slc42a-2

Overview
Nameslc42a-2 (AKN21682.1)
Smed IDSMED30018300
Length (bp)1561
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc42a-2 (SMED30018300) t-SNE clustered cells

Violin plots show distribution of expression levels for slc42a-2 (SMED30018300) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc42a-2 (SMED30018300) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc42a-2 (SMED30018300) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018300

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30018300SMESG000005978.1 dd_Smed_v4_2323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018300SMESG000005978.1 dd_Smed_v4_2323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018300SMESG000005978.1 dd_Smed_v4_2323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018300SMESG000005978.1 dd_Smed_v4_2323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30018300SMESG000005978.1 dd_Smed_v4_2323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30018300SMESG000005978.1 Smed-slc42a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc42a-2 vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 301.982 bits (772), Expect = 2.691e-97
Identity = 184/433 (42.49%), Postives = 266/433 (61.43%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P                  + G    IV   M   + S     Q AALG +I   + GG   G++L+ +P+  +P   + ++D+ +W VP+
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP-----------------GVVGGLAGIVAVAMGASNTS--MAMQAAALGSSIGTAVVGGLMTGLILK-LPLWGQPSDQNCYDDSVYWKVPK 407          
BLAST of slc42a-2 vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 301.982 bits (772), Expect = 2.906e-97
Identity = 184/433 (42.49%), Postives = 266/433 (61.43%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P                  + G    IV   M   + S     Q AALG +I   + GG   G++L+ +P+  +P   + ++D+ +W VP+
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP-----------------GVVGGLAGIVAVAMGASNTS--MAMQAAALGSSIGTAVVGGLMTGLILK-LPLWGQPSDQNCYDDSVYWKVPK 407          
BLAST of slc42a-2 vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 297.745 bits (761), Expect = 2.137e-95
Identity = 183/431 (42.46%), Postives = 264/431 (61.25%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTV 1352
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P                  + G    IV   M   + S     Q AALG +I   + GG   G++L+ +P+  +P   + ++D+ +W V
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP-----------------GVVGGLAGIVAVAMGASNTS--MAMQAAALGSSIGTAVVGGLMTGLILK-LPLWGQPSDQNCYDDSVYWKV 405          
BLAST of slc42a-2 vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 293.893 bits (751), Expect = 1.277e-94
Identity = 163/343 (47.52%), Postives = 229/343 (66.76%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMP 1088
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP 337          
BLAST of slc42a-2 vs. Ensembl Human
Match: RHAG (Rh associated glycoprotein [Source:HGNC Symbol;Acc:HGNC:10006])

HSP 1 Score: 293.893 bits (751), Expect = 1.406e-94
Identity = 163/343 (47.52%), Postives = 229/343 (66.76%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMP 1088
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP 337          
BLAST of slc42a-2 vs. Ensembl Celegans
Match: rhr-1 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q22947])

HSP 1 Score: 276.559 bits (706), Expect = 2.860e-87
Identity = 158/335 (47.16%), Postives = 218/335 (65.07%), Query Frame = 3
Query:  108 ILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVE-----NRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLE-GNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMP 1088
            + Q+ FL+IF     Y    DA+  PS +    E     N Y  FQD   M+F+GFGFLM FLK+YGFS++  N  L VFTI+W II+ G+     G    I++E LL A+F  A ILIS GA+LGKLSP QY++MA  E P+    E++        D G +I VH FGAYFGL CA     K+ R H NE S+Y++D+F+M+G + LWI+WPSFNA   A+ D +QRAV NT +SLC     TF+++    VD+       +F+MV+I N+TLAGGVA+G  A+++++P+ A++IG +AG +S +GY+YITP L+ ++ +HDTCGVNNLHGMP
Sbjct:   16 LFQVVFLVIFALYGSY----DASALPSETKNVEEAARMTNLYPLFQDTHVMIFIGFGFLMTFLKRYGFSAVSINMLLAVFTIQWGIIVRGMASAHHGFKFTISLEQLLTADFAAAVILISMGAMLGKLSPSQYVIMAFFETPVALIVEHICVHNLQINDVGGSIIVHAFGAYFGLACAKGFGKKEQRGHTNEGSTYHTDIFAMIGAIFLWIYWPSFNAAVAATDDARQRAVANTFLSLCACTMTTFLVSQ--AVDKHK-----RFDMVHIANSTLAGGVAIGTTANVVLEPYHAMIIGVIAGAVSVIGYKYITPFLSEKLGIHDTCGVNNLHGMP 339          
BLAST of slc42a-2 vs. Ensembl Celegans
Match: rhr-1 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q22947])

HSP 1 Score: 276.559 bits (706), Expect = 2.860e-87
Identity = 158/335 (47.16%), Postives = 218/335 (65.07%), Query Frame = 3
Query:  108 ILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVE-----NRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLE-GNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMP 1088
            + Q+ FL+IF     Y    DA+  PS +    E     N Y  FQD   M+F+GFGFLM FLK+YGFS++  N  L VFTI+W II+ G+     G    I++E LL A+F  A ILIS GA+LGKLSP QY++MA  E P+    E++        D G +I VH FGAYFGL CA     K+ R H NE S+Y++D+F+M+G + LWI+WPSFNA   A+ D +QRAV NT +SLC     TF+++    VD+       +F+MV+I N+TLAGGVA+G  A+++++P+ A++IG +AG +S +GY+YITP L+ ++ +HDTCGVNNLHGMP
Sbjct:   16 LFQVVFLVIFALYGSY----DASALPSETKNVEEAARMTNLYPLFQDTHVMIFIGFGFLMTFLKRYGFSAVSINMLLAVFTIQWGIIVRGMASAHHGFKFTISLEQLLTADFAAAVILISMGAMLGKLSPSQYVIMAFFETPVALIVEHICVHNLQINDVGGSIIVHAFGAYFGLACAKGFGKKEQRGHTNEGSTYHTDIFAMIGAIFLWIYWPSFNAAVAATDDARQRAVANTFLSLCACTMTTFLVSQ--AVDKHK-----RFDMVHIANSTLAGGVAIGTTANVVLEPYHAMIIGVIAGAVSVIGYKYITPFLSEKLGIHDTCGVNNLHGMP 339          
BLAST of slc42a-2 vs. Ensembl Celegans
Match: rhr-2 (RH (Rhesus) antigen Related [Source:UniProtKB/TrEMBL;Acc:Q17463])

HSP 1 Score: 237.269 bits (604), Expect = 3.074e-72
Identity = 155/395 (39.24%), Postives = 241/395 (61.01%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDAT--MFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIG---VKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIY-LHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF------SQMPTRSASEQAGYQLAALG 1232
            +F I+A ++Q  F+++F   V+Y D +D +  ++  T  P        FQDV  M+F+GFGFLM FLK+YGFS++  N  L  F I++A+++ G   V   E     I + ++++AE + AA+LI+ G +LG+L+P+Q++L+A  E  I    E+      H  D+G ++ VHTFGAYFGL  A V   K+  E +     ++SDLFSM+GTL+LW+F+PSFNA      D + RA++NT +++      TF+I+S +          G+FNM++IQ++TLAGGVA+G+ A+ ++ P+ A+++G +A +LS +G+ +I+P L R + L DTCGV+NLHGMPGI+ G+ S   A   + + YG TL  ++           R    QA YQ  ALG
Sbjct:    9 QFAIIAGLMQTVFIVLFAKYVKYIDPLDDSRRVYSGTDYPL-------FQDVHLMIFVGFGFLMAFLKRYGFSAVSVNLLLSAFVIQFAMLLRGFMTVAFQETGLFSIGIPEMISAESSCAAVLITMGVLLGRLTPVQFLLLAFFETGINVLVEHYVFNYLHVNDSGRSLSVHTFGAYFGLAAACVGHKKNVMEMDEHGGIHHSDLFSMIGTLLLWVFFPSFNAAIQEPEDARHRAIMNTYLAMASGTVTTFMISSCV-------DTLGRFNMIHIQSSTLAGGVAIGSSANAVLHPYHAVIVGVIAALLSVIGHAWISPRLERTFHLFDTCGVHNLHGMPGILAGLLSIGFAYFYEPESYGKTLYHIYPYWIGGELHGDRENVSQAQYQ--ALG 387          
BLAST of slc42a-2 vs. Ensembl Celegans
Match: amt-3 (Putative ammonium transporter 3 [Source:UniProtKB/Swiss-Prot;Acc:Q21565])

HSP 1 Score: 58.5362 bits (140), Expect = 8.378e-9
Identity = 62/231 (26.84%), Postives = 104/231 (45.02%), Query Frame = 3
Query:  426 TLAAILISFGAVLGKLSPLQYMLMALMEVPICA------WNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG---GASADRQQ---RAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGA-CADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLH 1079
            T A+ ++S GAV  +     Y+L+  + + I A      W++     K   VD      VH  G   GL     +  +  R +E+     +S   ++LGT +LW  W   NAG   G +  R +   RA V T+++  G       I SF+           K  + ++ N  L+  V++ A CA  + +PW AL+IGS++ + S      + P L R+++ D  G+  +H
Sbjct:  144 TTASTIVS-GAVAERAKLKSYILLGCIVILIQALPAHWVWDKEGVFYKKGVVDFAGCSAVHLVGGIIGLIATVFLKPRRNRFNEDSVHQMSSPTNALLGTFLLWWGWFGINAGSVWGITGGRWRLGARAAVATIMASIGGGATAITI-SFVKTK--------KLQVNFLINGILSSIVSITAICA--VSRPWHALVIGSISSVFSIA----VLPLLDRLHIDDPVGIVPIH 358          
BLAST of slc42a-2 vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0331423)

HSP 1 Score: 275.018 bits (702), Expect = 1.473e-86
Identity = 184/456 (40.35%), Postives = 274/456 (60.09%), Query Frame = 3
Query:   96 ILAFILQIGFLLIFGFCVRYKDN-----IDATMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVIS-GKDAREHEN-EESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP-------------TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP-----EETSLVEVYE 1385
            ++  I+QI FL++F   VRY+       IDA    S +     ++Y  FQD+Q M+F+GFGFLM FL+KYG+S+ GF  F+    ++WA++M G  H+EG  I +++E++++A+   A  LIS GA+LG+ +P+Q + M++ EV + A NEYL    F   D G +I VH FGAYFGL  A ++    D  E    E +SY SD+F+M+GT  LW++WPSFN+  A     +RA++NT +SL  +   TFV+++ ++ +        K +MV++QN+TLAGGVAVG   +L++   GA+LIG +AG +S LGYRY+TP +T  + LHDTCGV+NLHGMP ++  I SA+ AS+A    Y + L  +F  M               R+A+ QAGYQL  +  T+ I + GG   G +L++    +  KK +   D  +W VP     EE  L +V E
Sbjct:   12 VVLMIVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEHV--SKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHEN-------KLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKYTNFRNL-KKDEHHQDEHYWEVPAAENKEEYELEKVDE 457          
BLAST of slc42a-2 vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0345597)

HSP 1 Score: 275.018 bits (702), Expect = 1.473e-86
Identity = 184/456 (40.35%), Postives = 274/456 (60.09%), Query Frame = 3
Query:   96 ILAFILQIGFLLIFGFCVRYKDN-----IDATMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVIS-GKDAREHEN-EESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP-------------TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP-----EETSLVEVYE 1385
            ++  I+QI FL++F   VRY+       IDA    S +     ++Y  FQD+Q M+F+GFGFLM FL+KYG+S+ GF  F+    ++WA++M G  H+EG  I +++E++++A+   A  LIS GA+LG+ +P+Q + M++ EV + A NEYL    F   D G +I VH FGAYFGL  A ++    D  E    E +SY SD+F+M+GT  LW++WPSFN+  A     +RA++NT +SL  +   TFV+++ ++ +        K +MV++QN+TLAGGVAVG   +L++   GA+LIG +AG +S LGYRY+TP +T  + LHDTCGV+NLHGMP ++  I SA+ AS+A    Y + L  +F  M               R+A+ QAGYQL  +  T+ I + GG   G +L++    +  KK +   D  +W VP     EE  L +V E
Sbjct:   12 VVLMIVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEHV--SKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHEN-------KLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKYTNFRNL-KKDEHHQDEHYWEVPAAENKEEYELEKVDE 457          
BLAST of slc42a-2 vs. Ensembl Fly
Match: Rh50 (gene:FBgn0028699 transcript:FBtr0073354)

HSP 1 Score: 274.633 bits (701), Expect = 1.689e-86
Identity = 179/441 (40.59%), Postives = 268/441 (60.77%), Query Frame = 3
Query:   96 ILAFILQIGFLLIFGFCVRYKDN-----IDATMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVIS-GKDAREHEN-EESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP-------------TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP 1355
            ++  I+QI FL++F   VRY+       IDA    S +     ++Y  FQD+Q M+F+GFGFLM FL+KYG+S+ GF  F+    ++WA++M G  H+EG  I +++E++++A+   A  LIS GA+LG+ +P+Q + M++ EV + A NEYL    F   D G +I VH FGAYFGL  A ++    D  E    E +SY SD+F+M+GT  LW++WPSFN+  A     +RA++NT +SL  +   TFV+++ ++ +        K +MV++QN+TLAGGVAVG   +L++   GA+LIG +AG +S LGYRY+TP +T  + LHDTCGV+NLHGMP ++  I SA+ AS+A    Y + L  +F  M               R+A+ QAGYQL  +  T+ I + GG   G +L++    +  KK +   D  +W VP
Sbjct:   12 VVLMIVQIIFLVLFWLFVRYEKTALPLAIDAEDAGSANEHV--SKYPQFQDIQVMIFIGFGFLMTFLRKYGYSATGFTLFMAALVVQWAVLMKGFLHMEGGKISLSLENIIDADIAAAVPLISMGALLGRTTPIQLLCMSVFEVALFAANEYLALHVFSICDCGGSITVHAFGAYFGLAVALMLRPASDQNETGKLEGASYTSDIFAMIGTTFLWVYWPSFNSVLADGAGGERAILNTFLSLAAATVTTFVVSALVSHEN-------KLDMVHVQNSTLAGGVAVGTVCNLLLGAHGAVLIGIIAGTVSVLGYRYLTPWMTANLRLHDTCGVHNLHGMPALISAIASAIYASMATVGEYQSELQDIFPAMVGTNGTETKIMGGLGRNATSQAGYQLFGIAVTLLIAIGGGILTGAVLKYTNFRNL-KKDEHHQDEHYWEVP 442          
BLAST of slc42a-2 vs. Ensembl Zebrafish
Match: rhcgl1 (Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc:ZDB-GENE-060209-2])

HSP 1 Score: 287.73 bits (735), Expect = 3.444e-91
Identity = 193/438 (44.06%), Postives = 280/438 (63.93%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDA----TMFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH---LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGK-DAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIV---FSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            + F+ QI  +++FG  +RY +  D+    T   +  S  +EN ++Y    FQDV  M+F+GFGFLM FLK+Y F S+GFNF +  F I+WA++M G  H    E   IKI VE+L+NA+F +A  LI++GA LGK+SP+Q M++ L  V + A  EY+  +  H  DAG ++ +HTFGAY+GL  +WV+     ++ +  + S Y+SD+F+M+GTL LW+FWPSFN+  A   D Q RA +NT +SL  S   TF ++S         K  GK +MV+IQNATLAGGVA+G  ++ MI P+G+L++G  +GI+ST+GY ++TP + + + + DTCGV+NLH MPG++GGI  AV A+ A   +YG+   I    F     R+AS Q GYQ A +   +A GL GGA VG +L+ +PI   P   + F+D+ +W VPEE
Sbjct:   14 VCFVWQIAMIILFGVFIRYNEESDSHWIETRKKNNISTDLENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGSVGFNFLIAAFGIQWALLMQGWFHSFDKEDLKIKIGVENLINADFCVAGCLIAYGACLGKVSPVQLMVLTLFGVTLYAVEEYIILDLLHVRDAGGSMVIHTFGAYYGLTISWVLYRPFLSQSNHLQRSVYHSDVFAMIGTLFLWMFWPSFNSAIADHGDGQHRAAINTYLSLAASVLTTFALSSL-------SKKYGKLDMVHIQNATLAGGVAMGTASEFMITPYGSLIVGFCSGIVSTVGYVFLTPLMEKTLKIQDTCGVHNLHAMPGVIGGIVGAVTAACASESVYGHEGLINMFGFEGKVNRTASVQGGYQAAGIFVAMAFGLVGGALVGGILK-LPIWGDPTDSNCFDDDIYWEVPEE 443          
BLAST of slc42a-2 vs. Ensembl Zebrafish
Match: rhcgl1 (Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc:ZDB-GENE-060209-2])

HSP 1 Score: 287.345 bits (734), Expect = 4.902e-91
Identity = 195/438 (44.52%), Postives = 279/438 (63.70%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDA----TMFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH---LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGK-DAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIV---FSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            + F+ QI  +++FG  +RY +  D+    T   +  S  +EN ++Y    FQDV  M+F+GFGFLM FLK+Y F S+GFNF +  F I+WA++M G  H    E   IKI VE+L+NA+F +A  LI++GA LGK+SP+Q M++ L  V + A  EY+     H  DAG ++ +HTFGAY+GL  +WV+     ++ +  + S Y+SD+F+M+GTL LW+FWPSFN+  A   D Q RA +NT +SL  S   TF ++S         K  GK +MV+IQNATLAGGVA+G  ++ MI P+G+L++G  +GI+STLGY ++TP + + + + DTCGV+NLH MPG++GGI  AV A+ A   +YG+   I    F     R+AS Q GYQ A +   IA GL GGA VG +L+ +PI   P   + F+D+ +W VPEE
Sbjct:   14 VCFVWQIAMIILFGVFIRYDEESDSHWIETRKKNNISTDLENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGSVGFNFLIAAFGIQWALLMQGWFHSFDKEDLKIKIGVENLINADFCVAGCLIAYGACLGKVSPVQLMVLTLFGVTLYAVEEYIILYVLHVRDAGGSMVIHTFGAYYGLTISWVLYRPFLSQSNHLQRSVYHSDVFAMIGTLFLWMFWPSFNSAIADHGDGQHRAAINTYLSLAASVLTTFALSSL-------SKKYGKLDMVHIQNATLAGGVAMGTASEFMITPYGSLIVGFCSGIVSTLGYVFLTPLMEKTLKIQDTCGVHNLHAMPGVIGGIVGAVTAACASESVYGHEGLINMFGFEGKVNRTASVQGGYQAAGIFVAIAFGLVGGALVGGILK-LPIWGDPTDSNCFDDDIYWEVPEE 443          
BLAST of slc42a-2 vs. Ensembl Zebrafish
Match: rhcga (Rh family, C glycoprotein a [Source:ZFIN;Acc:ZDB-GENE-070424-81])

HSP 1 Score: 284.648 bits (727), Expect = 8.026e-90
Identity = 201/474 (42.41%), Postives = 283/474 (59.70%), Query Frame = 3
Query:   27 NRVRCTKKYFITKMKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTS----SPFVEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH----LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVI--SGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNT-LTIVF---SQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE-ETSLVEVYE 1385
            N V C + ++             I+ FI QI  +++FG  VRY    DA           +  +EN    RY  FQDV  M+F+GFGFLM FLK+Y F ++GFNF +  F ++WA++M G  H    ++G  IKI VE L+NA+F +A  LI++GA+LGK+SP+Q M+M L  + + A  EY+     H  DAG ++ +HTFGAY+GL  +W++     D  +H N  S Y+SD+F+M+GTL LW+FWPSFN+  ++  D Q RA +NT +SL  S   TF I+S           KGK +MV+IQNATLAGGVA+G  A+ MI P+G+L++G   GI+ST GY  ITP + + + + DTCGV+NLH MPG++GGI  A+ A+ A   +YG   L  +F        RS + Q GYQ A +   +A G+ GG  VG +LR +PI   P   + F+D  +W VPE E S+  V E
Sbjct:    3 NFVECCRGFWCGPKNPNVRVSLPIVCFIWQIAMIILFGLFVRYDIESDAHWAEHKKHENITSDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGAVGFNFLVAAFGLQWALLMQGWFHSLDPVDGT-IKIGVESLINADFCVAGCLIAYGALLGKVSPVQLMVMTLFGITLYAVEEYIILNLLHVRDAGGSMVIHTFGAYYGLTISWILYRPKLDQAKHLN-GSVYHSDVFAMIGTLFLWMFWPSFNSAISNHGDGQHRAAINTYLSLAASVLTTFAISSM-------SAKKGKVDMVHIQNATLAGGVAMGTAAEFMISPYGSLIVGFCCGIISTFGYVVITPFMEKYLKIQDTCGVHNLHAMPGLIGGIVGAITAAAASPTVYGQEGLVNLFGFTGDYANRSPATQGGYQAAGIAVALAFGIVGGIIVGCILR-LPIWGDPSDENCFDDEVYWEVPEDEESIPPVLE 466          
BLAST of slc42a-2 vs. Ensembl Zebrafish
Match: rhbg (Rh family, B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:337596])

HSP 1 Score: 281.182 bits (718), Expect = 8.790e-89
Identity = 189/442 (42.76%), Postives = 270/442 (61.09%), Query Frame = 3
Query:  135 FGFCVRYKDNIDATMF-PSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGK--DAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTR---SASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP-EETSLVEVYESDINPSVVKID 1418
            FG  V Y D+ DA  +  + S+    N ++Y    FQDV  M+F+GFGFLM FL++YGFSS+GFNF +  F+++WA +M G  H +    I + V  ++NA+F   A+LISFGAVLGK SP+Q ++MA++EV + A NEY+      A DAG ++ +HTFGAYFGL    ++     D  +H+N  S Y+SDLF+M+GT+ LW+FWPSFN+      D Q R   NT  SL      TF  +S +  +       GK +MV+IQNA LAGGVAVG   ++M+ P+G++++G +AG +S LGY+Y+TP + +++ + DTCG++NLHGMPGI+G I  AV A++A   +YGN L  VF +       SA  + G+Q  +L  T+ I L GG   G LL+ +PI   P     F D  +W VP EE    E+ E      V K++
Sbjct:   26 FGVLVEYNDDTDAKKWNKNNSTDPATNEFYYRYPSFQDVHVMIFVGFGFLMTFLQRYGFSSMGFNFLIAAFSLQWATLMQGFFHGMHHGKIHVGVTSMINADFCTGAVLISFGAVLGKTSPVQLLVMAILEVTLFAVNEYILLSILGANDAGGSMTIHTFGAYFGLMVTRILHRPNLDKSKHKN-SSVYHSDLFAMIGTIFLWMFWPSFNSAITQYGDPQHRTAANTYYSLAACTLATFGFSSLVNPE-------GKLDMVHIQNAALAGGVAVGTAGEMMLTPFGSMIVGFLAGTISVLGYKYLTPFMESKLKIQDTCGIHNLHGMPGILGAIVGAVTAALASRDVYGNGLDKVFLEAADNSQWSAQTKGGFQAISLAVTLGIALIGGLITGFLLK-LPIYGTPPDTQCFEDAVYWEVPGEEEDHHELNEVSTQNEVEKLN 458          
BLAST of slc42a-2 vs. Ensembl Zebrafish
Match: rhag (Rh associated glycoprotein [Source:ZFIN;Acc:ZDB-GENE-030131-8229])

HSP 1 Score: 280.026 bits (715), Expect = 1.266e-88
Identity = 182/429 (42.42%), Postives = 259/429 (60.37%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDA------TMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFW 1346
            KF ILA IL+I  ++++   V Y    D            T SP     Y  FQDV  M+F+GFGFLM FLK+YGF+S+G N  L  F ++W +++  V H+ G  I+++++ ++NA+F+ A +LISFGAVLGK SP+Q ++M L+E+     NEYL  E     D G ++ +H FGAYFGL  A V+     R  H+N+ S Y+SDLF+M+GT+ LW+FWPSFN+  A+  D Q RAVVNT  SL   A   +  +S +      EK KGK +MV+IQNATLAGGVAVG CAD+ IQP+GA+LIG  AGI+ST+G++++TP L +++ + DTCGV+NLHGMP                  I G    I+ + +  R       YQ A L  ++   L GG   G++++ IP   +P   + F+D+ +W
Sbjct:   11 KFPILALILEIITIVLYALFVVYDTGDDKGHGDHHEKSNQTESPM--TLYPMFQDVHVMIFIGFGFLMTFLKRYGFTSVGVNLLLAAFGLQWGLLLQNVWHMHGGKIRVSIDRMINADFSTATVLISFGAVLGKTSPVQLLIMTLLEITTFCINEYLVVEILGVSDVGASMTIHAFGAYFGLSVARVLYRPGLRNGHDNDGSVYHSDLFAMIGTVYLWMFWPSFNSAIATPGDHQLRAVVNTYFSLAACALAAYATSSLV------EK-KGKLDMVHIQNATLAGGVAVGTCADMDIQPFGAMLIGITAGIISTVGFKFLTPILASKLGIQDTCGVHNLHGMP-----------------GILGGVAGILAAAL-KRKEGVSPTYQAAGLASSLGFALVGGLITGLIMK-IPFLGQPPDQNCFDDSIYW 411          
BLAST of slc42a-2 vs. Ensembl Xenopus
Match: rhcg (Rh family C glycoprotein [Source:NCBI gene;Acc:445260])

HSP 1 Score: 290.426 bits (742), Expect = 6.029e-92
Identity = 187/436 (42.89%), Postives = 267/436 (61.24%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDAT----MFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIY-GNTLTIVF---SQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFW 1346
            +  ++ F+ +I  +++FG  VRY D  D      M     +  ++N Y++    FQDV  M+F+GFGFLM FLK+YGF S+ FNF L  F I+WAI+M G  H  +   I I VE L+NA+F + ++ I+FGA+LGK+SP+Q M+M L +V + A NE++     H  DAG ++ +HTFGAYFGL  AW+++    ++  ++E S Y SDLFSM+GTL LW+FWPSFN+  +   D Q RA +NT  SL      T  I+S +         KGK  MV+IQNATLAGGVAVG  A++M+ P+G+L++G + GI+STLG+ Y +P L+ ++ LHDTCG++NLH MPG++GGI  AV A+ A   +Y  + L  +F       TR+ S Q GYQ A L C        G  V   +  +PI   P   + F+D  +W
Sbjct:   25 RLPVVCFLWEIAMIVLFGIFVRYNDEADPHWSEFMKAQNITSDIQNDYYFRYPSFQDVHVMIFVGFGFLMTFLKRYGFGSVAFNFLLAAFGIQWAILMQGWFHTFKNGKILIGVESLINADFCVGSVCIAFGAILGKVSPVQIMVMTLFQVTLFAVNEWILLNLLHVNDAGGSMTIHTFGAYFGLTVAWILNRPRLKQTNDKEGSVYVSDLFSMIGTLFLWMFWPSFNSAVSYHGDAQHRAAINTYCSLAACVLTTVAISSVVNK-------KGKLEMVHIQNATLAGGVAVGTAAEMMLTPYGSLIVGFICGIVSTLGFTYCSPFLSNKLRLHDTCGIHNLHAMPGLIGGIVGAVTAACATEAVYTADGLKKMFRFEGDYATRTPSMQGGYQAAGL-CVSLAFGLVGGTVVGCILKLPIWGDPSDENCFDDEVYW 452          
BLAST of slc42a-2 vs. Ensembl Xenopus
Match: rhcg (Rh family C glycoprotein [Source:NCBI gene;Acc:445260])

HSP 1 Score: 289.656 bits (740), Expect = 8.421e-92
Identity = 191/436 (43.81%), Postives = 268/436 (61.47%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDA--TMFPSTSS--PFVEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIY-GNTLTIVF---SQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFW 1346
            K  ++ FI +I  +++FG  VRY +  D     F  T++    +EN    RY  FQDV  M+F+GFGFLM FLK+YGF S+ FNF L  F I+WAI+M G  H  +   I I VE L+NA+F + ++ I+FGA+LGK+SP+Q M+M L +V + A NE++     H  DAG ++ +HTFGAYFGL  AW+++    ++  ++E S Y SDLFSM+GTL LW+FWPSFN+  +   D Q RA +NT  SL      T  I+S +         KGK  MV+IQNATLAGGVAVG  A++M+ P+G+L++G + GI+STLG+ Y +P L+ ++ LHDTCG++NLH MPG++GGI  AV A+ A   +Y  + L  +F       TR+ S Q GYQ A L C        G  V   +  +PI   P   + F+D  +W
Sbjct:   10 KLPLVCFIWEIAMIVLFGVFVRYDEEADPHWAEFKQTNNIGSDIENDFYFRYASFQDVHVMIFVGFGFLMTFLKRYGFGSVAFNFLLAAFGIQWAILMQGWFHTFKNGKILIGVESLINADFCVGSVCIAFGAILGKVSPVQIMVMTLFQVTLFAVNEWILLNLLHVNDAGGSMTIHTFGAYFGLTVAWILNRPRLKQTNDKEGSVYVSDLFSMIGTLFLWMFWPSFNSAVSYHGDAQHRAAINTYCSLAACVLTTVAISSVV-------NKKGKLEMVHIQNATLAGGVAVGTAAEMMLTPYGSLIVGFICGIVSTLGFTYCSPFLSNKLRLHDTCGIHNLHAMPGLIGGIVGAVTAACATEAVYTADGLKKMFRFEGDYATRTPSMQGGYQAAGL-CVSLAFGLVGGTVVGCILKLPIWGDPSDENCFDDEVYW 437          
BLAST of slc42a-2 vs. Ensembl Xenopus
Match: rhcg (Rh family C glycoprotein [Source:NCBI gene;Acc:445260])

HSP 1 Score: 276.559 bits (706), Expect = 1.289e-87
Identity = 176/384 (45.83%), Postives = 243/384 (63.28%), Query Frame = 3
Query:  225 FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIY-GNTLTIVF---SQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTV 1352
            FQDV  M+F+GFGFLM FLK+YGF S+ FNF L  F I+WAI+M G  H  +   I I VE L+NA+F + ++ I+FGA+LGK+SP+Q M+M L +V + A NE++     H  DAG ++ +HTFGAYFGL  AW+++    ++  ++E S Y SDLFSM+GTL LW+FWPSFN+  +   D Q RA +NT  SL      T  I+S +         KGK  MV+IQNATLAGGVAVG  A++M+ P+G+L++G + GI+STLG+ Y +P L+ ++ LHDTCG++NLH MPG++GGI  AV A+ A   +Y  + L  +F       TR+ S Q GYQ A L C        G  V   +  +PI   P   + F+D  +W V
Sbjct:   28 FQDVHVMIFVGFGFLMTFLKRYGFGSVAFNFLLAAFGIQWAILMQGWFHTFKNGKILIGVESLINADFCVGSVCIAFGAILGKVSPVQIMVMTLFQVTLFAVNEWILLNLLHVNDAGGSMTIHTFGAYFGLTVAWILNRPRLKQTNDKEGSVYVSDLFSMIGTLFLWMFWPSFNSAVSYHGDAQHRAAINTYCSLAACVLTTVAISSVV-------NKKGKLEMVHIQNATLAGGVAVGTAAEMMLTPYGSLIVGFICGIVSTLGFTYCSPFLSNKLRLHDTCGIHNLHAMPGLIGGIVGAVTAACATEAVYTADGLKKMFRFEGDYATRTPSMQGGYQAAGL-CVSLAFGLVGGTVVGCILKLPIWGDPSDENCFDDEVYWEV 403          
BLAST of slc42a-2 vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 273.863 bits (699), Expect = 1.047e-85
Identity = 182/436 (41.74%), Postives = 267/436 (61.24%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMF----PSTSSPFVEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKD-AREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP--TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTV 1352
            K  +   +L+   +++F   VRY    DA  +     + S    EN    RY  FQDV  M+F+GFGFLM FLK+YGFSS+ FNF +  F ++W+ ++ G  H      I + +E ++NA+F   A+LISFGAVLGK SP+Q ++M L+EV +   NEY+      A DAG ++ +HTFGAYFGL  + V+   D  +  + E S Y+SDLF+M+GT+ LW+FWPSFN+   A  D Q R V+NT  SL      TF  ++ +  +       GK +MV+IQNA LAGGVAVG   ++M+ P+GA++ G++AG++S LGY+Y+TP L +++ + DTCGV+NLHGMPGI+G +  A+ A  A ++IYG  +  VF  +   +R+A +Q+ YQ  AL   +   + GG  VG +L+ +PI   P   + F D  +W V
Sbjct:   11 KLPVFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGE-------GKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILK-LPIFGTPSDAECFEDAVYWEV 438          
BLAST of slc42a-2 vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:NCBI gene;Acc:496595])

HSP 1 Score: 273.478 bits (698), Expect = 1.154e-85
Identity = 182/436 (41.74%), Postives = 266/436 (61.01%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFPST----SSPFVEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKD-AREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP--TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTV 1352
            K  +   +L+   +++F   VRY    DA  +       S    EN    RY  FQDV  M+F+GFGFLM FLK+YGFSS+ FNF +  F ++W+ ++ G  H      I + +E ++NA+F   A+LISFGAVLGK SP+Q ++M L+EV +   NEY+      A DAG ++ +HTFGAYFGL  + V+   D  +  + E S Y+SDLF+M+GT+ LW+FWPSFN+   A  D Q R V+NT  SL      TF  ++ +  +       GK +MV+IQNA LAGGVAVG   ++M+ P+GA++ G++AG++S LGY+Y+TP L +++ + DTCGV+NLHGMPGI+G +  A+ A  A ++IYG  +  VF  +   +R+A +Q+ YQ  AL   +   + GG  VG +L+ +PI   P   + F D  +W V
Sbjct:   11 KLPVFCLLLEFITIILFAVFVRYDHESDAKQWHDEMRNHSVQNAENDFYFRYPSFQDVHVMIFIGFGFLMTFLKRYGFSSVAFNFLIAAFGLQWSTLIQGFFHGFHDGKIHVGIESMINADFCTGAVLISFGAVLGKTSPVQLIVMTLIEVTLFGINEYIILNIVGAKDAGGSMTIHTFGAYFGLIVSRVLYRDDLEKSRQREGSVYHSDLFAMIGTIYLWMFWPSFNSAITAHGDDQHRTVMNTYYSLAACTLATFGFSALLNGE-------GKLDMVHIQNAALAGGVAVGTSGEMMLTPFGAMIAGTLAGMISVLGYKYLTPVLDSKLKIQDTCGVHNLHGMPGILGALIGAIVALFATAEIYGAGMEDVFPLISDGSRTAKQQSLYQFLALLVALGFAILGGLVVGFILK-LPIFGTPSDAECFEDAVYWEV 438          
BLAST of slc42a-2 vs. Ensembl Mouse
Match: Rhag (Rhesus blood group-associated A glycoprotein [Source:MGI Symbol;Acc:MGI:1202713])

HSP 1 Score: 296.59 bits (758), Expect = 5.672e-95
Identity = 184/441 (41.72%), Postives = 269/441 (61.00%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYK----------DNIDATMFPSTSSPFVENRYF----YFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAR-EHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            KF ++A  L++  +++FG  V Y+           + +A+   +TSS   ++++F     FQDV  M+F+GFGFLM FLKKYGFS +GFN FL    ++W  IM G+ H  G      + +++NA+F+ A +LISFGAVLGK SP+Q ++M ++E+ + A NEYL  E F A D G ++ +H FGAYFGL  A V+     R EH N+ES Y+SDLF+M+GTL LWIFWPSFN+  A   D Q RA+VNT +SL       + ++S +       + +G+ +MV+IQNATLAGGVAVG CAD+ I  + A+ IGS+AGI+S LGY++ +P L  ++ +HDTCGV+NLHG+P                  ++G   +IV       +AS     Q AALG +I   + GG   G++L+ +PI ++P     ++D+  W VP+
Sbjct:    4 KFPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNASQQGNTSSSAKKDQFFQLYPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGKEFHFGIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVTELFEASDTGASMTIHAFGAYFGLAVAGVLYRPGLRCEHPNDESVYHSDLFAMIGTLFLWIFWPSFNSAIADPGDHQYRAIVNTYMSLAACVITAYALSSLV-------ERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLP-----------------GVFGGLASIVAISWGMSTAS--MAMQAAALGSSIGSAIVGGLLTGLILK-LPIWNQPPDEYCYDDSVSWKVPK 417          
BLAST of slc42a-2 vs. Ensembl Mouse
Match: Rhag (Rhesus blood group-associated A glycoprotein [Source:MGI Symbol;Acc:MGI:1202713])

HSP 1 Score: 290.812 bits (743), Expect = 2.859e-93
Identity = 162/351 (46.15%), Postives = 231/351 (65.81%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYK----------DNIDATMFPSTSSPFVENRYF----YFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAR-EHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMP 1088
            KF ++A  L++  +++FG  V Y+           + +A+   +TSS   ++++F     FQDV  M+F+GFGFLM FLKKYGFS +GFN FL    ++W  IM G+ H  G      + +++NA+F+ A +LISFGAVLGK SP+Q ++M ++E+ + A NEYL  E F A D G ++ +H FGAYFGL  A V+     R EH N+ES Y+SDLF+M+GTL LWIFWPSFN+  A   D Q RA+VNT +SL       + ++S +       + +G+ +MV+IQNATLAGGVAVG CAD+ I  + A+ IGS+AGI+S LGY++ +P L  ++ +HDTCGV+NLHG+P
Sbjct:    4 KFPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNASQQGNTSSSAKKDQFFQLYPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGKEFHFGIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVTELFEASDTGASMTIHAFGAYFGLAVAGVLYRPGLRCEHPNDESVYHSDLFAMIGTLFLWIFWPSFNSAIADPGDHQYRAIVNTYMSLAACVITAYALSSLV-------ERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLP 347          
BLAST of slc42a-2 vs. Ensembl Mouse
Match: Rhbg (Rhesus blood group-associated B glycoprotein [Source:MGI Symbol;Acc:MGI:1927379])

HSP 1 Score: 291.197 bits (744), Expect = 1.181e-92
Identity = 190/421 (45.13%), Postives = 265/421 (62.95%), Query Frame = 3
Query:  129 LIFGFCVRYKDNIDATMFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFN-AGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP--TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            L+F   VRY    DA ++   +   V+N +++    FQDV  M+F+GFGFLMVFL++YGFSS+GF F +   T++WA ++ G  H   G +I + VE L+NA+F   A+LISFGAVLGK  P Q +LMAL+E  + + NE++        DAG ++ +HTFGAYFGL  +WV+      +  + +SS YNSDLF+M+GT+ LW+FWPSFN A  A  D Q R VVNT  SL  S   TF +++ ++ D       G+ +MV++QNA LAGGV VG  +++M+ P+GAL  G +AG +STLGY++ TP L +R  L DTCGV+NLHGMPG++G I   V A++A  + YG+ L  VF  +    RSA+ QA YQL  +  T+     GG+  G+LLR +P  D P     F D  +W VP E
Sbjct:   25 LLFAIFVRYNHETDAALWHWGNHSNVDNEFYFRYPSFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLLQGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSWVLYRSQLEKSRHRQSSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGD-------GRLDMVHVQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLVFASVGGSLGGLLLR-LPFLDSPPDSQCFEDQVYWEVPGE 437          
BLAST of slc42a-2 vs. Ensembl Mouse
Match: Gm38392 (predicted gene, 38392 [Source:MGI Symbol;Acc:MGI:5613632])

HSP 1 Score: 280.026 bits (715), Expect = 1.331e-88
Identity = 180/385 (46.75%), Postives = 246/385 (63.90%), Query Frame = 3
Query:  225 FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFN-AGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPT--RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            FQDV  M+F+GFGFLMVFL++YGFSS+GF F +   T++WA ++ G  H   G +I + VE L+NA+F   A+LISFGAVLGK  P Q +LMAL+E  + + NE++        DAG ++ +HTFGAYFGL  +WV+      +  + +SS YNSDLF+M+GT+ LW+FWPSFN A  A  D Q R VVNT  SL  S   TF +++ ++ D       G+ +MV++QNA LAGGV VG  +++M+ P+GAL  G +AG +STLGY++ TP L +R  L DTCGV+NLHGMPG++G I   V A++A  + YG+ L  VF  +    RSA+ QA YQL  +  T+     GG+  G+LLR     D P     F D  +W VP E
Sbjct:   40 FQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLLQGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSWVLYRSQLEKSRHRQSSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGD-------GRLDMVHVQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLVFASVGGSLGGLLLRLP-FLDSPPDSQCFEDQVYWEVPGE 416          
BLAST of slc42a-2 vs. Ensembl Mouse
Match: Rhcg (Rhesus blood group-associated C glycoprotein [Source:MGI Symbol;Acc:MGI:1888517])

HSP 1 Score: 268.855 bits (686), Expect = 1.452e-83
Identity = 154/343 (44.90%), Postives = 224/343 (65.31%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTS----SPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLH 1079
            +  I   ILQ+  +++FG  VRY    DA  +        S  VEN ++Y    FQDV  M+F+GFGFLM FL++YGFS++GFNF L  F I+WA++M G  H  E  +I ++VE+++ A+F +A+  ++FGAVLGK+SP+Q ++M   +V +   NE++      A DAG ++ +HTFGAYFGL   W++  K+  + +  +SS Y+SDLF+M+GTL LWI+WPSFN+  +   D Q RA +NT +SL  S   T  ++S +         KGK +MV+IQNATLAGGV VG  A++M+ P+GAL++G   GI STLG+ Y+TP L +R  + DTCG++NLH
Sbjct:   10 RLPITCLILQVTMVVLFGVFVRYDIQADAHWWLEKKRKNISSDVENEFYYRYPSFQDVHAMVFVGFGFLMTFLQRYGFSAVGFNFLLAAFGIQWALLMQGWFHYFEEGHIVLSVENIIQADFCVASSCVAFGAVLGKVSPMQLLIMTFFQVTLFTVNEFILLNLIEAKDAGGSMTIHTFGAYFGLTVTWILYRKNLDQSKQRQSSVYHSDLFAMIGTLFLWIYWPSFNSASSFHGDAQHRAALNTYLSLAASVLTTVTVSSIV-------HKKGKLDMVHIQNATLAGGVGVGTAAEMMLTPYGALIVGFFCGIFSTLGFAYLTPFLESRHRIQDTCGIHNLH 345          
BLAST of slc42a-2 vs. UniProt/SwissProt
Match: sp|Q3BCQ5|RHAG_CANLF (Ammonium transporter Rh type A OS=Canis lupus familiaris OX=9615 GN=RHAG PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 4.014e-102
Identity = 188/437 (43.02%), Postives = 278/437 (63.62%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENR----YFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEV 1379
            F  +A +L+   +++FGF V+Y+   +A   P++++    +R    Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W   + G+ H  G  I I +++++NA+F+ A +LISFGAVLGK+SP Q ++M ++E+ + A NEY+  E F A D G ++ +H FGAYFGL  A V+     R+ HE EES Y+SDLF+M+GTL LW+FWPSFN+  A +A+ Q  A++NT +SL       + ++S +         +GK +MV+IQNATLAGGVAVG CAD+ I P+G+L+IGS+AG++S LG+R++TP LT ++ +HDTCGV+NLHG+P                  + G   +IV   +   +AS     Q AALG +I   +AGG   G++LRFI +  +P K + F+D+ +W VP+E  L  V
Sbjct:    5 FPTIAVLLEASMIVLFGFFVKYETEQNAIQQPNSTNSTKVDRSLELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLIAALGLQWGTFVQGMVHRHGQTIYIGIKNMINADFSTATVLISFGAVLGKISPTQMLIMTIIEITVFAGNEYVVGEIFQASDIGASMTIHAFGAYFGLAVAGVLYRTGLRKGHEKEESEYHSDLFAMIGTLFLWMFWPSFNSAIAETAEEQYLAIINTYLSLVACVLTAYAMSSLV-------GHRGKLDMVHIQNATLAGGVAVGTCADMKIHPYGSLIIGSIAGMVSVLGFRFLTPCLTAKLRIHDTCGVHNLHGLP-----------------GVVGGLSSIVAILLGVSTASSMT-MQAAALGSSIGSAIAGGLITGLILRFI-VRGQPSKDNFFDDSVYWEVPKEKELDNV 415          
BLAST of slc42a-2 vs. UniProt/SwissProt
Match: sp|Q02094|RHAG_HUMAN (Ammonium transporter Rh type A OS=Homo sapiens OX=9606 GN=RHAG PE=1 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 1.396e-96
Identity = 184/433 (42.49%), Postives = 266/433 (61.43%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMF-------PSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            F ++A +L+I  +++FG  V Y+   D T+        P+    F E  Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  +    ++W  I+ G+   +G    I +++++NA+F+ A +LISFGAVLGK SP Q ++M ++E+   A NEYL  E F A D G ++ +H FGAYFGL  A ++     R+ HENEES+Y SDLF+M+GTL LW+FWPSFN+  A   D+Q RA+VNT  SL       F  +S +       + +GK NMV+IQNATLAGGVAVG CAD+ I P+G+++IGS+AG++S LGY+++TP   T++ +HDTCGV+NLHG+P                  + G    IV   M   + S     Q AALG +I   + GG   G++L+ +P+  +P   + ++D+ +W VP+
Sbjct:    5 FPLMAIVLEIAMIVLFGLFVEYET--DQTVLEQLNITKPTDMGIFFE-LYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLV-------EHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLP-----------------GVVGGLAGIVAVAMGASNTS--MAMQAAALGSSIGTAVVGGLMTGLILK-LPLWGQPSDQNCYDDSVYWKVPK 407          
BLAST of slc42a-2 vs. UniProt/SwissProt
Match: sp|Q9QUT0|RHAG_MOUSE (Ammonium transporter Rh type A OS=Mus musculus OX=10090 GN=Rhag PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 3.967e-94
Identity = 184/441 (41.72%), Postives = 269/441 (61.00%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYK----------DNIDATMFPSTSSPFVENRYF----YFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAR-EHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            KF ++A  L++  +++FG  V Y+           + +A+   +TSS   ++++F     FQDV  M+F+GFGFLM FLKKYGFS +GFN FL    ++W  IM G+ H  G      + +++NA+F+ A +LISFGAVLGK SP+Q ++M ++E+ + A NEYL  E F A D G ++ +H FGAYFGL  A V+     R EH N+ES Y+SDLF+M+GTL LWIFWPSFN+  A   D Q RA+VNT +SL       + ++S +       + +G+ +MV+IQNATLAGGVAVG CAD+ I  + A+ IGS+AGI+S LGY++ +P L  ++ +HDTCGV+NLHG+P                  ++G   +IV       +AS     Q AALG +I   + GG   G++L+ +PI ++P     ++D+  W VP+
Sbjct:    4 KFPLMAISLEVAMIVLFGLFVEYETPQNASQKNASHQNASQQGNTSSSAKKDQFFQLYPLFQDVHVMIFVGFGFLMTFLKKYGFSGVGFNLFLAALGLQWGTIMQGLLHSHGKEFHFGIYNMINADFSTATVLISFGAVLGKTSPIQMLIMTILEIAVFAGNEYLVTELFEASDTGASMTIHAFGAYFGLAVAGVLYRPGLRCEHPNDESVYHSDLFAMIGTLFLWIFWPSFNSAIADPGDHQYRAIVNTYMSLAACVITAYALSSLV-------ERRGRLDMVHIQNATLAGGVAVGTCADMEIPLYAAMTIGSIAGIISVLGYKFFSPLLANKLMIHDTCGVHNLHGLP-----------------GVFGGLASIVAISWGMSTAS--MAMQAAALGSSIGSAIVGGLLTGLILK-LPIWNQPPDEYCYDDSVSWKVPK 417          
BLAST of slc42a-2 vs. UniProt/SwissProt
Match: sp|Q8BUX5|RHBG_MOUSE (Ammonium transporter Rh type B OS=Mus musculus OX=10090 GN=Rhbg PE=1 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 8.261e-92
Identity = 190/421 (45.13%), Postives = 265/421 (62.95%), Query Frame = 3
Query:  129 LIFGFCVRYKDNIDATMFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFN-AGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMP--TRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            L+F   VRY    DA ++   +   V+N +++    FQDV  M+F+GFGFLMVFL++YGFSS+GF F +   T++WA ++ G  H   G +I + VE L+NA+F   A+LISFGAVLGK  P Q +LMAL+E  + + NE++        DAG ++ +HTFGAYFGL  +WV+      +  + +SS YNSDLF+M+GT+ LW+FWPSFN A  A  D Q R VVNT  SL  S   TF +++ ++ D       G+ +MV++QNA LAGGV VG  +++M+ P+GAL  G +AG +STLGY++ TP L +R  L DTCGV+NLHGMPG++G I   V A++A  + YG+ L  VF  +    RSA+ QA YQL  +  T+     GG+  G+LLR +P  D P     F D  +W VP E
Sbjct:   25 LLFAIFVRYNHETDAALWHWGNHSNVDNEFYFRYPSFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLLQGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSWVLYRSQLEKSRHRQSSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGD-------GRLDMVHVQNAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLVFASVGGSLGGLLLR-LPFLDSPPDSQCFEDQVYWEVPGE 437          
BLAST of slc42a-2 vs. UniProt/SwissProt
Match: sp|Q68FT6|RHBG_RAT (Ammonium transporter Rh type B OS=Rattus norvegicus OX=10116 GN=Rhbg PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.282e-91
Identity = 189/421 (44.89%), Postives = 265/421 (62.95%), Query Frame = 3
Query:  129 LIFGFCVRYKDNIDATMFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFN-AGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPT--RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            L+F   VRY    DA ++   +   V+N +++    FQDV  M+F+GFGFLMVFL++YGFSS+GF F +  FT++WA ++ G  H   G +I I VE L+NA+F   A+LISFGAVLGK  P Q +LMAL+E  + + NE++        DAG ++ +HTFGAYFGL  + V+      +  + ++S YNSDLF+M+GT+ LW+FWPSFN A  A  D Q R VVNT  SL  S   TF +++ ++ D       G+ +MV+IQNA LAGGV VG  +++M+ P+GAL  G +AG +STLGY++ TP L +R  L DTCGV+NLHGMPG++G I   + A++A  + YG+ L  VF  +    RSA+ QA YQL  +  T+     GG+  G+LL+ +P  D P     F D  +W VP E
Sbjct:   25 LLFAIFVRYNHETDAALWHWGNHSNVDNEFYFRYPSFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVATFTLQWATLLQGFLHSFHGGHIHIGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVNEFILLSLLGVRDAGGSMTIHTFGAYFGLFLSRVLYRSQLEKSRHRQTSVYNSDLFAMIGTIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGD-------GRLDMVHIQNAALAGGVVVGTASEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHNLHGMPGLLGAILGVLVAALATHEAYGDGLQTVFPLIAKGQRSATSQAMYQLFGMFVTLVFASVGGSLGGLLLK-LPFLDSPPDSQCFEDQVYWEVPGE 437          
BLAST of slc42a-2 vs. TrEMBL
Match: A0A0H3YFM5 (Slc42a-2 OS=Schmidtea mediterranea OX=79327 GN=slc42a-2 PE=2 SV=1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 455/455 (100.00%), Postives = 455/455 (100.00%), Query Frame = 3
Query:   66 MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF 1430
            MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSAVAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGAFVGVLLRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF
Sbjct:    1 MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSAVAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGAFVGVLLRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF 455          
BLAST of slc42a-2 vs. TrEMBL
Match: A0A1S3H8K3 (ammonium transporter Rh type B OS=Lingula unguis OX=7574 GN=LOC106152434 PE=3 SV=2)

HSP 1 Score: 350.132 bits (897), Expect = 6.415e-112
Identity = 217/450 (48.22%), Postives = 288/450 (64.00%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFP--STSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF-SQMPT---------------------RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            K   +  +LQ  F+++FG  V Y D+ +A M     T+   V++ Y  FQDV  M+F+GFGFLM FLK+YGF S+GFNF L    ++W I+M G  H+E   IKI+V  ++ A+F   A+LISFGAVLGK SPLQ ++MA  E+     NE +G   F AVD G ++F+H FGAYFGL  A V+  +D  E + E S Y+SDLFSM+GT+ LW++WPSFN   A  D Q RAV+NT +SL     +TF I+S +         KG+ NMV++QNATLAGGVA+G  ADLMI+PWGA+L+G+ A ++STLG+ Y+TP L T+  +HDTCGVNNLHGMPGI+  I  A+ A+IA + IYG +L  VF ++ P                      R+A EQAGYQ+A LG T+ I L GG   G LL  IP  D+P+   LF+D +FW VPEE
Sbjct:   10 KLTSVLLVLQALFIVLFGIFVDYGDDANAVMSTGNETTPNSVKSYYPMFQDVHVMIFVGFGFLMTFLKRYGFGSMGFNFLLSALVVQWQILMAGFLHMEHGKIKIDVTSMIAADFGAGAVLISFGAVLGKTSPLQLVIMAFFEIIFYCVNEMIGLTYFKAVDIGGSMFIHAFGAYFGLAVARVLWREDIEESDKEGSVYHSDLFSMIGTIFLWMYWPSFNGALAPGDDQHRAVINTYLSLAACCVVTFAISSALDA-------KGRINMVHVQNATLAGGVAIGTSADLMIRPWGAMLVGTSAALISTLGFTYLTPLLSTKAKVHDTCGVNNLHGMPGILAAIAGAILAAIASTDIYGLSLYQVFPARSPVENSTMLQELQARFSEIEAGLGRTAGEQAGYQMATLGVTLGIALLGGTITGFLL-LIPCLDRPEGDQLFDDEKFWEVPEE 451          
BLAST of slc42a-2 vs. TrEMBL
Match: D7UQE2 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 4.614e-111
Identity = 214/480 (44.58%), Postives = 301/480 (62.71%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSP----------FVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF---------SQMPT-------------RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKK 1427
            K   +  I ++ F+++FG  V Y D  +AT   ++ +P           V   Y  FQDV  MMF+GFGFLM FLKKYGF S+GFNF +  F ++WA +M G  HL    I +++  LL ++F  AA+LIS GAVLGK+S +Q ++MA +E+   + NE++G   F AVD G ++FVH FGAYFGL  A V+  +D   H  E S+Y+SD+F+M+GT+ LW+FWPSFNA  A  D Q RAV+NT  SL   A +TF I+S +  D       GK NMV++QNATLAGGVA+G  AD+M+ PWGALLIGS+A +LS +GY YITP +  ++ +HDTCGVNNLHGMPG++ GI  A+ A++A    YGN++  +F         +++ T             RSA  QAG+Q+AAL  ++ + L  GA  G+LLR +PI D+P+K  ++ D  +W +PEE ++      D+N S+  +  KK
Sbjct:    7 KLTAILLIFEVVFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVVRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHIQLIIMAFVEIIFVSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSNYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKD-------GKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVNNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLR-LPIWDQPEKDSMYEDEDYWEIPEEEAV------DMNGSLEGVGHKK 472          
BLAST of slc42a-2 vs. TrEMBL
Match: D7UQE3 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.251e-109
Identity = 215/480 (44.79%), Postives = 301/480 (62.71%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDAT-----MFPSTSSPFVEN---RYFY--FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF---------SQMPT-------------RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKK 1427
            K   +  I ++ F+++FG  V Y D  +AT     + P+      +N   R +Y  FQDV  MMF+GFGFLM FLKKYGF S+GFNF +  F ++WA +M G  HL    I +++  LL ++F  AA+LIS GAVLGK+S +Q ++MA +E+   + NE++G   F AVD G ++FVH FGAYFGL  A V+  +D   H  E S Y+SD+F+M+GT+ LW+FWPSFNA  A  D Q RAV+NT  SL   A +TF I+S +  D       GK NMV++QNATLAGGVA+G  AD+M+ PWGALLIGS+A +LS +GY YITP +  ++ +HDTCGVNNLHGMPG++ GI  A+ A++A    YGN++  +F         +++ T             RSA  QAG+Q+AAL  ++ + L  GA  G+LLR +PI D P+K  ++ D  +W +PEE ++      D+N S+  +  KK
Sbjct:    7 KLTAILLIFEVVFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVLRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHIQLIIMAFVEIIFFSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSVYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKD-------GKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVNNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLR-LPIWDHPEKDSMYEDEDYWEIPEEEAV------DMNGSLEGVGHKK 472          
BLAST of slc42a-2 vs. TrEMBL
Match: D7UQE4 (Rh-related protein OS=Branchiostoma floridae OX=7739 GN=RhR-2 PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 8.078e-109
Identity = 214/480 (44.58%), Postives = 301/480 (62.71%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDAT-----MFPSTSSPFVEN---RYFY--FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALT-RIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF---------SQMPT-------------RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKK 1427
            K   +  I ++ F+++FG  V Y D  +AT     + P+      +N   R +Y  FQDV  MMF+GFGFLM FLKKYGF S+GFNF +  F ++WA +M G  HL    I +++  LL ++F  AA+LIS GAVLGK+S +Q ++MA +E+   + NE++G   F AVD G ++FVH FGAYFGL  A V+  +D   H  E S Y+SD+F+M+GT+ LW+FWPSFNA  A  D Q RAV+NT  SL   A +TF I+S +  D       GK NMV++QNATLAGGVA+G  AD+M+ PWGALLIGS+A +LS +GY YITP +  ++ +HDTCGV+NLHGMPG++ GI  A+ A++A    YGN++  +F         +++ T             RSA  QAG+Q+AAL  ++ + L  GA  G+LLR +PI D P+K  ++ D  +W +PEE ++      D+N S+  +  KK
Sbjct:    7 KLTAILLIFEVVFIVLFGILVVYDDQANATATQNSLTPAQGGADADNNVLRAYYPMFQDVHVMMFIGFGFLMTFLKKYGFGSVGFNFLVAAFVLQWATLMSGFLHLHHGKIVVDITTLLTSDFAAAAVLISMGAVLGKVSHVQLIIMAFVEIIFFSINEWVGLTFFKAVDVGGSMFVHAFGAYFGLAVARVLYREDMVGHSKEGSVYHSDIFAMIGTVFLWLFWPSFNAALAPGDDQHRAVINTYFSLAACAVVTFAISSAVEKD-------GKVNMVHVQNATLAGGVAIGTSADMMVHPWGALLIGSIAAVLSVVGYSYITPFMADKLKIHDTCGVHNLHGMPGVLAGIIGAIVAAVASPAQYGNSVYQIFPARAPIENSTELATIQAAFPAIEAGNGRSAGLQAGFQMAALIVSVLVALVTGALTGLLLR-LPIWDHPEKDSMYEDEDYWEIPEEEAV------DMNGSLEGVGHKK 472          
BLAST of slc42a-2 vs. Ensembl Cavefish
Match: rhbg (Rh family B glycoprotein [Source:NCBI gene;Acc:103039811])

HSP 1 Score: 290.426 bits (742), Expect = 1.921e-92
Identity = 185/457 (40.48%), Postives = 285/457 (62.36%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSS----PFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRS--ASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP-EETSLVEVYESDINPSVVK 1412
            +  I+  +L++  +++FG  V Y D+  A  +    +    P  EN +++    FQDV  M+F+GFGFLM FL++YGFSS+GFNF +  F ++WA +M G  H +    I + VE ++NA+F   ++LISFGAVLGK SP+Q ++MA+ EV + A NE++    F A DAG ++ +HTFGAYFGL    V+  ++  + +++  S Y+SDLF+M+GT+ LW+FWPSFN+   A  D Q R  +NT  SL      T+  ++ ++ +       GK +MV+IQNA LAGGVAVG   ++M+ P+G++++G +AG +S LGY+Y++P L +++ + DTCGV+NLHGMPG++G +   V A++A ++ YGN +  VF  +  +S  A  QAG Q  +LG T+ + L GG  VG +L+ +PI   P     F D+ +W VP EE    E+      P  V+
Sbjct:   10 RLPIVCIVLEVILIILFGTLVEYDDHTSAHGWHDNKTKPKDPDYENEFYFRYPSFQDVHVMIFIGFGFLMTFLQRYGFSSVGFNFLIAAFALQWATLMQGFFHGMHHGKIHVGVESMINADFCTGSVLISFGAVLGKTSPVQLLVMAVFEVTLFAVNEFILLSLFGARDAGGSMTIHTFGAYFGLTVTRVLYRQNLEKSKSKNCSVYHSDLFAMIGTIYLWMFWPSFNSAVTAHGDDQHRTALNTYYSLAACTLATYAFSALVSHE-------GKLDMVHIQNAALAGGVAVGTAGEMMLTPFGSMIVGFLAGTISVLGYKYLSPVLESKLKIQDTCGVHNLHGMPGVLGAVVGIVTAAVASTEAYGNGMEDVFPSIADKSSNAYSQAGMQAVSLGVTLGMALLGGLIVGFILK-LPIYGAPPDTQCFEDSIYWEVPGEEEHCNELTHVTTAPEEVE 458          
BLAST of slc42a-2 vs. Ensembl Cavefish
Match: RHCG (ammonium transporter Rh type C 2-like [Source:NCBI gene;Acc:103032157])

HSP 1 Score: 279.256 bits (713), Expect = 9.796e-88
Identity = 186/448 (41.52%), Postives = 269/448 (60.04%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPF-----VENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH----LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNT-LTIVFSQMPT-RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE-ETSLVEVYE 1385
            + F+ QI  +++FG  VRY   +DA  +P+           EN ++Y    FQDV  M+F+GFGFLM FLK+Y F  +GFNF +  F I+WA++M G  H    ++G  IKI VE ++NA+F +A+ LI+FG  LGK+SP+Q M+M L  V + A  EY+  E  H  DAG ++ +HTFG YFGL  +WV+   +  + +    S Y+SDLF+M+GTL LW+FWPSFN+  AS  D Q RA +NT +SL  S   ++ I+S           KGK +MV+IQNATLAGGVA+G  ++ MI P+G+L++G   GI+ST GY  ++P + + + + DTCG++NLH MPG +G I  A+ A+ A   IY    L  VF  + T R+A +Q GYQ A L C   +    G  +   +  +PI       + F+D  +W +PE E S+  + E
Sbjct:   27 VCFVWQIAMIILFGAFVRYNPEVDAH-WPTYKKEHNITSDSENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGIQWALLMQGWFHSLDPVDGT-IKIGVESIINADFCVASCLIAFGGCLGKVSPVQLMVMTLFGVTLFAVEEYIILELLHVKDAGGSMTIHTFGGYFGLMVSWVLYRPNLHQSKRLHGSVYHSDLFAMIGTLFLWMFWPSFNSAIASHGDGQHRAAINTYLSLAASVLTSYAISSL-------SAKKGKLDMVHIQNATLAGGVAMGTASEFMITPYGSLIVGFFCGIISTFGYLVLSPFMEKHMKIQDTCGIHNLHAMPGFLGAIVGAITAATASESIYSKEGLANVFELVGTKRTAGQQGGYQAAGL-CVALVFALVGGAIVGFILRLPIWGDVADDNCFDDEVYWELPEDEESIPPILE 464          
BLAST of slc42a-2 vs. Ensembl Cavefish
Match: ENSAMXT00000046184.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:10373477:10386288:-1 gene:ENSAMXG00000035292.1 transcript:ENSAMXT00000046184.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.789 bits (704), Expect = 6.412e-87
Identity = 179/435 (41.15%), Postives = 262/435 (60.23%), Query Frame = 3
Query:  108 ILQIGFLLIFGFCVRYKDNIDAT----MFPSTSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH----LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHEN-EESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYG-----NTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTV 1352
            + Q   +++FG  VRY D  DA     M     +  VEN ++Y    FQDV  M+F+GFGFLM FLK+Y F  +GFNF +  F I+WA++M G  H    ++G  IKI VE+++NA+F +A  LI++GA LGK+SP+Q M+M L  V + A  EY+     HA DAG ++ +HTFG Y+GL  +W++      + +  + S Y+SDLF+M+GTL LW+FWPSFN+  A+  D Q RA +NT + L  S   TF I+S         K  GK +MV++QNATLAGGVA+G  A+ MI P+G+L++G   GILST GY  ++P + + + + DTCG++NLH MPG +GG+  A+ A+ A   +YG     NT   V  +   R+ ++Q  +Q A L C   +   GG  +   +  +PI   P+  + F+D  +W V
Sbjct:   26 VWQTAMIILFGVFVRYNDETDAHWGEHMRQKNITSHVENDFYYRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGIQWALLMQGWFHSLDPVDGT-IKIGVENMINADFCVAGCLIAYGACLGKVSPVQLMVMTLFGVTLFAVEEYIILNLIHAKDAGGSMTIHTFGGYYGLVISWILYRPYLHQSKRFQGSVYHSDLFAMIGTLFLWMFWPSFNSAIANHGDGQHRAALNTYLCLAASVLTTFAISSL-------SKKGGKLDMVHVQNATLAGGVAMGTAAEFMITPYGSLIVGFCCGILSTFGYLVLSPLMEKHLKIQDTCGIHNLHAMPGFLGGVVGAITAATASESVYGREGLVNTFNFV-GEFANRTVNKQGAHQAAGL-CVALLFGLGGGALVGGILKLPIWGDPEDENCFDDETYWEV 450          
BLAST of slc42a-2 vs. Ensembl Cavefish
Match: rhag (Rh associated glycoprotein [Source:NCBI gene;Acc:103025823])

HSP 1 Score: 269.626 bits (688), Expect = 1.258e-84
Identity = 177/430 (41.16%), Postives = 256/430 (59.53%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDA--TMFPSTSSPFVENR-----YFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQ-RAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFW 1346
            KF ILA IL++  +L++   V Y D   +      ++S P  E       Y  FQDV  M+F+GFGFLM FLK+YGFSS+G N  L  F ++W +++  + H+    I ++V  ++NA+F+ A +LISFGAVLGK SP+Q ++M L+E+     NE+L      A D G ++ +H FGAYFGL  A V+     R  H+NE S Y+SDLF+M+GT+ LW+FWPSFN+  A     Q RA+VNT  SL       +  +S +       + KGK +MV+IQNATLAGGVAVG CAD+ I P+GA++IG  AGI+STLG+++++P L + + + DTCGV+NLHGMP                  I G  L  + + +  +  +   G Q AAL  +I   L GGA  G++L+ +P   +P   + F+D+ +W
Sbjct:   11 KFPILALILELVTILLYALFVVYDDGESSGHDAKDNSSDPHHEKSNPVALYPMFQDVHVMIFIGFGFLMTFLKRYGFSSVGLNLLLAAFGLQWGLLLQNMWHMHDGKIMVSVGSMINADFSTATVLISFGAVLGKTSPVQLLIMTLLEITTFCINEHLAVTMLGASDIGASMTIHAFGAYFGLAVARVLYRPGLRNGHDNEGSVYHSDLFAMIGTVYLWMFWPSFNSAIAEPGAAQLRAIVNTYFSLAACTLAAYATSSLV-------EGKGKLDMVHIQNATLAGGVAVGTCADMAIGPFGAMVIGVCAGIISTLGFKFLSPILASSLGIQDTCGVHNLHGMP-----------------GILGG-LAGILAALLGKKENVFPGTQAAALASSIGFALVGGAITGLILK-LPFWGQPPDQNCFDDSIYW 414          
BLAST of slc42a-2 vs. Ensembl Cavefish
Match: rhcgb (Rh family C glycoprotein [Source:NCBI gene;Acc:103041354])

HSP 1 Score: 267.314 bits (682), Expect = 2.994e-83
Identity = 157/344 (45.64%), Postives = 223/344 (64.83%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDAT----MFPSTSSPFVEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHL---EGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMP 1088
            + F+ Q   +++FG  VRY D +DA           +   EN    RY  FQDV  M+F+GFGFLM F+K+Y F ++GFNF +  F I+WA++M G  H    E   IKI VE+++NA+F +A+ LI++GA+LGK+SP+Q M+M L  V + A  EY+     HA DAG ++ +HTFGAYFGL  +WV+   + ++      S Y+SD+F+M+GTL LW+FWPSFN+      D Q RA +NT +SL  +   TF I+S +      EK  GK +MV+IQN+TLAGGVAVG  A+ M+ P+GAL++G   G++STLGY Y++P L R + + D+CGV+NLH MP
Sbjct:   24 VCFVWQCAMVILFGCFVRYNDEVDAHWPEFKIEKNITSDAENDFYFRYPSFQDVHVMIFVGFGFLMTFMKRYSFGAVGFNFLVAAFGIQWALLMQGWFHHIDSEDGMIKIGVENIINADFCVASCLIAYGALLGKVSPVQLMVMTLFGVTLFAVEEYIILNLIHAKDAGGSMVIHTFGAYFGLSISWVLYRPNLKDSSKLNGSVYHSDVFAMIGTLFLWMFWPSFNSAICQHGDGQHRAAINTYLSLAATVLTTFAISSLL------EK-NGKLDMVHIQNSTLAGGVAVGTAAEFMLSPYGALIVGFFCGVISTLGYIYLSPFLERKLKIQDSCGVHNLHAMP 360          
BLAST of slc42a-2 vs. Ensembl Sea Lamprey
Match: rh50 (Rh50-like protein [Source:ZFIN;Acc:ZDB-GENE-000427-1])

HSP 1 Score: 258.455 bits (659), Expect = 9.868e-82
Identity = 148/301 (49.17%), Postives = 209/301 (69.44%), Query Frame = 3
Query:  213 RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIG-VKHLEGNY--IKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGA-SADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNM---VYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMP 1088
            RY  FQDV  M+F+GFGFLM FL++YG+SS+GFNF +  F I+WAI++ G V+H + N   IK+N+E ++NA+F  A++LISFGAVLGK SP+Q ++M ++E  I + NE++G       DAG ++ +H FGAYFGL    ++  K   E H  E + Y+SDLF+M+GTL LW+FWPSFN+  A   D Q RAV++T  SL      T VI+S +          GK +M   V+IQNA+LAGGVAVG C D+M+ P+GAL++G +A I+ST G++Y+TP L +++ + DTCGV+NLHG+P
Sbjct:   26 RYTRFQDVHVMVFVGFGFLMTFLQRYGYSSVGFNFMIAGFGIQWAILVQGWVQHFDSNTGTIKVNLESMINADFCSASVLISFGAVLGKTSPVQLLIMTVIEELIFSVNEFVGIYILRVKDAGGSMIIHIFGAYFGLTVTRMLYRKGLEEGHPKEGAVYHSDLFAMIGTLFLWMFWPSFNSAIALHGDDQMRAVMHTYFSLASCVLTTIVISSLL-------DNHGKLDMVPPVHIQNASLAGGVAVGTCGDMMLSPYGALILGFIAAIISTFGFKYLTPILASKLKIQDTCGVHNLHGLP 319          
BLAST of slc42a-2 vs. Ensembl Nematostella
Match: EDO30704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T012])

HSP 1 Score: 275.018 bits (702), Expect = 4.446e-87
Identity = 162/361 (44.88%), Postives = 221/361 (61.22%), Query Frame = 3
Query:  225 FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVF-SQMPT---------------------RSASEQAGYQLAALGCT 1238
            FQD+  ++ +GFG LM FLKKYGFS +G+NF +C   +EWA +M G   +E N I+++++ ++  +     IL+SFGAVLGK S LQ +LM+ +EV     N  +      AVD G  + VH FGAYFGL  A V+  K++  HE E S Y SDLF+ LGT+ LW++WPSFN+       + RAVVNT  ++  S    F  +S +T          K +MV+IQNATLAGGVAVG  A ++I PWGA+L+G V GI+ST+GY+YI P L R +++HDTCGVN+LHGMPGI+  I S V++ +A    Y  +L  VF ++ P                      R+A+EQAGYQ AAL  T
Sbjct:   53 FQDIHVLLLVGFGLLMTFLKKYGFSGLGYNFLICAVVMEWATLMQGFFEMENNKIQLDIDSMIKGDLAAVTILVSFGAVLGKTSSLQLLLMSFIEVIFYTINRTICTTYLQAVDPGGAVLVHAFGAYFGLTVARVLYNKNSVAHEKEASRYTSDLFATLGTIFLWVYWPSFNSILVQGVLRHRAVVNTYYAMAASCVTVFAFSSLVTK-------ASKLSMVHIQNATLAGGVAVGTIASMIIHPWGAILLGMVGGIISTIGYKYIQPWLIRTLHIHDTCGVNSLHGMPGILAAIASIVSSGLAGFGQYKTSLYTVFPARSPVINSTQYLELVQFVPDARAGLGRTATEQAGYQCAALVMT 406          
BLAST of slc42a-2 vs. Ensembl Nematostella
Match: EDO37911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED8])

HSP 1 Score: 239.195 bits (609), Expect = 1.286e-73
Identity = 167/435 (38.39%), Postives = 255/435 (58.62%), Query Frame = 3
Query:   84 PKFGILAFILQIGFLLIFGFCVRYKDNIDATMF---PSTSSPFVENRYF-YFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGV--KHLEG--NYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASAD-RQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            P F IL  +LQ+ F++IF     Y D+         P  +     N Y+  FQDV  M+FLG G L+ FL+ + +SSI + FF      EW+ I+ GV    +EG  +  KI++   +NA+F  A ILIS+  VLGK+S LQ ++M ++E+ +   N ++   K    D G +I +H F AYFGLG   V+  +D+  +  E SSY++D+F ++GT+ LW++WPSFNA   + D  + R V NT  S+ G+  M F ++     D       GKFN+ ++QNATLAGGVA+G  +++++QPWG++LIGS+ G + TLGY Y++P L +   +HD CGV+NLH +P  + GI SA+A+S+A +  YG+            + S+QAG+Q+AA+  TI I L  G   G L++ + I +      +F+D  FW V +
Sbjct:    4 PTFTILTILLQVLFVVIFAIFGEYGDDARPNHKRPNPGAAGINAVNIYYPMFQDVHVMIFLGIGLLLAFLRNHAYSSISYCFFAAAILCEWSTIINGVFWHIIEGGNDKFKIDLFSAINADFAAAVILISYCVVLGKISILQLLVMGVIELAVYVLNSWICFAKLGISDIGASITIHMFAAYFGLGVTRVLHSRDSEGNGKECSSYHNDVFCLVGTIFLWLYWPSFNACLTTDDVMRHRTVTNTYYSMLGACVMVFALSPMFRRD-------GKFNLSHVQNATLAGGVAIGTASNMIVQPWGSMLIGSIGGAMCTLGYVYLSPFLQKHCKMHDVCGVHNLHALPAFLSGIASAIASSLAAADEYGDA-----------TPSQQAGFQVAAMFVTIGISLLSGILTGFLIK-LWIFEPMSTRQMFDDEDFWMVSK 419          
BLAST of slc42a-2 vs. Ensembl Nematostella
Match: EDO37910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SED7])

HSP 1 Score: 236.113 bits (601), Expect = 9.050e-73
Identity = 154/392 (39.29%), Postives = 235/392 (59.95%), Query Frame = 3
Query:   84 PKFGILAFILQIGFLLIFGFCVRYKDNIDATMF---PSTSSPFVENRYF-YFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGV--KHLEG--NYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASAD-RQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAAL 1229
            P F IL  +LQ+ F++IF     Y D+         P  +     N Y+  FQDV  M+FLG G L+ FL+K+ +SSI + FF      EW+ I+ GV    +EG  +  KI++   +NA+F  A ILIS+  VLGK+S LQ ++M ++E+ +   N ++   K    D G +I +H F AYFGLG   V+  +D+  +  E SSY++D+F ++GT+ LW++WPSFNA   + D  + R V NT  S+ G+  M F ++     D       GKFN+ ++QNATLAGGVA+G  +++++QPWG++LIGS+ G + TLGY Y++P L +   +HD CGV+NLH +P  + GI SA+A+S+A +  YG+            +  +QAG+Q+AA+
Sbjct:    4 PTFTILTILLQVLFVVIFAIFGEYGDDARPNHKRPNPGAAGINAVNIYYPMFQDVHVMIFLGIGLLLAFLRKHAYSSISYCFFAAAILCEWSTIINGVFWHIIEGGNDKFKIDLFSAINADFAAAVILISYCVVLGKISILQLLVMGVIELAVYVLNSWICFAKLGISDIGASITIHMFAAYFGLGVTRVLHSRDSEGNGKECSSYHNDVFCLVGTIFLWLYWPSFNACLTTDDVMRHRTVTNTYYSMLGACVMVFALSPMFRRD-------GKFNLSHVQNATLAGGVAIGTASNMIVQPWGSMLIGSIGGAMCTLGYVYLSPFLKKHCKMHDVCGVHNLHALPAFLSGIASAIASSLAAADEYGDA-----------TPGQQAGFQVAAM 377          
BLAST of slc42a-2 vs. Ensembl Nematostella
Match: EDO36089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM6])

HSP 1 Score: 220.705 bits (561), Expect = 2.411e-66
Identity = 154/393 (39.19%), Postives = 226/393 (57.51%), Query Frame = 3
Query:  282 KKYGFSSIGFNFFLCVFTIEWAIIMIGV----KHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAV---DAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNA--GGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNT-----------------------LTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            K++G+S I   FF      +WAII  GV     H E  +I++N++ L  A++T A +LI++   +G  SP Q ++++   +PI  +   L    FH +   DAG +I +H+FGAY+G+    ++  KDA +H  E++SY SD+FSM GTL LWI+WPSFN   G    + Q R VVNT + L     M F++ SF+T  +      GKF M +IQNATLAGGVAVG  A++M+ PWGALL+G++ G +STLG+ Y++P L + + ++D  GVNNLHGMPGI+GGI  AV ++ A  + YG+                        + + F+    R+A  Q  YQ A L   I I L GG   G++ RF    +  KKH L++D  F+ +P+ 
Sbjct:   14 KRFGYSGICTAFFGASLAAQWAIICSGVFTGLIHGEA-HIQVNIQSLCLADYTTAVVLIAYCTTMGYASPTQLIIISFF-LPI--FYGLLEMVLFHYLLIADAGGSILIHSFGAYYGMAFCRMMYRKDAVDHPKEDASYTSDMFSMAGTLFLWIYWPSFNGVFGAPDYEAQHRIVVNTYLGLLSGTVMVFIV-SFLTSKD------GKFTMAHIQNATLAGGVAVGTAANMMMYPWGALLVGAMGGTISTLGFVYMSPLLLKYLKINDVAGVNNLHGMPGILGGIAGAVISAHAQPETYGHQGLYSVFSARAPMVNTTEYVQLQEMGVAFTPGSGRTARLQGCYQAAGLAAAIGIALIGGLLTGLVARFRAF-NPLKKHQLYDDFDFYVLPDS 394          
BLAST of slc42a-2 vs. Ensembl Nematostella
Match: EDO26607 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBK0])

HSP 1 Score: 69.3218 bits (168), Expect = 3.138e-15
Identity = 31/53 (58.49%), Postives = 45/53 (84.91%), Query Frame = 3
Query:  888 VYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIY 1046
            V+IQNATLAGGVA+G  ++++I PWGALL+GS++G +STLGY Y+T + + I+
Sbjct:    1 VHIQNATLAGGVAIGTASNMVIYPWGALLVGSISGTISTLGYAYLTVSFSCIF 53          
BLAST of slc42a-2 vs. Ensembl Medaka
Match: rhag (Rh associated glycoprotein [Source:NCBI gene;Acc:101169082])

HSP 1 Score: 276.944 bits (707), Expect = 1.424e-87
Identity = 172/402 (42.79%), Postives = 239/402 (59.45%), Query Frame = 3
Query:  189 TSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDARE-HENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASAD-RQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQA---------GYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPE 1358
            TS+P     Y  FQDV  M+F+GFGFLM FLKKYGFSS+G N  L  F ++W ++M GV H++   IK++V  ++NA+F+ A +LISFGAVLGK SP+Q ++M ++E+ I + NE+L      A D G ++ +H FGAYFGL  A V+     R  HEN+ S Y+SDLF+M+GT+ LW+FWPSFN+  A     Q  AV+NT +SL       + I+S +       + KGK +MV+IQNATLAGGVAVG CAD+ IQP+GA+LIG VAGI+STLG++Y++P L +++ + DTCGV+NLHGMP                  I G    IV   +  +  S            G+ L     T  I              +P+  +P   + F+D+ +W VPE
Sbjct:   48 TSNPV--ELYPMFQDVHVMIFIGFGFLMTFLKKYGFSSVGINLLLAAFGLQWGLLMQGVWHMDHGKIKVDVFKMINADFSTATVLISFGAVLGKTSPVQLLIMTILEITIFSINEHLVANILSANDVGASMIIHAFGAYFGLAVARVLYRPGLRNGHENDGSVYHSDLFAMIGTVFLWMFWPSFNSAIAEPGFVQLTAVINTYLSLAACVLSAYAISSLV-------EHKGKLDMVHIQNATLAGGVAVGTCADMNIQPFGAMLIGVVAGIISTLGFKYLSPVLASKLGIQDTCGVHNLHGMP-----------------GILGGLAGIVAVALGKKDGSAAMQAAALASSLGFALIGGAITGLIMK------------LPVWGQPPDQNCFDDSIYWEVPE 411          
BLAST of slc42a-2 vs. Ensembl Medaka
Match: rhcgb (Rh family C glycoprotein [Source:NCBI gene;Acc:101168114])

HSP 1 Score: 275.018 bits (702), Expect = 2.908e-86
Identity = 178/429 (41.49%), Postives = 258/429 (60.14%), Query Frame = 3
Query:  108 ILQIGFLLIFGFCVRYKDNIDATMFPSTSSPF--VEN----RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGN--YIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESS-YNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTR-IYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEE 1361
            + QI  +++FG  VRY    DA    +       +EN    RY  FQDV  M+F+GFGFLM FLK+Y F  +GFNF +  F ++WA++M G  H  G+   I INV  ++NA+F +A  LI++GA+LGK+SP+Q M++ L  V + A  EY+     +A DAG ++ +HTFGAY+GL  +W++   +  +    + S Y+SD+F+M+GTL LW+FWPSFN+      D Q RA +NT +SL  +      ++S         +  GK +MV+IQNATLAGGVAVG  A+ M+ P+G+L++G   GILSTLGY YITP L + + + DTCG++NLH MPG++GGI  A+ A+ A   +YG     +F   P    ++Q G+Q  AL C       GG  +   +  +PI   P   + F+D  +W VPEE
Sbjct:   29 VWQISMIILFGIFVRYDKESDAHWIETNPKNMSKIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGGVGFNFLIAAFGLQWALLMQGWFHHLGDDGKISINVYSMINADFCVAGCLIAYGALLGKVSPVQLMVLTLFGVTLFAVEEYIILNLIYAKDAGGSMVIHTFGAYYGLAISWMLYRPNLDQSSRLQGSVYHSDVFAMIGTLFLWMFWPSFNSAITEHGDGQHRAAINTYLSLASTVLTAVAVSSVY-------QKHGKLDMVHIQNATLAGGVAVGTAAEFMLMPYGSLIVGFCCGILSTLGYIYITPFLEKYLKIQDTCGIHNLHAMPGVIGGIVGAITAAAASESVYGTEGIKLFKFPP----AQQGGHQAGAL-CVALCFGIGGGILVGAILRLPIWGDPADDNCFDDESYWEVPEE 445          
BLAST of slc42a-2 vs. Ensembl Medaka
Match: rhbg (RhBG-like protein [Source:NCBI gene;Acc:100125813])

HSP 1 Score: 265.388 bits (677), Expect = 9.760e-83
Identity = 196/457 (42.89%), Postives = 284/457 (62.14%), Query Frame = 3
Query:   87 KFGILAFILQIGFLLIFGFCVRYKDNIDATMFP----STSSPFVENRYFY----FQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH-LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVI--SGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAG-GASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPT--RSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVP-------EETSLVEVYESD 1391
            K  I  FILQI  +++FG  V+Y ++ DA        S S   +EN ++Y    FQDV  M+F+GFGFLM FL++YGFSS+GFNF +  F+++WA +M G  H L    I I VE ++NA+F   ++LISFGAVLGK SP+Q + MA+ EV + A NE++        DAG ++ +HTFGAYFGL    ++     D  +H+N  S Y+SDLF+M+GTL LW+FWPSFN+      D Q R  +NT  SL      T+ ++S    D       GK +MV+IQNA LAGGVA G   ++M+ P+G++++G +AGI+S LG++Y+TP L  ++ + DTCG++NLHGMPG++G I  AV AS+A  ++YG  L  VF  + +  R+AS+Q G Q  +L  T+ + L GG  VG +L+ +PI   P+    F D+ +W VP       ++ + V+  ESD
Sbjct:   11 KLPITCFILQIILIILFGVLVQYDEDTDAKKHHHGNHSESKSDIENDFYYRYPSFQDVHVMIFVGFGFLMTFLQRYGFSSVGFNFLIAAFSLQWATLMQGFFHGLHEGKIHIGVESMINADFCTGSVLISFGAVLGKTSPVQLLFMAVFEVTLFAVNEFILLTLLGTRDAGGSMTIHTFGAYFGLMVTRILYRPNLDKSKHKN-CSVYHSDLFAMIGTLYLWMFWPSFNSAVTEHGDPQHRTAMNTYYSLAACTLSTYAMSSLTAHD-------GKLDMVHIQNAALAGGVAAGTAGEMMLTPFGSMIVGFLAGIISVLGFKYLTPILENKLKIQDTCGIHNLHGMPGVLGAIVGAVTASLASKEVYGEGLEKVFPDVASGKRTASDQGGVQAISLAVTLGMALFGGLIVGFILK-LPIFGAPRDTTCFEDSLYWEVPGEEESHEDQLTTVKTEESD 458          
BLAST of slc42a-2 vs. Ensembl Medaka
Match: rh50 (50 kD glycoprotein [Source:NCBI gene;Acc:100144346])

HSP 1 Score: 264.233 bits (674), Expect = 3.982e-82
Identity = 183/442 (41.40%), Postives = 264/442 (59.73%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVEN-------RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH---LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKD-AREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIY---GNTLTIVFS-QMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLV 1373
            + F+ QI  +++FG  +RY +  DA       +  + +       RY  FQDV  M+F+GFGFLM FLK+Y FS++GFNF +  F ++WA++M G  H        I I +E L+NA+F  AA LI++GA+LGK+SP+Q M++ L  V + A  EY+  +  H  D+G  + +H FG Y+GL  +WV+   +  R      S Y+SDLF+M+GTL LW+FWPSFN+  A+  D Q R  +NT I+L  S   T  ++S         K +GK +MV+IQNATLAGGVA+G  A+ MI P+G+L++G   GI+ST GY Y+TP L  R+ L DTCG++NLH +PG++GG   A+ A+ A   +Y   G   T  F+ +   RS   Q G+Q A +   +A GL GGA VG +L+F PI         F+D  +W +PEE   +
Sbjct:   27 VCFVWQIAMIVLFGVFIRYDEESDAHWVELKKTENLTDLQNEFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFSAVGFNFLIAAFGLQWALLMQGWFHHFDYSTGKIYIGIESLINADFCCAASLIAYGAILGKVSPVQLMVVTLFGVTLFAVEEYIILDLLHCRDSGGAMVIHCFGGYYGLAISWVLYRPNLHRSKRLNGSVYHSDLFAMIGTLFLWMFWPSFNSAIANHGDGQHRTAMNTYIALASSVLTTVALSSM-------SKKEGKLDMVHIQNATLAGGVAMGTAAEFMITPYGSLIVGFCIGIISTFGYLYVTPFLEKRLKLQDTCGIHNLHAVPGMLGGFIGAIVAATASESVYSKQGLIDTFGFTGKYENRSPGTQGGFQAAGVCVAMAFGLVGGAIVGFILKF-PIWGDAADDYCFDDEAYWELPEEEETI 460          
BLAST of slc42a-2 vs. Ensembl Medaka
Match: rh50 (50 kD glycoprotein [Source:NCBI gene;Acc:100144346])

HSP 1 Score: 264.233 bits (674), Expect = 4.443e-82
Identity = 183/442 (41.40%), Postives = 264/442 (59.73%), Query Frame = 3
Query:   99 LAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVEN-------RYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKH---LEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKD-AREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGAS-ADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPAL-TRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIY---GNTLTIVFS-QMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLV 1373
            + F+ QI  +++FG  +RY +  DA       +  + +       RY  FQDV  M+F+GFGFLM FLK+Y FS++GFNF +  F ++WA++M G  H        I I +E L+NA+F  AA LI++GA+LGK+SP+Q M++ L  V + A  EY+  +  H  D+G  + +H FG Y+GL  +WV+   +  R      S Y+SDLF+M+GTL LW+FWPSFN+  A+  D Q R  +NT I+L  S   T  ++S         K +GK +MV+IQNATLAGGVA+G  A+ MI P+G+L++G   GI+ST GY Y+TP L  R+ L DTCG++NLH +PG++GG   A+ A+ A   +Y   G   T  F+ +   RS   Q G+Q A +   +A GL GGA VG +L+F PI         F+D  +W +PEE   +
Sbjct:   27 VCFVWQIAMIVLFGVFIRYDEESDAHWVELKKTENLTDLQNEFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFSAVGFNFLIAAFGLQWALLMQGWFHHFDYSTGKIYIGIESLINADFCCAASLIAYGAILGKVSPVQLMVVTLFGVTLFAVEEYIILDLLHCRDSGGAMVIHCFGGYYGLAISWVLYRPNLHRSKRLNGSVYHSDLFAMIGTLFLWMFWPSFNSAIANHGDGQHRTAMNTYIALASSVLTTVALSSM-------SKKEGKLDMVHIQNATLAGGVAMGTAAEFMITPYGSLIVGFCIGIISTFGYLYVTPFLEKRLKLQDTCGIHNLHAVPGMLGGFIGAIVAATASESVYSKQGLIDTFGFTGKYENRSPGTQGGFQAAGVCVAMAFGLVGGAIVGFILKF-PIWGDAADDYCFDDEAYWELPEEEETI 460          
BLAST of slc42a-2 vs. Planmine SMEST
Match: SMESG000005978.1 (SMESG000005978.1)

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 455/455 (100.00%), Postives = 455/455 (100.00%), Query Frame = 3
Query:   66 MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPXXXXXXXXXXXXXXXXXKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTXXXXXXXXXXXXXXXRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF 1430
            MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSAVAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGAFVGVLLRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF
Sbjct:    1 MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENRYFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSAVAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGAFVGVLLRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKIDMKKF 455          
BLAST of slc42a-2 vs. Planmine SMEST
Match: SMESG000048384.1 (SMESG000048384.1)

HSP 1 Score: 323.553 bits (828), Expect = 1.687e-106
Identity = 178/337 (52.82%), Postives = 233/337 (69.14%), Query Frame = 3
Query:   90 FGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENR----YFYFQDVQXXXXXXXXXXXXXXKKYGFSSIGFNFFLCVFTIEWAIIMIGVKHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVPICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENEESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAFMTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWGALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMP 1088
            F I A +LQ    ++      Y   IDA++  + +   V++     Y YFQDVQGM+FLGFGFLM FL+KYG+SS+G NFF+ V +I+WA+++ G        I ++   LLNAEF  A ILISFG VLGK +P+Q ++M+ +E+P+   NEY+GR      D GD+IFVHTFGAYFGL  + VI  K     +NE S Y+SDLF+M+GTLVLW+FWPSFN+GG   +++ RAVVNT  SL  S  +TF+I++ +         KGK NMV+I NATL+GGVAVGA A+LM++PWGA LIG +AG +STLGY+YITP L +I  HDTCGVNNLHGMP
Sbjct:    7 FVITASLLQAFVFILLVIFSDYDSRIDASITGNANHTGVQDTLSSVYPYFQDVQGMIFLGFGFLMTFLQKYGYSSVGINFFIAVISIQWALVINGFVSSHATRIYLDGASLLNAEFATATILISFGVVLGKTTPIQMLIMSFIEMPLFVLNEYIGRHLLMVSDVGDSIFVHTFGAYFGLFLSRVIHKKKMGNSKNESSIYHSDLFAMIGTLVLWMFWPSFNSGGIEGEQRHRAVVNTFCSLIASTIVTFIISALVE--------KGKINMVHIANATLSGGVAVGASANLMLKPWGACLIGMIAGAVSTLGYKYITPRLNKIGFHDTCGVNNLHGMP 335          
The following BLAST results are available for this feature:
BLAST of slc42a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHAG2.691e-9742.49Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG2.906e-9742.49Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG2.137e-9542.46Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG1.277e-9447.52Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
RHAG1.406e-9447.52Rh associated glycoprotein [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rhr-12.860e-8747.16RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
rhr-12.860e-8747.16RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
rhr-23.074e-7239.24RH (Rhesus) antigen Related [Source:UniProtKB/TrE... [more]
amt-38.378e-926.84Putative ammonium transporter 3 [Source:UniProtKB... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rh501.473e-8640.35gene:FBgn0028699 transcript:FBtr0331423[more]
Rh501.473e-8640.35gene:FBgn0028699 transcript:FBtr0345597[more]
Rh501.689e-8640.59gene:FBgn0028699 transcript:FBtr0073354[more]
back to top
BLAST of slc42a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhcgl13.444e-9144.06Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc... [more]
rhcgl14.902e-9144.52Rh family, C glycoprotein, like 1 [Source:ZFIN;Acc... [more]
rhcga8.026e-9042.41Rh family, C glycoprotein a [Source:ZFIN;Acc:ZDB-G... [more]
rhbg8.790e-8942.76Rh family, B glycoprotein (gene/pseudogene) [Sourc... [more]
rhag1.266e-8842.42Rh associated glycoprotein [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhcg6.029e-9242.89Rh family C glycoprotein [Source:NCBI gene;Acc:445... [more]
rhcg8.421e-9243.81Rh family C glycoprotein [Source:NCBI gene;Acc:445... [more]
rhcg1.289e-8745.83Rh family C glycoprotein [Source:NCBI gene;Acc:445... [more]
rhbg1.047e-8541.74Rh family B glycoprotein (gene/pseudogene) [Source... [more]
rhbg1.154e-8541.74Rh family B glycoprotein (gene/pseudogene) [Source... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rhag5.672e-9541.72Rhesus blood group-associated A glycoprotein [Sour... [more]
Rhag2.859e-9346.15Rhesus blood group-associated A glycoprotein [Sour... [more]
Rhbg1.181e-9245.13Rhesus blood group-associated B glycoprotein [Sour... [more]
Gm383921.331e-8846.75predicted gene, 38392 [Source:MGI Symbol;Acc:MGI:5... [more]
Rhcg1.452e-8344.90Rhesus blood group-associated C glycoprotein [Sour... [more]
back to top
BLAST of slc42a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3BCQ5|RHAG_CANLF4.014e-10243.02Ammonium transporter Rh type A OS=Canis lupus fami... [more]
sp|Q02094|RHAG_HUMAN1.396e-9642.49Ammonium transporter Rh type A OS=Homo sapiens OX=... [more]
sp|Q9QUT0|RHAG_MOUSE3.967e-9441.72Ammonium transporter Rh type A OS=Mus musculus OX=... [more]
sp|Q8BUX5|RHBG_MOUSE8.261e-9245.13Ammonium transporter Rh type B OS=Mus musculus OX=... [more]
sp|Q68FT6|RHBG_RAT1.282e-9144.89Ammonium transporter Rh type B OS=Rattus norvegicu... [more]
back to top
BLAST of slc42a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFM50.000e+0100.00Slc42a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3H8K36.415e-11248.22ammonium transporter Rh type B OS=Lingula unguis O... [more]
D7UQE24.614e-11144.58Rh-related protein OS=Branchiostoma floridae OX=77... [more]
D7UQE31.251e-10944.79Rh-related protein OS=Branchiostoma floridae OX=77... [more]
D7UQE48.078e-10944.58Rh-related protein OS=Branchiostoma floridae OX=77... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhbg1.921e-9240.48Rh family B glycoprotein [Source:NCBI gene;Acc:103... [more]
RHCG9.796e-8841.52ammonium transporter Rh type C 2-like [Source:NCBI... [more]
ENSAMXT00000046184.16.412e-8741.15pep primary_assembly:Astyanax_mexicanus-2.0:5:1037... [more]
rhag1.258e-8441.16Rh associated glycoprotein [Source:NCBI gene;Acc:1... [more]
rhcgb2.994e-8345.64Rh family C glycoprotein [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rh509.868e-8249.17Rh50-like protein [Source:ZFIN;Acc:ZDB-GENE-000427... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc42a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO307044.446e-8744.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379111.286e-7338.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379109.050e-7339.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360892.411e-6639.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266073.138e-1558.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc42a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhag1.424e-8742.79Rh associated glycoprotein [Source:NCBI gene;Acc:1... [more]
rhcgb2.908e-8641.49Rh family C glycoprotein [Source:NCBI gene;Acc:101... [more]
rhbg9.760e-8342.89RhBG-like protein [Source:NCBI gene;Acc:100125813][more]
rh503.982e-8241.4050 kD glycoprotein [Source:NCBI gene;Acc:100144346... [more]
rh504.443e-8241.4050 kD glycoprotein [Source:NCBI gene;Acc:100144346... [more]
back to top
BLAST of slc42a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005978.10.000e+0100.00SMESG000005978.1[more]
SMESG000048384.11.687e-10652.82SMESG000048384.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018300
GenBankAKN21682.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018300 ID=SMED30018300|Name=slc42a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1561bp
TGTGCGTATAGAGTTATGTATAAATTAATAGAGTTAGATGCACTAAAAAA
TATTTTATCACAAAAATGAAAAGTTTTCAAGGTCCCAAATTTGGTATTTT
GGCATTCATTTTACAAATAGGGTTTCTTTTGATATTTGGTTTTTGCGTGA
GATATAAGGATAACATTGATGCGACAATGTTTCCTAGTACCTCCTCCCCA
TTTGTAGAAAACAGATATTTTTATTTTCAAGACGTCCAAGGAATGATGTT
TTTAGGATTTGGTTTTTTGATGGTTTTCTTAAAGAAATATGGATTCAGTT
CAATAGGATTTAATTTTTTTCTTTGTGTATTTACAATTGAATGGGCTATC
ATTATGATAGGAGTCAAACATCTTGAAGGAAACTACATTAAGATAAATGT
CGAAGATTTGTTAAATGCTGAATTCACATTAGCAGCAATTTTAATTTCAT
TTGGAGCTGTTCTTGGAAAATTGAGTCCACTTCAATATATGCTTATGGCT
TTAATGGAAGTTCCTATTTGTGCTTGGAATGAATATTTGGGACGTGAAAA
ATTTCATGCTGTAGACGCAGGGGATACGATTTTTGTACACACATTTGGAG
CTTACTTTGGATTGGGATGCGCATGGGTCATTTCAGGCAAAGACGCTCGT
GAACACGAAAATGAAGAATCGAGTTATAATTCTGATCTATTTTCAATGCT
TGGAACATTGGTGTTATGGATCTTTTGGCCTAGCTTCAATGCTGGAGGAG
CTTCTGCAGACCGTCAACAAAGAGCTGTGGTTAACACAGTTATTTCGTTG
TGTGGAAGTGCTTTTATGACTTTTGTGATAAATTCATTCATAACGGTTGA
TGAATCCGACGAAAAGATTAAAGGAAAATTTAACATGGTTTACATTCAAA
ATGCTACATTGGCTGGTGGTGTTGCCGTAGGAGCATGTGCTGACTTAATG
ATTCAACCATGGGGTGCACTTTTAATTGGTTCAGTTGCTGGAATTTTATC
AACTCTTGGATATCGTTATATCACTCCAGCTTTAACTAGAATATATCTTC
ACGATACATGTGGAGTGAATAATTTACACGGTATGCCTGGTATCATGGGA
GGTATAGGTTCTGCAGTGGCTGCCTCTATAGCTGACAGCAAAATTTATGG
AAACACGCTGACCATTGTGTTTTCTCAAATGCCAACAAGATCTGCTTCAG
AACAGGCCGGTTATCAGCTGGCGGCGCTTGGCTGTACAATAGCTATTGGT
TTGGCTGGGGGTGCCTTTGTCGGAGTACTTTTGCGTTTCATTCCGATTTG
TGACAAACCGAAAAAACATGATTTGTTCAATGATAACCGTTTTTGGACCG
TTCCAGAAGAGACGTCTTTAGTTGAAGTTTATGAATCTGATATAAATCCA
TCAGTTGTAAAGATCGACATGAAAAAGTTTTAAAGTTTAATTATGAATTG
TTTTGTTTTTATTATTGTGAAAAAAATGTACTATTTTTTGCATTCCAACC
TATTTCTTTCATTTCAGACAATAAACATTGTTTTAACTGTCACAAATTTT
TTAACTTTCAG
back to top

protein sequence of SMED30018300-orf-1

>SMED30018300-orf-1 ID=SMED30018300-orf-1|Name=SMED30018300-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
MKSFQGPKFGILAFILQIGFLLIFGFCVRYKDNIDATMFPSTSSPFVENR
YFYFQDVQGMMFLGFGFLMVFLKKYGFSSIGFNFFLCVFTIEWAIIMIGV
KHLEGNYIKINVEDLLNAEFTLAAILISFGAVLGKLSPLQYMLMALMEVP
ICAWNEYLGREKFHAVDAGDTIFVHTFGAYFGLGCAWVISGKDAREHENE
ESSYNSDLFSMLGTLVLWIFWPSFNAGGASADRQQRAVVNTVISLCGSAF
MTFVINSFITVDESDEKIKGKFNMVYIQNATLAGGVAVGACADLMIQPWG
ALLIGSVAGILSTLGYRYITPALTRIYLHDTCGVNNLHGMPGIMGGIGSA
VAASIADSKIYGNTLTIVFSQMPTRSASEQAGYQLAALGCTIAIGLAGGA
FVGVLLRFIPICDKPKKHDLFNDNRFWTVPEETSLVEVYESDINPSVVKI
DMKKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002229RhesusRHD
IPR024041NH4_transpt_AmtB-like_dom
IPR029020Ammonium/urea_transptr
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008519ammonium transmembrane transporter activity
GO:0022840leak channel activity
Vocabulary: biological process
TermDefinition
GO:0015696ammonium transport
GO:0006810transport
GO:0015672monovalent inorganic cation transport
GO:0015695organic cation transport
GO:0072488ammonium transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002229Blood group Rhesus C/E/D polypeptidePRINTSPR00342RHESUSRHDcoord: 117..133
score: 53.27
coord: 8..26
score: 29.82
coord: 140..163
score: 29.63
coord: 339..355
score: 31.05
coord: 302..320
score: 37.43
coord: 51..68
score: 53.7
coord: 80..97
score: 29.32
coord: 174..189
score: 54.51
coord: 208..226
score: 72.22
IPR029020Ammonium/urea transporterGENE3DG3DSA:1.10.3430.10coord: 3..434
e-value: 9.5E-166
score: 554.0
IPR024041Ammonium transporter AmtB-like domainPFAMPF00909Ammonium_transpcoord: 21..406
e-value: 2.5E-66
score: 224.0
NoneNo IPR availablePANTHERPTHR11730AMMONIUM TRANSPORTERcoord: 7..432
NoneNo IPR availablePANTHERPTHR11730:SF60RH50, ISOFORM Bcoord: 7..432
NoneNo IPR availableSUPERFAMILYSSF111352Ammonium transportercoord: 53..410
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 299..321
NoneNo IPR availableTMHMMTMhelixcoord: 10..28
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 272..294
NoneNo IPR availableTMHMMTMhelixcoord: 203..222
NoneNo IPR availableTMHMMTMhelixcoord: 115..134
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
NoneNo IPR availableTMHMMTMhelixcoord: 384..406
NoneNo IPR availableTMHMMTMhelixcoord: 172..191