TNF receptor associated factor-2

Overview
NameTNF receptor associated factor-2
Smed IDSMED30018288
Length (bp)1263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor associated factor-2 (SMED30018288) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30018288) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor associated factor-2 (SMED30018288) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor associated factor-2 (SMED30018288) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018288

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30018288h1SMcG0006147 Contig3103GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018288h1SMcG0019596 Contig3103GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
posterior sideSMED30018288h1SMcG0019596 dd_Smed_v4_5329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30018288h1SMcG0019596 dd_Smed_v4_5329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 58.9214 bits (141), Expect = 8.786e-9
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQD 575
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  LE +L        D  A + I  + VKCP + C    ELR++E H   C+   + CP       + HI +  L+D
Sbjct:   56 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF------PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 58.9214 bits (141), Expect = 8.786e-9
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQD 575
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  LE +L        D  A + I  + VKCP + C    ELR++E H   C+   + CP       + HI +  L+D
Sbjct:   56 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF------PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 51.9878 bits (123), Expect = 6.113e-7
Identity = 37/148 (25.00%), Postives = 63/148 (42.57%), Query Frame = 3
Query:  219 KCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQS--CRFVDELRNIEYHMRVCDARGVS------CPYLIIGCN-ESHIALDRLQDHLATDNYPHTKLLMECIENV 635
            +C IC+  L       CG R+C  C+  ++   N+ CP   K     +L+ + DI  D    + I ++K  CP  S  C  V     +  H+  C  R         CP+  I C+       ++L++HL  D   H +L+++  +  
Sbjct:  103 ECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNK-----RLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQT 245          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 4.639e-9
Identity = 42/133 (31.58%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDH 578
            Y  E +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP   +  LEE+L        D  A + I  + VKC    C    ELR +E H+  C      CP     C ES + +  L +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLF------PDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQ----CQES-VPISHLDEH 178          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 4.639e-9
Identity = 42/133 (31.58%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDH 578
            Y  E +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP   +  LEE+L        D  A + I  + VKC    C    ELR +E H+  C      CP     C ES + +  L +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLF------PDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQ----CQES-VPISHLDEH 178          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 59.3066 bits (142), Expect = 4.639e-9
Identity = 42/133 (31.58%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDH 578
            Y  E +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP   +  LEE+L        D  A + I  + VKC    C    ELR +E H+  C      CP     C ES + +  L +H
Sbjct:   57 YDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNEVLLEEQLF------PDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQ----CQES-VPISHLDEH 178          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 49.6766 bits (117), Expect = 5.299e-6
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCP-EQSCRFVDELRNIEYHMRVCDARGVS 515
            +++  + D+ +DL C ICL+ LI   + PCG  YC  C+  +L + +++CP      + +K       +   + +K + K+ V CP    C  V     +E H+R C  +G S
Sbjct:   32 HEYTYKEDVDDDLMCHICLQPLIRPLDTPCGHTYCQECLTNFL-LESDFCPVDRTPLMLQKCR-----KSSLLVHKLLDKLMVSCPFADHCTEVMPRGEMEGHIR-CRCKGAS 137          
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 49.6766 bits (117), Expect = 5.706e-6
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCP-EQSCRFVDELRNIEYHMRVCDARGVS 515
            +++  + D+ +DL C ICL+ LI   + PCG  YC  C+  +L + +++CP      + +K       +   + +K + K+ V CP    C  V     +E H+R C  +G S
Sbjct:   43 HEYTYKEDVDDDLMCHICLQPLIRPLDTPCGHTYCQECLTNFL-LESDFCPVDRTPLMLQKCR-----KSSLLVHKLLDKLMVSCPFADHCTEVMPRGEMEGHIR-CRCKGAS 148          
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 68.1662 bits (165), Expect = 9.329e-12
Identity = 39/113 (34.51%), Postives = 54/113 (47.79%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  +E +L        D  A + I  ++VKCP Q C    ELR++E H+  CD  GV C
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQLF------PDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVEC 164          
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 58.151 bits (139), Expect = 1.061e-8
Identity = 38/114 (33.33%), Postives = 53/114 (46.49%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCP 521
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  LE +L        D  A + I  + VKCP + C    ELR++E H   C+   V+CP
Sbjct:   56 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF------PDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCP 163          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.898e-11
Identity = 39/113 (34.51%), Postives = 54/113 (47.79%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  +E +L        D  A + I  ++VKCP Q C    ELR++E H+  CD  GV C
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQLF------PDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVEC 164          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.716e-10
Identity = 37/113 (32.74%), Postives = 53/113 (46.90%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K L      CP      ++ ++  +  +  D  A + I  +KVKCP Q C    ELR++E H+  C    V C
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCP------VDNEILMENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQCQFASVEC 164          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.730e-9
Identity = 36/113 (31.86%), Postives = 54/113 (47.79%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K L      CP      ++ ++  +K +  D  A + I  ++VKCP   C    ELR++E+H+  C    V C
Sbjct:   58 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCP------VDNEILMEKQLFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQCQFASVEC 164          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.544e-8
Identity = 42/132 (31.82%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQD 575
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  LE +L        D  A + I  + VKCP + C    ELR++E H   C+   V CP       + HI +  L+D
Sbjct:   56 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF------PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.558e-8
Identity = 42/132 (31.82%), Postives = 59/132 (44.70%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQD 575
            Y  E +  + +  +C ICL  L  A   PCG R+C  CI K +      CP   +  LE +L        D  A + I  + VKCP + C    ELR++E H   C+   V CP       + HI +  L+D
Sbjct:   56 YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLF------PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQCQRPFQKFHINIHILKD 181          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 6.620e-39
Identity = 69/186 (37.10%), Postives = 114/186 (61.29%), Query Frame = 3
Query:  147 TFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKN 704
            T + I  ++  Y FE+E  + ++LKC +C  +L+NA  + CGCR+C  CI +Y+S GN YCP    EC EE L    +I  D   N+ I+K++VKCPE++C+   EL +IE H+R+C  +  +CP+ ++GCN+  + +  L +HL    + H+KL+++ I N+RN+      K  +L ++   +KN
Sbjct:    2 TAEKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKN 187          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.151e-23
Identity = 56/172 (32.56%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  135 MSDKTFDNIWSIMTEYKFE-LEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEV 647
            M     DN+  ++++Y  + ++  ++NDL C++C K++ +A  + CGC YC  CI  YLS  + YCP    EC E+ LN + D+  +   +  IS++ VKCP   C +  EL  ++ H+  C    V CP + IGC E  +  D +  HL      HT+L+M     +++E+
Sbjct:    1 MIPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEI 172          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.673e-19
Identity = 48/113 (42.48%), Postives = 74/113 (65.49%), Query Frame = 3
Query:  369 FDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNE 707
             +++I +D   N  I+K++VKC E+SC +VDELR +E H R C  R V+CPY  IGC++ +I+ D++ DHL ++ + HTKLLM+ + N  NE+E+ +     L   N  L+NE
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNE 124          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.501e-11
Identity = 40/105 (38.10%), Postives = 62/105 (59.05%), Query Frame = 3
Query:  204 ISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            I+++LKCV+C  +L++A    CGCRYC  CI+ YL  G + C ++ ++C     ++      DR  NK IS +KVKC  + C F D L++I+ H+  C+ R   C
Sbjct:   25 INDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVITSY----IYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMC 125          
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Match: A0A5J5DQT8 (Uncharacterized protein (Fragment) OS=Etheostoma spectabile OX=54343 GN=FQN60_011065 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.237e-10
Identity = 42/125 (33.60%), Postives = 61/125 (48.80%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHI 554
            Y  E +  + +  +C ICL  L NA   PCG R+C HCIEK +    + CP   +  LE++L        D  A + I  + V+CP   C    ELR++E H++ C    V CP       +SH+
Sbjct:   66 YDVEFDPPLESKYECPICLMALRNAIQTPCGHRFCKHCIEKSIRDTGQRCPVDNERLLEDQLF------PDNFAKREILSLTVRCPNSGCAEKMELRSLENHLKQCQFATVPCPQCQQSVRKSHL 184          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 53.1434 bits (126), Expect = 3.818e-7
Identity = 46/163 (28.22%), Postives = 70/163 (42.94%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKL 668
            Y  + +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP    E L E   F      D  A + I  + V+C    C    ELR++E H+  C    V CP     C ES +    L++H+  +         +C EN+    + F  +L
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-NEVLTEDQLFP-----DNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQES-VWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQL 207          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 53.1434 bits (126), Expect = 3.818e-7
Identity = 46/163 (28.22%), Postives = 70/163 (42.94%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKL 668
            Y  + +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP    E L E   F      D  A + I  + V+C    C    ELR++E H+  C    V CP     C ES +    L++H+  +         +C EN+    + F  +L
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-NEVLTEDQLFP-----DNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQES-VWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQL 207          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 52.7582 bits (125), Expect = 4.100e-7
Identity = 44/152 (28.95%), Postives = 66/152 (43.42%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENV 635
            Y  + +  + +  +C ICL  L +A   PCG R+C  CI K +    + CP    E L E   F      D  A + I  + V+C    C    ELR++E H+  C    V CP     C ES +    L++H+  +         +C EN+
Sbjct:   56 YDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-NEVLTEDQLFP-----DNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQES-VWKSELEEHINQECSHRLITCPDCAENI 196          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: ENSAMXT00000053226.1 (ring finger protein 135 [Source:NCBI gene;Acc:103038296])

HSP 1 Score: 51.6026 bits (122), Expect = 1.001e-6
Identity = 22/65 (33.85%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  204 ISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRV 398
            ++N+LKC IC ++  +     CG  YCL+CI++YLS G   CP + +  L    N  K++ +  +
Sbjct:   12 VANNLKCSICFELFTDPVTLSCGHNYCLNCIQRYLSRGTRTCP-QCRSKLPHTPNLKKNVALSNI 75          
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Match: ENSAMXT00000031232.1 (ring finger protein 135 [Source:NCBI gene;Acc:103038296])

HSP 1 Score: 51.2174 bits (121), Expect = 1.059e-6
Identity = 22/65 (33.85%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  204 ISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRV 398
            ++N+LKC IC ++  +     CG  YCL+CI++YLS G   CP + +  L    N  K++ +  +
Sbjct:   12 VANNLKCSICFELFTDPVTLSCGHNYCLNCIQRYLSRGTRTCP-QCRSKLPHTPNLKKNVALSNI 75          
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 48.521 bits (114), Expect = 2.192e-6
Identity = 31/126 (24.60%), Postives = 54/126 (42.86%), Query Frame = 3
Query:  147 TFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSV--GNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            + D+  +    Y+ + E  + +  +C ICL  L      PCG R+C  CI   + +      CP      ++  +  +  +  D  A + I  + V+CP + C    ELR ++ H   C+   V C
Sbjct:   40 SGDDSATEAQGYEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCP------VDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC 159          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 56.9954 bits (136), Expect = 6.780e-9
Identity = 36/118 (30.51%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  168 IMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCI-EKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            + + Y  E    ++ +  C IC   L       CG R+C  C+ E         CP        E L+  KD+ +D+ A + I    VKCP + C++  ELR++E H R CD   V+C
Sbjct:    7 VPSGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMD-----REPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTC 119          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 51.9878 bits (123), Expect = 2.510e-7
Identity = 35/113 (30.97%), Postives = 59/113 (52.21%), Query Frame = 3
Query:  210 NDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEY--CPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCN 542
            ++L C IC  ++       CG  YC +CIEK+ + G E   CP   ++    ++  DK  + DR+    +  ++VKC    CR+  ELR  + H+++C  + V C  ++ GCN
Sbjct:   26 DELICAICHMVVNEPVLTSCGHSYCKYCIEKWCN-GKEVVTCPVDNEQLKPSQIFPDK--KTDRI----VLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKC--ILEGCN 129          
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Match: EDO27426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9A1])

HSP 1 Score: 49.2914 bits (116), Expect = 3.861e-7
Identity = 32/111 (28.83%), Postives = 50/111 (45.05%), Query Frame = 3
Query:  168 IMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCI-EKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVC 497
            + + Y  E    ++ +  C IC   L       CG R+C  C+ E         CP        E L+  KD+ +D+ A + I    VKCP + C++  ELR++E  M+ C
Sbjct:    7 VPSGYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMD-----REPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEVSMKGC 112          
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 56.6102 bits (135), Expect = 2.527e-8
Identity = 38/113 (33.63%), Postives = 51/113 (45.13%), Query Frame = 3
Query:  180 YKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSC 518
            Y  E +  + +  +C ICL  L NA    CG R+C  CIEK +    + CP    E L E   F      D  A + I  + V+CP   C    ELR++E H+  C    V C
Sbjct:   64 YDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPVD-NEMLSEDQLFP-----DNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPC 170          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014897.1 (SMESG000014897.1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 319/321 (99.38%), Postives = 319/321 (99.38%), Query Frame = 3
Query:  135 MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVLGWLRQRNTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL 1097
            MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRPSSYSNSNPDSPTMSKSSSFSPKSKSKSGV GWLRQ NTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL
Sbjct:    1 MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRPSSYSNSNPDSPTMSKSSSFSPKSKSKSGVFGWLRQHNTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL 321          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014897.1 (SMESG000014897.1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 307/309 (99.35%), Postives = 307/309 (99.35%), Query Frame = 3
Query:  171 MTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVLGWLRQRNTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL 1097
            MTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRPSSYSNSNPDSPTMSKSSSFSPKSKSKSGV GWLRQ NTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL
Sbjct:    1 MTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIFELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDRPSSYSNSNPDSPTMSKSSSFSPKSKSKSGVFGWLRQHNTNGSPNSSSVFYTDPADNGRASNLSEIDQANHL 309          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000014923.1 (SMESG000014923.1)

HSP 1 Score: 189.504 bits (480), Expect = 3.101e-55
Identity = 88/183 (48.09%), Postives = 120/183 (65.57%), Query Frame = 3
Query:  135 MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEK 683
            MS+  ++NIW I++EY+     +IS+DL CVIC  +L NA N PCGCRYC  CI+ YL    ++CP    EC EE LN D++I +D  AN  IS++ VKCPE SC F DELR I  H+  CD + V CPY  IGC+E  +A +R+ DHL  DNY H K L+ CI+N++NE+ + +    +L+K
Sbjct:    1 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKK 183          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000049649.1 (SMESG000049649.1)

HSP 1 Score: 177.563 bits (449), Expect = 1.029e-52
Identity = 90/193 (46.63%), Postives = 126/193 (65.28%), Query Frame = 3
Query:  150 FDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKK 728
            F N+W +M E KFE +++ISNDL C IC +++I A NAPCGCR+C  CIE+YL+  +++CP + K C  +K+NF  D+  DR+AN  IS+V VKCP Q+C    EL  +E HMR CD R +SCP+  IGC  + IA + ++ HL   NY H+KL+++ I N RNE+E        L+ EN+ L+NE     KK
Sbjct:    2 FTNLWKMMRENKFESDNEISNDLLCRICKRLMIKACNAPCGCRFCSDCIEQYLNETDKFCPGEAKYCQVQKINFTGDVLEDRIANLRISEVIVKCPGQNCETKTELSMMEEHMRTCDKRHISCPFNSIGCEINEIANEEMKTHLNESNYWHSKLIIDLINNFRNEME-------SLKNENMELRNEMSELKKK 187          
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Match: SMESG000001730.1 (SMESG000001730.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.836e-52
Identity = 82/195 (42.05%), Postives = 127/195 (65.13%), Query Frame = 3
Query:  135 MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYCLHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKCPEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLATDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIF 719
            M +  ++ +W +M ++KFE  ++ +N+L C IC  ++INA NAPCGCRYCL CI  YL   + +CP    +C  E LN  ++I +D+  N  ISKV VKCPE  C F DELR I+ H+R+C+ + + CPY  IGC +  + +D + +HL  +   H++LL++CI+N+RN+V+  ++ +A L+ EN +LK   D F
Sbjct:    1 MVNLKYEELWKMMKDHKFEGVNEFNNELICKICQNLMINAHNAPCGCRYCLECITTYLDSSDRFCPGNSVDCKIELLNLHRNIYVDQPINNKISKVTVKCPEIQCEFNDELRYIQNHIRICNFQSIPCPYFDIGCKDHKVPVDAICEHLDCEIEGHSRLLLDCIDNLRNDVDAMKKSIADLKLENSYLKENIDDF 195          
The following BLAST results are available for this feature:
BLAST of TNF receptor associated factor-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF68.786e-931.06TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF68.786e-931.06TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf66.113e-725.00gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf64.639e-931.58TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf64.639e-931.58TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf64.639e-931.58TNF receptor-associated factor 6 [Source:NCBI gene... [more]
lnx15.299e-628.32ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
lnx15.706e-628.32ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf9.329e-1234.51epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf61.061e-833.33TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DL4|TRAF6_XENTR4.898e-1134.51TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q6DJN2|TRF6B_XENLA3.716e-1032.74TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3MV19|TRF6A_XENLA1.730e-931.86TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|B6CJY5|TRAF6_MACMU1.544e-831.82TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|B6CJY4|TRAF6_CERAT1.558e-831.82TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID86.620e-3937.10TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1011.151e-2332.56TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW36.673e-1942.48TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
T1DBK64.501e-1138.10TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5J5DQT82.237e-1033.60Uncharacterized protein (Fragment) OS=Etheostoma s... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf63.818e-728.22TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf63.818e-728.22TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf64.100e-728.95TNF receptor associated factor 6 [Source:NCBI gene... [more]
ENSAMXT00000053226.11.001e-633.85ring finger protein 135 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000031232.11.059e-633.85ring finger protein 135 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf62.192e-624.60TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO412436.780e-930.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483942.510e-730.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274263.861e-728.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf62.527e-833.63TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor associated factor-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014897.10.000e+099.38SMESG000014897.1[more]
SMESG000014897.10.000e+099.35SMESG000014897.1[more]
SMESG000014923.13.101e-5548.09SMESG000014923.1[more]
SMESG000049649.11.029e-5246.63SMESG000049649.1[more]
SMESG000001730.11.836e-5242.05SMESG000001730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018288 ID=SMED30018288|Name=TNF receptor associated factor-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1263bp
CGTTAACATTTGAAATTAATTATTATTTTATTTAACTTTTAATTTATATA
AAATTACATACGAATGTAATGCAGAGTAAAAGTTTTCTAATTTTGAAAAA
TTGATAATTTAAATTTATTCTAAAATTTATAATAATGTCTGATAAAACGT
TTGATAATATTTGGAGTATAATGACTGAATACAAGTTTGAATTGGAACAT
GATATTAGTAATGATTTAAAGTGTGTAATTTGTTTGAAAATGTTGATTAA
TGCAAGTAATGCACCTTGTGGATGTCGATATTGCCTTCATTGTATTGAAA
AATATTTATCCGTTGGAAATGAATATTGTCCGAGTAAAATGAAAGAATGT
TTAGAAGAGAAGCTAAATTTTGATAAAGATATACAAATCGACCGTGTTGC
AAATAAATGTATTTCTAAAGTTAAAGTAAAATGTCCAGAGCAGTCTTGTC
GATTTGTGGATGAACTGCGAAATATTGAATATCACATGCGAGTTTGTGAT
GCTCGTGGTGTCAGTTGCCCGTATTTGATAATAGGATGCAATGAATCGCA
TATTGCATTAGATCGTCTGCAAGATCATTTAGCGACGGATAATTATCCAC
ATACTAAACTGCTAATGGAGTGCATTGAAAACGTTAGAAATGAAGTCGAA
GTCTTTCAACGAAAACTAGCAAAATTAGAAAAAGAAAATATTTTTCTTAA
GAATGAAAATGATATATTTAATAAGAAAATATTTGAATTGGAAGCCAATT
GCGATCAAAACAATAAACAAATGAAAGAAATACTGGATAAATTTATTAAA
ATGGAGGACAACATGAATATAATTGGAATGCTTACTAAACTTCCTAAAAC
TCCCGTGGAAATGAGAAATGAGCATTTCGATCGACCTTCCAGTTATTCCA
ACTCAAATCCAGACTCACCAACAATGAGCAAGTCTTCCTCTTTCTCGCCG
AAGTCGAAATCTAAATCTGGAGTACTCGGATGGCTAAGACAACGGAACAC
CAACGGATCACCTAACAGTTCATCCGTATTTTATACCGATCCCGCCGACA
ACGGACGAGCTTCGAACCTTTCAGAAATTGACCAAGCGAATCATTTATAA
TCATTTGATATGTTAATCCCGTGCTTAGCCATGTTATATTTGCTAATTAG
TTATTAATTTGTTAAATTTCATTAATGCAATGAATGAATGTATTAATTAA
TTAATTAATTATTTATATATTTGAATTATTATTGACTTAGTTTTGCATGT
AAATATTTATCAG
back to top

protein sequence of SMED30018288-orf-1

>SMED30018288-orf-1 ID=SMED30018288-orf-1|Name=SMED30018288-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=322bp
MSDKTFDNIWSIMTEYKFELEHDISNDLKCVICLKMLINASNAPCGCRYC
LHCIEKYLSVGNEYCPSKMKECLEEKLNFDKDIQIDRVANKCISKVKVKC
PEQSCRFVDELRNIEYHMRVCDARGVSCPYLIIGCNESHIALDRLQDHLA
TDNYPHTKLLMECIENVRNEVEVFQRKLAKLEKENIFLKNENDIFNKKIF
ELEANCDQNNKQMKEILDKFIKMEDNMNIIGMLTKLPKTPVEMRNEHFDR
PSSYSNSNPDSPTMSKSSSFSPKSKSKSGVLGWLRQRNTNGSPNSSSVFY
TDPADNGRASNLSEIDQANHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 164..219
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 247..297
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..297
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 11..129
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 5.55129E-6
score: 40.5285
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 22..77
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..130
e-value: 2.9E-15
score: 58.3
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 11..129
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..66
score: 9.273
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 95..166