56/192 (29.17%), Postives = 88/192 (45.83%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDIS---------TNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKS------FIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            ++++L  HN LR++V        PSAANM  + W DE    A   A++C+++    + +      S+G N L +      +PA  ++    E+  Y               C  P C HYTQ+VWA +  +GC +  C    +         +++C Y P G+   + PY  G PCSQCP   G  C ++LC
Sbjct:   76 REEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQDLL-----MSIGQN-LAVHWGRYRSPAFHVQAWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQLVWATTNRVGCAVHVCPKMNVWGEIWETAVYLVCNYSPKGNWIGEAPYRHGRPCSQCPPSFGGGCRNNLC 254          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 89.3521 bits (220), Expect = 2.484e-20
Identity = 61/189 (32.28%), Postives = 91/189 (48.15%), Query Frame = 2
Query:   59 LTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFT-MEDISYGTYKSVGNNSL--LIESFFISNPALILKELKREIDFYDISTNTC-ESPTCEHYTQIVWADSQELGCGMSNCDTFQ----IQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTS-CVDSLC 598
            LTD Q++ L++ HN  R  V+       PSAA ML LKW       A+  A +C ++  T +ED     +   G   L   +E +F+             +D Y    N+C E   C HYTQ+VWAD+  +GC +  C+T +       S+++C Y P G+   + PY+ G  CS+CP     C + LC
Sbjct:   57 LTDQQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTELEDTGENLFAGTGKLDLSEAVEKWFL-----------ERLD-YSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGDWCSRCPEDLDVCQNHLC 226          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 84.3445 bits (207), Expect = 3.455e-19
Identity = 55/179 (30.73%), Postives = 83/179 (46.37%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL---ILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            + +++D HN  R AV       +P AA+ML + +S+E A  AQ   D+C  D           Y+ +G N      F+ ++P L   I+    +E+  +     +       HYTQ+VW  S ++GCG++ C           C Y   G+ K  PPY  G PC+ CP    CVD LC+
Sbjct:   31 QAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENL-----FYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSN---NIYLYGCHYYRAGNFKRWPPYKVGTPCASCP--NDCVDKLCT 191          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 83.5741 bits (205), Expect = 3.947e-19
Identity = 55/179 (30.73%), Postives = 83/179 (46.37%), Query Frame = 2
Query:   74 KKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPAL---ILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            + +++D HN  R AV       +P AA+ML + +S+E A  AQ   D+C  D           Y+ +G N      F+ ++P L   I+    +E+  +     +       HYTQ+VW  S ++GCG++ C           C Y   G+ K  PPY  G PC+ CP    CVD LC+
Sbjct:   16 QAEIVDVHNAFRRAV-------EPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPPSSRMLNGYE-LGENL-----FYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCSN---NIYLYGCHYYRAGNFKRWPPYKVGTPCASCP--NDCVDKLCT 176          
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 82.8037 bits (203), Expect = 9.682e-18
Identity = 56/203 (27.59%), Postives = 82/203 (40.39%), Query Frame = 2
Query:   41 QSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTN---------TCESPTCEHYTQIVWADSQELGCGMSNCDTFQI------QKSFIICIYGPGGDVKLKPPYISGPPCSQCP--IGTSCVDSLC 598
            Q  +  +TD   + +LD HN LR  V        P A+NM  + W  E    A+  A+ C ++      +       +G N L         P   ++    E+  Y               C  P C HYTQ+VWA S  +GC ++ C    +      +  +++C Y P G+     PY  G PCS CP   G  C D+LC
Sbjct:   78 QRGKRAITDSDAQLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHGPASLLP-----QIGQN-LGAHWGRYQPPTFHVQAWYDEVKDYSFPYPQECNPYCPFRCSGPVCTHYTQLVWATSSRIGCAINLCHNMDVWGQIWAKAVYLVCNYSPKGNWWGHAPYKHGTPCSACPPSYGGGCRDNLC 267          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072676.1 (SMESG000072676.1)

HSP 1 Score: 353.599 bits (906), Expect = 6.514e-125
Identity = 177/200 (88.50%), Postives = 186/200 (93.00%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            VLILISSLYFICFQSAQGDLTDGQKK LLDAHN  RAAVA G  A+QPSAANMLKLKWSDESA KAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIES F  NPALIL++L+RE  FYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDT Q+++S++ICIYGPGGDVKLKPPYISGPPCSQCP GTSCVDSLCS
Sbjct:    3 VLILISSLYFICFQSAQGDLTDGQKKGLLDAHNRFRAAVAGGQAAQQPSAANMLKLKWSDESALKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIESLFNRNPALILRQLERESPFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTSQVKQSYLICIYGPGGDVKLKPPYISGPPCSQCPTGTSCVDSLCS 202          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 329.717 bits (844), Expect = 1.663e-115
Identity = 160/201 (79.60%), Postives = 177/201 (88.06%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNS-LLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            VLILISSL FICFQSAQGDLTDGQK ++LD HN LR+ VASG  A QPSAANMLK+KWS ESASKAQNLADQCKFD+ TMEDISYGTYKSVGNNS LL E  +ISNPA    EL  +  +YD+STNTC+SPTCEH+ Q++WADSQELGCGMSNCDT QI++S++ICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS
Sbjct:    3 VLILISSLLFICFQSAQGDLTDGQKMEILDVHNWLRSHVASGEGAPQPSAANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCKSPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 203          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072936.1 (SMESG000072936.1)

HSP 1 Score: 329.717 bits (844), Expect = 1.912e-115
Identity = 160/201 (79.60%), Postives = 177/201 (88.06%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNS-LLIESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            VLILISSL FICFQSAQGDLTDGQK ++LD HN LR+ VASG  A QPSAANMLK+KWS ESASKAQNLADQCKFD+ TMEDISYGTYKSVGNNS LL E  +ISNPA    EL  +  +YD+STNTC+SPTCEH+ Q++WADSQELGCGMSNCDT QI++S++ICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS
Sbjct:    7 VLILISSLLFICFQSAQGDLTDGQKMEILDVHNWLRSHVASGEGAPQPSAANMLKMKWSAESASKAQNLADQCKFDNVTMEDISYGTYKSVGNNSELLTEDIYISNPAYKFYELLDDFFYYDMSTNTCKSPTCEHHAQMMWADSQELGCGMSNCDTSQIKQSYLICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 207          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072813.1 (SMESG000072813.1)

HSP 1 Score: 328.561 bits (841), Expect = 5.654e-115
Identity = 159/201 (79.10%), Postives = 176/201 (87.56%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLI-ESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            VLILISSLYFICFQSAQGDLTD QKK++LD HN  RAAVASG  A+Q +AA+MLK+KWS+ESASKAQNLADQCKFD+ TMEDISYGTYK+VGNNS LI +SF   NP+ I ++   E  +YDI TNTC SPTCEHYTQIVWADSQELGCGMSNCDT  I++S+ ICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS
Sbjct:    7 VLILISSLYFICFQSAQGDLTDRQKKEMLDIHNRFRAAVASGRGAQQSTAASMLKMKWSNESASKAQNLADQCKFDNVTMEDISYGTYKTVGNNSALITDSFPFINPSRIYQQWFPEAYYYDIKTNTCSSPTCEHYTQIVWADSQELGCGMSNCDTSHIKQSYFICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 207          
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Match: SMESG000072813.1 (SMESG000072813.1)

HSP 1 Score: 328.176 bits (840), Expect = 5.923e-115
Identity = 159/201 (79.10%), Postives = 176/201 (87.56%), Query Frame = 2
Query:    2 VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSAANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLI-ESFFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGMSNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 601
            VLILISSLYFICFQSAQGDLTD QKK++LD HN  RAAVASG  A+Q +AA+MLK+KWS+ESASKAQNLADQCKFD+ TMEDISYGTYK+VGNNS LI +SF   NP+ I ++   E  +YDI TNTC SPTCEHYTQIVWADSQELGCGMSNCDT  I++S+ ICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS
Sbjct:    3 VLILISSLYFICFQSAQGDLTDRQKKEMLDIHNRFRAAVASGRGAQQSTAASMLKMKWSNESASKAQNLADQCKFDNVTMEDISYGTYKTVGNNSALITDSFPFINPSRIYQQWFPEAYYYDIKTNTCSSPTCEHYTQIVWADSQELGCGMSNCDTSHIKQSYFICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS 203          
The following BLAST results are available for this feature:
BLAST of Peptidase inhibitor 16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PI162.413e-2836.70peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.413e-2836.70peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
PI162.413e-2836.70peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
GLIPR1L17.852e-2535.20GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
GLIPR1L11.328e-2435.20GLIPR1 like 1 [Source:HGNC Symbol;Acc:HGNC:28392][more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-81.321e-2232.52SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-141.095e-2131.58SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-71.336e-2129.36SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-51.661e-2133.16SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-111.324e-1930.48SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84837.512e-1931.31gene:FBgn0038126 transcript:FBtr0082782[more]
CG340026.371e-926.88gene:FBgn0054002 transcript:FBtr0302155[more]
CG326797.699e-824.47gene:FBgn0052679 transcript:FBtr0071469[more]
CG94003.572e-724.59gene:FBgn0030562 transcript:FBtr0073920[more]
CG304861.925e-625.13gene:FBgn0050486 transcript:FBtr0087817[more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01068499.11.794e-2231.25cysteine-rich venom protein natrin-1-like [Source:... [more]
crispld23.138e-2029.17cysteine-rich secretory protein LCCL domain contai... [more]
pi15a1.063e-1727.51peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
pi15b1.902e-1728.87peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pi15b2.063e-1728.87peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000036788.12.291e-2030.39pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
R3HDML4.246e-2030.69R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML6.567e-2030.69R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
crispld21.142e-1929.17cysteine-rich secretory protein LCCL domain contai... [more]
crispld21.188e-1929.17cysteine-rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pi162.364e-3134.95peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi167.319e-3135.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi167.319e-3135.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi163.249e-2935.68peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Glipr11.579e-2133.14GLI pathogenesis-related 1 (glioma) [Source:MGI Sy... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ET66|PI16_MOUSE2.272e-2835.68Peptidase inhibitor 16 OS=Mus musculus OX=10090 GN... [more]
sp|Q6UXB8|PI16_HUMAN1.159e-2736.70Peptidase inhibitor 16 OS=Homo sapiens OX=9606 GN=... [more]
sp|P0DPU1|VA576_SCODE4.505e-2734.93Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE1.585e-2536.57Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|Q58D34|PI16_BOVIN1.109e-2433.15Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W4ZGC09.212e-3039.38SCP domain-containing protein OS=Strongylocentrotu... [more]
F7A2L31.499e-2937.98SCP domain-containing protein OS=Ciona intestinali... [more]
C3YGV02.433e-2936.90SCP domain-containing protein (Fragment) OS=Branch... [more]
A0A1W2WKG42.601e-2935.98peptidase inhibitor 16-like OS=Ciona intestinalis ... [more]
A0A093RUZ04.887e-2936.32Peptidase inhibitor 16 (Fragment) OS=Manacus vitel... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld22.317e-2129.17cysteine-rich secretory protein LCCL domain contai... [more]
ENSAMXT00000036030.13.396e-2128.64peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000031557.14.551e-2128.64peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000032496.15.695e-2132.42pep primary_assembly:Astyanax_mexicanus-2.0:18:323... [more]
ENSAMXT00000029824.17.727e-2128.64peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000374.12.099e-2230.93pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
CRISP33.391e-1731.07cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000002250.12.158e-1224.87pep scaffold:Pmarinus_7.0:GL477299:1626:22672:-1 g... [more]
CLEC18A3.513e-1129.70C-type lectin domain family 18 member A [Source:HG... [more]
CRISP25.446e-942.03cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY35.912e-1031.13Cell wall-associated protein involved in export of... [more]
PRY12.404e-731.93Sterol binding protein involved in the export of a... [more]
PRY29.418e-730.58Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316823.497e-925.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488811.367e-724.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352871.591e-624.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371142.088e-626.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486634.329e-624.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld26.740e-2129.17cysteine rich secretory protein LCCL domain contai... [more]
ENSORLT00000023160.22.484e-2032.28peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000020674.23.455e-1930.73cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020676.23.947e-1930.73cysteine-rich venom protein pseudecin-like [Source... [more]
crispld1a9.682e-1827.59cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of Peptidase inhibitor 16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072676.16.514e-12588.50SMESG000072676.1[more]
SMESG000072936.11.663e-11579.60SMESG000072936.1[more]
SMESG000072936.11.912e-11579.60SMESG000072936.1[more]
SMESG000072813.15.654e-11579.10SMESG000072813.1[more]
SMESG000072813.15.923e-11579.10SMESG000072813.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018331 ID=SMED30018331|Name=Peptidase inhibitor 16|organism=Schmidtea mediterranea sexual|type=transcript|length=764bp
TGTTCTCATTTTAATTTCATCTTTATATTTTATTTGTTTCCAAAGTGCTC
AAGGCGATCTTACAGATGGACAGAAAAAGGACCTCCTTGATGCTCACAAC
GATTTAAGAGCAGCTGTTGCTAGTGGAAACGTAGCTCGGCAGCCCAGTGC
TGCAAATATGCTGAAATTGAAATGGAGCGATGAATCGGCATCGAAGGCGC
AAAACCTAGCGGACCAATGTAAGTTTGATGACTTCACGATGGAGGATATA
AGCTACGGAACGTACAAAAGCGTTGGGAATAATAGTCTTCTTATAGAAAG
TTTTTTTATCAGCAATCCGGCATTAATATTAAAAGAGTTGAAGCGAGAAA
TTGATTTTTACGACATTTCAACAAATACATGCGAATCTCCTACATGTGAA
CATTATACTCAAATTGTATGGGCTGATTCTCAAGAACTTGGATGTGGTAT
GTCCAACTGTGACACTTTCCAGATTCAAAAAAGTTTTATTATCTGCATTT
ACGGACCTGGAGGAGATGTGAAACTCAAACCTCCATATATAAGCGGACCT
CCTTGCTCGCAATGTCCAATTGGAACATCTTGTGTCGATTCATTATGCAG
TTGACTTTTAAAATGAATTTTTCTCATTTATCAAATGAAAATATTTTAAA
ATAAATGTTTTCATTTTAAGGTGCAAATGTACAAAAAACTTATTAAAAAA
GTTAAAGATCGAATTTTAAGGCTCAATGTTCAGGTCATTCAAATTTTCAA
GGTCAATTTTCAAT
back to top

protein sequence of SMED30018331-orf-1

>SMED30018331-orf-1 ID=SMED30018331-orf-1|Name=SMED30018331-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
VLILISSLYFICFQSAQGDLTDGQKKDLLDAHNDLRAAVASGNVARQPSA
ANMLKLKWSDESASKAQNLADQCKFDDFTMEDISYGTYKSVGNNSLLIES
FFISNPALILKELKREIDFYDISTNTCESPTCEHYTQIVWADSQELGCGM
SNCDTFQIQKSFIICIYGPGGDVKLKPPYISGPPCSQCPIGTSCVDSLCS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR002413V5_allergen-like
IPR014044CAP_domain
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0061052negative regulation of cell growth involved in cardiac muscle cell development
Vocabulary: molecular function
TermDefinition
GO:0030414peptidase inhibitor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 56..74
score: 36.62
coord: 162..175
score: 35.79
coord: 132..148
score: 54.12
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 16..194
IPR002413Venom allergen 5-likePRINTSPR00838V5ALLERGENcoord: 19..35
score: 37.5
coord: 131..150
score: 53.75
IPR014044CAP domainSMARTSM00198SCP_3coord: 23..175
e-value: 4.4E-27
score: 106.0
IPR014044CAP domainPFAMPF00188CAPcoord: 29..167
e-value: 4.8E-20
score: 72.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 14..200
e-value: 3.8E-48
score: 165.6
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 17..182
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 16..194
NoneNo IPR availableCDDcd05380CAP_eukcoord: 25..168
e-value: 5.4867E-35
score: 118.711
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.686
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 133..143