GCR136

Overview
NameGCR136
Smed IDSMED30018290
Length (bp)1348
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR136 (SMED30018290) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR136 (SMED30018290) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018290

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018290h1SMcG0003665 dd_Smed_v4_8759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018290h1SMcG0003665 dd_Smed_v4_8759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018290h1SMcG0003665 dd_Smed_v4_8759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30018290h1SMcG0003664 Contig17309newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018290h1SMcG0003664 Contig17309uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30018290h1SMcG0003664 GCR136smed_ncbi_20240424PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR136 vs. TrEMBL
Match: A0A193KUM8 (GCR136 OS=Schmidtea mediterranea OX=79327 GN=gcr136 PE=2 SV=1)

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 422/423 (99.76%), Query Frame = 1
Query:   49 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDDESSETSLLKNKSK 1317
            MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNIT ASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDDESSETSLLKNKSK
Sbjct:    1 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITTASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDDESSETSLLKNKSK 423          
BLAST of GCR136 vs. TrEMBL
Match: A0A193KUM0 (GCR126 OS=Schmidtea mediterranea OX=79327 GN=gcr126 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.441e-48
Identity = 122/418 (29.19%), Postives = 218/418 (52.15%), Query Frame = 1
Query:   31 QIDF-FSMYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQ--DIDLKKTLDDYGNDEFFAALKVAT 1272
            +IDF + MY L P  DS E I  KFS F+  +K  CL  ++S  C   W +  C+T +   +  +++ CPF+      +C NG W+   ++++ +C    F +R TI       + P +LLI+ T  + + EY EI ++F W+ ++W+   +S+     I +  +NSS   Y  CML     +  + F   SM     ++YAI+    TQLR+IKS+L H  FI P+++ ++ LI D+  TKG + FQC+  P+ S + ++YV   +  I+    + ++I   L  + +  N    YR+EYDI+G RKE+S R++ R    +K+ + ++  N ++    +  +    +   YK  VI+YS +++   ++   ++W N  L+    A + W    ++++K   +D    +F  A++  T
Sbjct:   22 RIDFLYIMYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNS-SCISTWVFQVCLTDSMR-SEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIG-TKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQND---ADFLLAIQETT 433          
BLAST of GCR136 vs. TrEMBL
Match: A0A193KUE1 (GCR135 OS=Schmidtea mediterranea OX=79327 GN=gcr135 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.503e-42
Identity = 126/425 (29.65%), Postives = 209/425 (49.18%), Query Frame = 1
Query:   49 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLAN---NITAASQVQCPFYNLKTDIMC-INGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVN----VFALATKYPYVSVYYYKFTVILYSFK-DLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDDESSET 1293
            MYSL P +++  SI+ K+   F +   +C L N SY CP  WWY SC+ + N   NI A     CPF      + C  +G WN +    F  CNG  FL+R  I       L P+ ++I+++S FK+  YDE+ ++F W++IIW    K++    G +L  +NS++F+   C+ I    ++ + F         FYLY ++     Q+R IKSAL  I  ++PI+ I + L+ D+        F+C+ +   S +   +V   ++  +  IY+ + I      +N       +YR+EYDI G RKEIS R+I R  Y+LK ++ ++    +V     +  +   Y    V +  F   + +F  +   +V  + ++W N   ++   AL++WY +ID     D   N+E          +ES +T
Sbjct:    1 MYSLRPKNNTMASINDKYRYIFSKFIEECKLNNISYTCPNVWWYNSCIRMTNSDENIDAP----CPFIKSFVALKCNPDGKWNATEIGFFQLCNGAEFLYRIQIEKYFGFILYPIQIIIYLSSIFKISLYDEMLKDFCWRMIIWSLRAKTLKHGIGWLLVLMNSNSFVSAACIPITVIPIFMDLFGQSCHMALFFYLYIMLYRFDVQIRTIKSALFRITIMTPILAITVCLVLDMNKDDYYNYFECQTDIFGSRVVLAFVTSFVAMTIINIYLWIAILKKCKEMN-KEAFFGIYRMEYDIAGTRKEISKREIIRTTYVLKWLLGLSVFETIVYFCSVLHIVLDGYLERPVKFNFFITAIVTFLINNAEMVTMIAIIWFNKHFQTKQNALKQWYIEID----DDKRSNNEELENFLFQDAEESIQT 416          
BLAST of GCR136 vs. Planmine SMEST
Match: SMESG000018582.1 (SMESG000018582.1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 1
Query:   49 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFT 1089
            MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFT
Sbjct:    1 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFT 347          
BLAST of GCR136 vs. Planmine SMEST
Match: SMESG000076933.1 (SMESG000076933.1)

HSP 1 Score: 179.874 bits (455), Expect = 1.145e-51
Identity = 119/411 (28.95%), Postives = 213/411 (51.82%), Query Frame = 1
Query:   49 MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQ--DIDLKKTLDDYGNDEFFAALKVAT 1272
            MY L P  DS E I  KFS F+  +K  CL  ++S  C   W +  C+T +   +  +++ CPF+      +C NG W+   ++++ +C    F +R TI       + P +LLI+ T  + + EY EI ++F W+ ++W+   +S+     I +  +NSS   Y  CML     +  + F   SM     ++YAI+    TQLR+IKS+L H  FI P+++ ++ LI D+  TKG + FQC+  P+ S + ++YV   +  I+    + ++I   L  + +  N    YR+EYDI+G RKE+S R++ R    +K+ + ++  N ++    +  +    +   YK  VI+YS +++   ++   ++W N  L+    A + W    ++++K   +D    +F  A++  T
Sbjct:    1 MYYLTPVDDSMEKIEDKFSPFYNIDKKKCLKLSNS-SCISTWVFQVCLTDSMR-SEDNEILCPFFTTYIQPVCSNGRWDYDDRRVYEDCYTKEFYYRLTIERTFMLLINPFILLIYQTGVYYISEYPEIVKDFNWRFVVWLLKSRSIHLFILISMCFINSSRATYEWCMLFTFLPLTLDLFYHTSMLALFIHVYAIIFNQETQLRVIKSSLKHFCFIMPLLIAIVCLILDIG-TKGHSYFQCQCGPILSRVYYVYVATTLVQILIAFPLYLRIMSKLKTIELENNLRNHYRMEYDILGERKEVSKRELVRCKLSMKVFLLLSIWNFVMYCVMVINRIILPNRLVYKIMVIIYSSRNIADCIMLTILIWFNKGLRQRMAAWDLWNNVLNVEVKTNQND---ADFLLAIQETT 405          
BLAST of GCR136 vs. Planmine SMEST
Match: SMESG000076929.1 (SMESG000076929.1)

HSP 1 Score: 152.91 bits (385), Expect = 1.321e-41
Identity = 121/413 (29.30%), Postives = 201/413 (48.67%), Query Frame = 1
Query:   85 SISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTLAN---NITAASQVQCPFYNLKTDIMC-INGTWNLSPKQLFVNCNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDVTFTKGRT-FQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVN----VFALATKYPYVSVYYYKFTVILYSFK-DLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDDESSET 1293
            SI+ K+   F +   +C L N SY CP  WWY SC+ + N   NI A     CPF      + C  +G WN +    F  CNG  FL+R  I       L P+ ++I+++S FK+  YDE+ ++F W++IIW    K++    G +L  +NS++F+   C+ I    ++ + F         FYLY ++     Q+R IKSAL  I  ++PI+ I + L+ D+        F+C+ +   S +   +V   ++  +  IY+ + I      +N       +YR+EYDI G RKEIS R+I R  Y+LK ++ ++    +V     +  +   Y    V +  F   + +F  +   +V  + ++W N   ++   AL++WY +ID     D   N+E          +ES +T
Sbjct:    3 SINDKYRYIFSKFIEECKLNNISYTCPNVWWYNSCIRMTNSDENIDAP----CPFIKSFVALKCNPDGKWNATEIGFFQLCNGAEFLYRIQIEKYFGFILYPIQIIIYLSSIFKISLYDEMLKDFCWRMIIWSLRAKTLKHGIGWLLVLMNSNSFVSAACIPITVIPIFMDLFGQSCHMALFFYLYIMLYRFDVQIRTIKSALFRITIMTPILAITVCLVLDMNKDDYYNYFECQTDIFGSRVVLAFVTSFVAMTIINIYLWIAILKKCKEMN-KEAFFGIYRMEYDIAGTRKEISKREIIRTTYVLKWLLGLSVFETIVYFCSVLHIVLDGYLERPVKFNFFITAIVTFLINNAEMVTMIAIIWFNKHFQTKQNALKQWYIEID----DDKRSNNEELENFLFQDAEESIQT 406          
BLAST of GCR136 vs. Planmine SMEST
Match: SMESG000076928.1 (SMESG000076928.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.708e-31
Identity = 96/330 (29.09%), Postives = 170/330 (51.52%), Query Frame = 1
Query:  313 CNGNLFLFRNTITNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTITGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYMHTQLRIIKSALNHIMFXXXXXXXXXXXXFDV-TFTKGRTFQCKDEPMSSPIQFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRKEISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVS----VYYY---KFTVILYSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEFFAALKVATDD 1278
            CNG  FL+R  I       L P+ +++ +TS FK+  +DE+ ++F W++IIW    K++    G ++  +NS+  +   C+ +    +  ++F++       FY+Y I+     Q+R IKSAL  +  ++P + I++ L+ D+ T      F+C+ +   S I   Y+ I  +  V + Y+ + I+  ++ +       T YR+EYDI+G RKEIS R+I R+ YIL  ++     N+  ++   +T Y  +S     YY+     T+ +  F +    V  + +VW+N   +    AL  WY +I+ +K L     D F +ALK  TD+
Sbjct:    6 CNGKQFLYRTQIEKYFGFVLYPMQMILLLTSIFKISIFDEMVKDFSWRMIIWSLRAKTIKYTIGWMMVLMNSNYVVSTTCIALSLIPVLADFFSLACQMALFFYVYIILFRFDVQIRTIKSALFRVTVMTPFLAIIVCLVLDLNTDDNYNYFECQTDIFGSRILHAYLTIYFAVTVILFYLWIAISRKINEMRKQVLIGT-YRMEYDIVGARKEISRREIFRVRYILNWLL---AHNVFDSIVLSSTIYQTISETPRTYYFLIMALTLFILIFGE---AVTVLAIVWMNRHFRDRHNALRLWYVEINEEKNLGQEEED-FKSALKETTDE 327          
The following BLAST results are available for this feature:
BLAST of GCR136 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A193KUM80.000e+099.76GCR136 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUM01.441e-4829.19GCR126 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A193KUE17.503e-4229.65GCR135 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
back to top
BLAST of GCR136 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR136 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000018582.10.000e+0100.00SMESG000018582.1[more]
SMESG000076933.11.145e-5128.95SMESG000076933.1[more]
SMESG000076929.11.321e-4129.30SMESG000076929.1[more]
SMESG000076928.11.708e-3129.09SMESG000076928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018290 ID=SMED30018290|Name=GCR136|organism=Schmidtea mediterranea sexual|type=transcript|length=1348bp
TTATTGTATTAAAAAATCTTATCCATTACCCAAATAGACTTTTTTTCTAT
GTATTCATTAATTCCAGATTCTGACAGTGCTGAGTCGATTTCTAAAAAAT
TTTCAATATTCTTCGAACAAGAAAAAGCTGATTGCTTGTTACAAAATGAT
TCATACAAATGTCCAAAAGAATGGTGGTATTTGTCTTGTGTTACACTTGC
CAACAACATCACAGCCGCCTCACAAGTTCAATGTCCATTTTATAATTTAA
AAACCGATATTATGTGCATTAATGGAACATGGAATTTGTCCCCCAAACAG
TTGTTCGTTAATTGCAATGGGAATTTATTTTTGTTTCGAAACACTATTAC
CAATATTGTTTATAAATCTTTATTGCCAGTTTTACTACTAATATTCATGA
CAAGTACTTTCAAATTATACGAATACGACGAAATTAGTCAGGAATTTCAG
TGGAAAATCATCATTTGGATGTTTATATTCAAATCGGTTTCAACCATAAC
CGGAATCGTGTTAGCCTCTCTTAATTCAAGCAATTTTATTTATCATCTTT
GCATGTTGATTGTTACATTTTCAATGTATGGTGAATATTTTACAATTTGT
AGCATGTTCGTCCAATGTTTTTATCTTTATGCCATTGTCAATTATATGCA
CACGCAATTGAGAATTATTAAATCAGCTCTTAACCATATCATGTTCATAA
GCCCGATCATCCTTATTGTGATTGGGTTGATTTTTGACGTCACGTTTACC
AAAGGAAGAACATTTCAGTGCAAAGATGAACCAATGTCATCGCCTATACA
ATTTTTGTACGTGTACATCTGTATTTCTGGTATCGTTTCAATGATATATA
TGCGTGTAAAAATTAACTATTCATTACATTATCTGAATATTTCAACGAAT
CACACTACGGTCTATCGAGTAGAATATGACATAATAGGTAGACGAAAAGA
GATATCACATAGAGATATTCAGCGGTTGTTGTACATTTTAAAAATCATAA
TATGTATAACAGGCATTAATATCTTAGTCAATGTATTCGCTTTGGCAACG
AAATATCCATATGTGTCGGTTTATTATTATAAATTTACAGTTATACTTTA
TTCATTTAAAGACCTGACATTTGTTGTGTTAGCCGTTAAAGTAGTTTGGT
TGAATCCGACTCTGAAAAGTCTAACGACAGCCCTGGAAAGATGGTATCAA
GACATAGATTTGAAAAAAACTTTGGATGATTATGGTAATGATGAATTTTT
TGCTGCACTCAAAGTTGCAACAGATGATGAAAGTTCTGAAACAAGTCTTT
TGAAAAATAAATCAAAATAAATTTATTATTTATTTCGGTAAATAAAAA
back to top

protein sequence of SMED30018290-orf-1

>SMED30018290-orf-1 ID=SMED30018290-orf-1|Name=SMED30018290-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MYSLIPDSDSAESISKKFSIFFEQEKADCLLQNDSYKCPKEWWYLSCVTL
ANNITAASQVQCPFYNLKTDIMCINGTWNLSPKQLFVNCNGNLFLFRNTI
TNIVYKSLLPVLLLIFMTSTFKLYEYDEISQEFQWKIIIWMFIFKSVSTI
TGIVLASLNSSNFIYHLCMLIVTFSMYGEYFTICSMFVQCFYLYAIVNYM
HTQLRIIKSALNHIMFISPIILIVIGLIFDVTFTKGRTFQCKDEPMSSPI
QFLYVYICISGIVSMIYMRVKINYSLHYLNISTNHTTVYRVEYDIIGRRK
EISHRDIQRLLYILKIIICITGINILVNVFALATKYPYVSVYYYKFTVIL
YSFKDLTFVVLAVKVVWLNPTLKSLTTALERWYQDIDLKKTLDDYGNDEF
FAALKVATDDESSETSLLKNKSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 248..270
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 137..156
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 310..332