Phosphatidylinositol-binding clathrin assembly protein

Overview
NamePhosphatidylinositol-binding clathrin assembly protein
Smed IDSMED30018266
Length (bp)2424
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol-binding clathrin assembly protein (SMED30018266) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol-binding clathrin assembly protein (SMED30018266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol-binding clathrin assembly protein (SMED30018266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol-binding clathrin assembly protein (SMED30018266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018266SMESG000020797.1 SmedASXL_014580SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018266SMESG000020797.1 dd_Smed_v4_6650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018266SMESG000020797.1 dd_Smed_v4_6650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30018266SMESG000020797.1 dd_Smed_v6_6650_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30018266SMESG000020797.1 SMED30018266smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30018266SMESG000020797.1 SMESG000004925.1 OX_Smed_1.0.09785ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30018266SMESG000020797.1 dd_Smed_v4_6650_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Match: PICALM (phosphatidylinositol binding clathrin assembly protein [Source:HGNC Symbol;Acc:HGNC:15514])

HSP 1 Score: 340.502 bits (872), Expect = 5.675e-106
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Match: PICALM (phosphatidylinositol binding clathrin assembly protein [Source:HGNC Symbol;Acc:HGNC:15514])

HSP 1 Score: 338.961 bits (868), Expect = 1.268e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Match: PICALM (phosphatidylinositol binding clathrin assembly protein [Source:HGNC Symbol;Acc:HGNC:15514])

HSP 1 Score: 339.732 bits (870), Expect = 1.404e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Match: PICALM (phosphatidylinositol binding clathrin assembly protein [Source:HGNC Symbol;Acc:HGNC:15514])

HSP 1 Score: 339.732 bits (870), Expect = 1.838e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Match: SNAP91 (synaptosome associated protein 91 [Source:HGNC Symbol;Acc:HGNC:14986])

HSP 1 Score: 336.65 bits (862), Expect = 4.170e-105
Identity = 155/290 (53.45%), Postives = 214/290 (73.79%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNK 952
            +GQ+L DR++AA+YS+ GS + R V KATT E+  PKKKHLDYL   TNE NV+IP++A+ L +R   +SWVVV K  +TTHHLM  GNE+F QYLA++NT  +L NF+DK+ S GY+MS +++ YS+Y+NEK+ +YR MAFDF ++K+G  DG++R M  EKL+K++PILQGQID LLEFD    +L N V+N+AF LL+KDLI+L+A YN+G+INL+E +F M    CK++L++YK FL R  +V++F+ VAE  G+ DK  +  L   P  ++ETLE HL  LE  K
Sbjct:    2 SGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNSSWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQMAFDFARVKKGA-DGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFACYNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGI-DKGDIPDLTQAPSSLMETLEQHLNTLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Match: unc-11 (Phosphatidylinositol-binding clathrin assembly protein unc-11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XZI6])

HSP 1 Score: 349.362 bits (895), Expect = 6.523e-112
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Match: unc-11 (Phosphatidylinositol-binding clathrin assembly protein unc-11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XZI6])

HSP 1 Score: 349.362 bits (895), Expect = 4.581e-111
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Match: unc-11 (Phosphatidylinositol-binding clathrin assembly protein unc-11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XZI6])

HSP 1 Score: 349.362 bits (895), Expect = 7.611e-111
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Match: unc-11 (Phosphatidylinositol-binding clathrin assembly protein unc-11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XZI6])

HSP 1 Score: 349.362 bits (895), Expect = 7.649e-111
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Match: unc-11 (Phosphatidylinositol-binding clathrin assembly protein unc-11 [Source:UniProtKB/Swiss-Prot;Acc:Q9XZI6])

HSP 1 Score: 350.132 bits (897), Expect = 1.357e-110
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Match: lap (gene:FBgn0086372 transcript:FBtr0334888)

HSP 1 Score: 357.066 bits (915), Expect = 4.926e-112
Identity = 165/291 (56.70%), Postives = 220/291 (75.60%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
            GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +  GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    5 GQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 294          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Match: lap (gene:FBgn0086372 transcript:FBtr0081572)

HSP 1 Score: 349.747 bits (896), Expect = 6.758e-112
Identity = 165/303 (54.46%), Postives = 221/303 (72.94%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTS-----------SIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
             GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +            +GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    4 AGQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 305          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Match: lap (gene:FBgn0086372 transcript:FBtr0334886)

HSP 1 Score: 357.066 bits (915), Expect = 1.051e-111
Identity = 165/291 (56.70%), Postives = 220/291 (75.60%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
            GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +  GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    5 GQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 294          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Match: lap (gene:FBgn0086372 transcript:FBtr0305153)

HSP 1 Score: 350.132 bits (897), Expect = 1.060e-110
Identity = 165/303 (54.46%), Postives = 221/303 (72.94%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTS-----------SIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
             GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +            +GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    4 AGQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 305          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Match: lap (gene:FBgn0086372 transcript:FBtr0305155)

HSP 1 Score: 349.362 bits (895), Expect = 3.270e-109
Identity = 165/302 (54.64%), Postives = 221/302 (73.18%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTS-----------SIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
            GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +            +GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    5 GQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 305          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Match: si:ch211-200p22.4 (si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104-61])

HSP 1 Score: 339.732 bits (870), Expect = 4.777e-110
Identity = 158/289 (54.67%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT E+S PKKKHLDYL +CTN+VNV+IP LA+ L +RT   SWVVV K  ITTHHLM +GNE+F QYLA+++T  +L NFVDK +  GY+MS Y++ YS+Y+ E++ +YRL+A DF K+KRG  DG++R M  EKLMKTLPI Q Q+D LL+F+A+  +L N V+N AFTLL+KD IR++A+YNEG+INL+E YF+M    CKE+L++YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  K
Sbjct:    2 SGQSITDRIAAAQHSMTGSAISKAVCKATTHEVSAPKKKHLDYLMHCTNDVNVNIPHLADTLFERTANQSWVVVFKALITTHHLMMYGNERFIQYLASRSTLFNLNNFVDKGALQGYDMSIYIRRYSRYLTERALSYRLVAADFTKMKRG-TDGVMRTMSIEKLMKTLPITQNQLDALLDFEASSTELTNGVINCAFTLLFKDSIRIFAAYNEGVINLLEKYFNMKKNQCKEALEIYKRFLVRMTKLSEFLKVAEQVGIDQVDIPDLSQAPSSLLEALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Match: picalmb (phosphatidylinositol binding clathrin assembly protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6795])

HSP 1 Score: 340.502 bits (872), Expect = 4.917e-109
Identity = 156/290 (53.79%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL +CTNE+NV+IP+LA+ L +RT   SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+ D+  +  L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIHCTNEMNVNIPQLADSLFERTTNTSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGV-DGVMRTMNTEKLLKTIPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDSIRLFAAYNEGIINLLEKYFDMKKVQCKEGLDIYKKFLTRMTRISEFLKVAEQVGI-DRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Match: si:ch211-200p22.4 (si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104-61])

HSP 1 Score: 342.428 bits (877), Expect = 1.601e-107
Identity = 158/290 (54.48%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT E+S PKKKHLDYL +CTNE+NV++P+LA+ L +RT  +SWVVV K  ITTHHLM +GNE+F QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRIAAAQHSMTGSAISKAVCKATTHEVSGPKKKHLDYLIHCTNEMNVNVPQLADTLFERTTNSSWVVVFKALITTHHLMMYGNERFIQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKALSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINAAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLTQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Match: picalma (phosphatidylinositol binding clathrin assembly protein a [Source:ZFIN;Acc:ZDB-GENE-040426-761])

HSP 1 Score: 339.347 bits (869), Expect = 1.990e-107
Identity = 153/289 (52.94%), Postives = 213/289 (73.70%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++ + GS + + V KATT E+  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT   SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHIVTGSAVSKTVCKATTHEVMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNTSWVVVFKSLITTHHLMVYGNERFVQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTIPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKAQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Match: si:ch211-200p22.4 (si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104-61])

HSP 1 Score: 343.199 bits (879), Expect = 3.113e-107
Identity = 158/290 (54.48%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT E+S PKKKHLDYL +CTNE+NV++P+LA+ L +RT  +SWVVV K  ITTHHLM +GNE+F QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRIAAAQHSMTGSAISKAVCKATTHEVSGPKKKHLDYLIHCTNEMNVNVPQLADTLFERTTNSSWVVVFKALITTHHLMMYGNERFIQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKALSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINAAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLTQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Match: fktn (fukutin [Source:Xenbase;Acc:XB-GENE-971788])

HSP 1 Score: 340.887 bits (873), Expect = 1.151e-106
Identity = 155/289 (53.63%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRG-TDGVMRTMSTEKLLKTMPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Match: fktn (fukutin [Source:Xenbase;Acc:XB-GENE-971788])

HSP 1 Score: 340.887 bits (873), Expect = 2.079e-106
Identity = 155/289 (53.63%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGT-DGVMRTMSTEKLLKTMPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Match: fktn (fukutin [Source:Xenbase;Acc:XB-GENE-971788])

HSP 1 Score: 339.732 bits (870), Expect = 6.841e-106
Identity = 155/289 (53.63%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGT-DGVMRTMSTEKLLKTMPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Match: fktn (fukutin [Source:Xenbase;Acc:XB-GENE-971788])

HSP 1 Score: 339.347 bits (869), Expect = 7.381e-106
Identity = 155/289 (53.63%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRG-TDGVMRTMSTEKLLKTMPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Match: fktn (fukutin [Source:Xenbase;Acc:XB-GENE-971788])

HSP 1 Score: 339.732 bits (870), Expect = 1.167e-105
Identity = 155/289 (53.63%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADTLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGT-DGVMRTMSTEKLLKTMPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Match: Picalm (phosphatidylinositol binding clathrin assembly protein [Source:MGI Symbol;Acc:MGI:2385902])

HSP 1 Score: 339.347 bits (869), Expect = 3.480e-106
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Match: Picalm (phosphatidylinositol binding clathrin assembly protein [Source:MGI Symbol;Acc:MGI:2385902])

HSP 1 Score: 339.347 bits (869), Expect = 5.590e-106
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Match: Picalm (phosphatidylinositol binding clathrin assembly protein [Source:MGI Symbol;Acc:MGI:2385902])

HSP 1 Score: 338.961 bits (868), Expect = 8.347e-106
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Match: Picalm (phosphatidylinositol binding clathrin assembly protein [Source:MGI Symbol;Acc:MGI:2385902])

HSP 1 Score: 339.732 bits (870), Expect = 1.283e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Match: Picalm (phosphatidylinositol binding clathrin assembly protein [Source:MGI Symbol;Acc:MGI:2385902])

HSP 1 Score: 339.347 bits (869), Expect = 1.574e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Match: sp|Q9VI75|PICAL_DROME (Phosphatidylinositol-binding clathrin assembly protein LAP OS=Drosophila melanogaster OX=7227 GN=lap PE=1 SV=3)

HSP 1 Score: 349.747 bits (896), Expect = 6.774e-111
Identity = 165/303 (54.46%), Postives = 221/303 (72.94%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTS-----------SIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTS 958
             GQ++ DR+ AA++SLAG GL + V KATTEE   PKKKHLDYL +CTNE NVSIP LA  LI+R+Q A+WVVV K+ ITTHHLM +GNE+F QYLA+ N++ +L +F+DK +            +GY+MS +++ Y+KY+NEKS +YR MAFDFCK+KRG+++G LR M +EKL+KTLP+LQ Q+D LLEFD    DL N V+N +F LL++DLIRL+A YN+G+INL+E YF MN K  +++LD+YK FL R ++V +F+ VAE  G+ DK  +  L   P  +L+ LE HLA LE  K S
Sbjct:    4 AGQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGI-DKGDIPDLTKAPSSLLDALEQHLATLEGRKVS 305          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Match: sp|Q9XZI6|PICAL_CAEEL (Phosphatidylinositol-binding clathrin assembly protein unc-11 OS=Caenorhabditis elegans OX=6239 GN=unc-11 PE=1 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.726e-109
Identity = 163/289 (56.40%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   89 GQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIG-YEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            GQ++ DR++AAK+SLAGS LG+ + KATTEE+  PKKKHLDYL +CTNE NVSIP +A  LI+RTQ  +W VV K  IT H++M +GNE+FSQYLA+ NT+ +L  FVDK    G Y+MS +V+ Y+KYI EK +TYR+ AFDFCK+KRGR+DG+LR M ++KL+KT+PILQ QID LLEF  T  +L N V+N +F LL++DLIRL+A YN+G+IN++E YF MN K C+++LD YK+FL R +KV +F+ VAE  G+       L   P  +LE LE HL +LE  K
Sbjct:   18 GQTISDRLTAAKHSLAGSQLGKTICKATTEEVMAPKKKHLDYLLHCTNEPNVSIPSMANLLIERTQNPNWTVVYKALITIHNIMCYGNERFSQYLASCNTTFNLTAFVDKVGGAGGYDMSTHVRRYAKYIGEKINTYRMCAFDFCKVKRGREDGLLRTMHTDKLLKTIPILQNQIDALLEFSVTTSELNNGVINCSFILLFRDLIRLFACYNDGIINVLEKYFDMNKKQCRDALDTYKSFLTRLDKVAEFLRVAESVGIDRGEIPDLTRAPASLLEALEAHLIHLEGGK 306          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Match: sp|O55012|PICAL_RAT (Phosphatidylinositol-binding clathrin assembly protein OS=Rattus norvegicus OX=10116 GN=Picalm PE=1 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 5.312e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Match: sp|Q13492|PICAL_HUMAN (Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM PE=1 SV=2)

HSP 1 Score: 339.732 bits (870), Expect = 8.829e-105
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Match: sp|Q7M6Y3|PICAL_MOUSE (Phosphatidylinositol-binding clathrin assembly protein OS=Mus musculus OX=10090 GN=Picalm PE=1 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 1.249e-104
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQSL DR++AA++S+ GS + + V KATT EI  PKKKHLDYL  CTNE+NV+IP+LA+ L +RT  +SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +L+ LE HLA+LE  K
Sbjct:    2 SGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGA-DGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Match: A0A4S2LQS7 (ENTH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007004 PE=4 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 4.965e-142
Identity = 205/313 (65.50%), Postives = 252/313 (80.51%), Query Frame = 2
Query:   38 TLKMASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDEV 976
            T K ASKVVKQLAG+GTGQSL+DR++ AKYSLAGSGLG+ V KATTEEI  PKKKH+DYL NC+NE NVSIP LA  L++RTQ+ SWV+V K  ITTH+LMNFGNEKFS YLA+ N  ++LPNF DK+S+  YEMS +++ YS+YI+EK S+YR MAFDFCK+KRGRDDG+LR MP EKL+K LP+L  Q+ +LLEFDA +KDL N ++N+AF LLYKDLIRL+ASYNEGM+NLIE YFS+  K C+  LD+Y AF +   K+T+F++VAE  G+GDK SLGLQ VPPKV++ +E HLA LE  K S D DE 
Sbjct:    2 TTKAASKVVKQLAGSGTGQSLMDRVTQAKYSLAGSGLGKVVAKATTEEIGAPKKKHIDYLVNCSNEPNVSIPLLAGLLVERTQEKSWVIVFKALITTHNLMNFGNEKFSHYLASNNCPMNLPNFNDKSSAQSYEMSLFIRRYSRYISEKISSYRAMAFDFCKVKRGRDDGVLRTMPVEKLLKALPVLSEQLGVLLEFDALEKDLNNAIINAAFLLLYKDLIRLFASYNEGMMNLIEKYFSLRRKQCRAGLDLYHAFPDLQAKLTEFLSVAESLGIGDKDSLGLQPVPPKVIQAMEQHLAILESKKGSDDEDEA 314          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Match: A0A4S2LIF7 (ENTH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007004 PE=4 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 6.619e-142
Identity = 205/313 (65.50%), Postives = 252/313 (80.51%), Query Frame = 2
Query:   38 TLKMASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDEV 976
            T K ASKVVKQLAG+GTGQSL+DR++ AKYSLAGSGLG+ V KATTEEI  PKKKH+DYL NC+NE NVSIP LA  L++RTQ+ SWV+V K  ITTH+LMNFGNEKFS YLA+ N  ++LPNF DK+S+  YEMS +++ YS+YI+EK S+YR MAFDFCK+KRGRDDG+LR MP EKL+K LP+L  Q+ +LLEFDA +KDL N ++N+AF LLYKDLIRL+ASYNEGM+NLIE YFS+  K C+  LD+Y AF +   K+T+F++VAE  G+GDK SLGLQ VPPKV++ +E HLA LE  K S D DE 
Sbjct:    2 TTKAASKVVKQLAGSGTGQSLMDRVTQAKYSLAGSGLGKVVAKATTEEIGAPKKKHIDYLVNCSNEPNVSIPLLAGLLVERTQEKSWVIVFKALITTHNLMNFGNEKFSHYLASNNCPMNLPNFNDKSSAQSYEMSLFIRRYSRYISEKISSYRAMAFDFCKVKRGRDDGVLRTMPVEKLLKALPVLSEQLGVLLEFDALEKDLNNAIINAAFLLLYKDLIRLFASYNEGMMNLIEKYFSLRRKQCRAGLDLYHAFPDLQAKLTEFLSVAESLGIGDKDSLGLQPVPPKVIQAMEQHLAILESKKGSDDEDEA 314          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Match: A0A3Q0KRJ1 (Putative phosphatidylinositol-binding clathrin assembly protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 4.517e-138
Identity = 202/310 (65.16%), Postives = 247/310 (79.68%), Query Frame = 2
Query:   44 KMASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDE 973
            K ASKVVKQLAG+GTGQSL+DR++ AKYSLAGSGLG+ V KATTEEI  PKKKHLDYL NC+NE NVSIP LA  L++RTQ+ SWV+V K  ITTH+LMNFGNEKFS YLA+ N  + LP+F DKTSS  YEMS +++ YSKY++EK ++YR MAFDFCK+KRGRDDG+LR MP +KL+K LP++Q QI  LLEFDA +KDL N ++N+AF LLYKDLIRL+ASYNEGMINLIE YF++  + C+  LD+Y AF     K+T+F+T+AE  G+GDK SLGLQ VP KV++ +E HL  LE  K S D DE
Sbjct:    4 KAASKVVKQLAGSGTGQSLMDRVTQAKYSLAGSGLGKVVAKATTEEIGAPKKKHLDYLVNCSNEPNVSIPLLAGLLVERTQEKSWVIVFKALITTHNLMNFGNEKFSHYLASNNCPIDLPHFNDKTSSQSYEMSIFIRKYSKYLSEKIASYRAMAFDFCKVKRGRDDGVLRTMPVDKLLKALPVMQSQILTLLEFDALEKDLNNAIINAAFLLLYKDLIRLFASYNEGMINLIEKYFTLKRRQCRLGLDLYHAFPGLLSKLTEFLTLAESLGIGDKDSLGLQPVPEKVIQAMEQHLQILESKKGSDDEDE 313          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Match: G4VLB8 (Putative phosphatidylinositol-binding clathrin assembly protein OS=Schistosoma mansoni OX=6183 GN=Smp_162260 PE=4 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 4.989e-137
Identity = 202/310 (65.16%), Postives = 247/310 (79.68%), Query Frame = 2
Query:   44 KMASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDE 973
            K ASKVVKQLAG+GTGQSL+DR++ AKYSLAGSGLG+ V KATTEEI  PKKKHLDYL NC+NE NVSIP LA  L++RTQ+ SWV+V K  ITTH+LMNFGNEKFS YLA+ N  + LP+F DKTSS  YEMS +++ YSKY++EK ++YR MAFDFCK+KRGRDDG+LR MP +KL+K LP++Q QI  LLEFDA +KDL N ++N+AF LLYKDLIRL+ASYNEGMINLIE YF++  + C+  LD+Y AF     K+T+F+T+AE  G+GDK SLGLQ VP KV++ +E HL  LE  K S D DE
Sbjct:    4 KAASKVVKQLAGSGTGQSLMDRVTQAKYSLAGSGLGKVVAKATTEEIGAPKKKHLDYLVNCSNEPNVSIPLLAGLLVERTQEKSWVIVFKALITTHNLMNFGNEKFSHYLASNNCPIDLPHFNDKTSSQSYEMSIFIRKYSKYLSEKIASYRAMAFDFCKVKRGRDDGVLRTMPVDKLLKALPVMQSQILTLLEFDALEKDLNNAIINAAFLLLYKDLIRLFASYNEGMINLIEKYFTLKRRQCRLGLDLYHAFPGLLSKLTEFLTLAESLGIGDKDSLGLQPVPEKVIQAMEQHLQILESKKGSDDEDE 313          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Match: A0A183QJ83 (ENTH domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 2.514e-134
Identity = 205/352 (58.24%), Postives = 258/352 (73.30%), Query Frame = 2
Query:   44 KMASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLT----------NCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDE---VKVPASTPASLTIKINKPETTQYTKKSNQ 1060
            K ASKVVKQLAG+GTGQSL+DR++ AKYSLAGSGLG+ V KATTEEI  PKKKH+DYL           NC+NE NVSIP LA  L++RTQ+ SWV+V K  ITTH+LMNFGNEKFS YLA+ N  + LP+F DKTSS  YEMS +++ YSKY++EK ++YR MAFDFCK+KRGRDDG+LR MP +KL+K LP++Q QI  LLEFDA +KDL N ++N+AF LLYKDLIRL+ASYNEGMINLIE YF++  + C+  LD+Y AF     K+T+F+T+AE  G+GDK SLGLQ VP KV++ +E HL  LE  K S D +E        + P   T+ +  P  T    ++N+
Sbjct:    4 KAASKVVKQLAGSGTGQSLMDRVTQAKYSLAGSGLGKVVAKATTEEIGAPKKKHIDYLXXXXXXXXXXXNCSNEPNVSIPLLAGLLVERTQEKSWVIVFKALITTHNLMNFGNEKFSHYLASNNCPIDLPHFNDKTSSQSYEMSIFIRKYSKYLSEKIASYRAMAFDFCKVKRGRDDGVLRTMPVDKLLKALPVMQSQILTLLEFDALEKDLNNAIINAAFLLLYKDLIRLFASYNEGMINLIEKYFTLKRRQCRLGLDLYHAFPGLLSKLTEFLTLAESLGIGDKDSLGLQPVPEKVIQAMEQHLQILESKKGSDDEEEETHTSTKPNVPKKPTVPVPIPSQTVICTEANK 355          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein-like [Source:NCBI gene;Acc:103037856])

HSP 1 Score: 343.584 bits (880), Expect = 2.056e-108
Identity = 161/300 (53.67%), Postives = 224/300 (74.67%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK----TSLDSDE 973
            +GQS+ DR++AA++S+ GS + + V KATT E+S PKKKHLDYL +CTNE++VSIP LA+ LI+RT   SWVVV KT ITTHHLM +GNE+F QYLA+++T  +L NF+DK +  GY+MS Y++ YS+Y+NE++ +YRL+A DF K+KRG  DG++R M +EKLMKTLPI+Q Q+D LL+F+A+  +L N V+N AF LL+KD IR++A+YNEG+INL+E YF M    CKE+L++YK FL R  K+++F+ VAE  G+       L   P  +L+ LE HLA+LE  K    +S++ DE
Sbjct:    2 SGQSITDRIAAAQHSMTGSAISKAVCKATTHEVSAPKKKHLDYLMHCTNELSVSIPHLADTLIERTANQSWVVVFKTLITTHHLMMYGNERFIQYLASRSTLFNLNNFIDKGALQGYDMSTYIRRYSRYLNERAMSYRLVAVDFTKMKRGI-DGVMRTMSTEKLMKTLPIIQNQLDALLDFEASSNELTNGVINGAFMLLFKDSIRIFAAYNEGVINLLEKYFDMKKHQCKEALEIYKRFLTRMTKLSEFLKVAEQVGIDQVDIPDLSQAPSSLLQALEQHLASLEGKKIKELSSVNRDE 300          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein-like [Source:NCBI gene;Acc:103037856])

HSP 1 Score: 343.199 bits (879), Expect = 4.169e-108
Identity = 161/300 (53.67%), Postives = 224/300 (74.67%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK----TSLDSDE 973
            +GQS+ DR++AA++S+ GS + + V KATT E+S PKKKHLDYL +CTNE++VSIP LA+ LI+RT   SWVVV KT ITTHHLM +GNE+F QYLA+++T  +L NF+DK +  GY+MS Y++ YS+Y+NE++ +YRL+A DF K+KRG  DG++R M +EKLMKTLPI+Q Q+D LL+F+A+  +L N V+N AF LL+KD IR++A+YNEG+INL+E YF M    CKE+L++YK FL R  K+++F+ VAE  G+       L   P  +L+ LE HLA+LE  K    +S++ DE
Sbjct:    2 SGQSITDRIAAAQHSMTGSAISKAVCKATTHEVSAPKKKHLDYLMHCTNELSVSIPHLADTLIERTANQSWVVVFKTLITTHHLMMYGNERFIQYLASRSTLFNLNNFIDKGALQGYDMSTYIRRYSRYLNERAMSYRLVAVDFTKMKRGI-DGVMRTMSTEKLMKTLPIIQNQLDALLDFEASSNELTNGVINGAFMLLFKDSIRIFAAYNEGVINLLEKYFDMKKHQCKEALEIYKRFLTRMTKLSEFLKVAEQVGIDQVDIPDLSQAPSSLLQALEQHLASLEGKKIKELSSVNRDE 300          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein-like [Source:NCBI gene;Acc:103029285])

HSP 1 Score: 340.887 bits (873), Expect = 1.788e-106
Identity = 162/297 (54.55%), Postives = 220/297 (74.07%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGV--GDKASL-----GLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR+ AA+YSL GS + + + KATT E+S PKKKHLDYL +CTNE+NV++P+LA+ L +RT  +SWVVV K  ITTHHLM +GNE+F QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+  GD   L     G    P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRIVAAQYSLTGSAISKAISKATTHEVSGPKKKHLDYLIHCTNEMNVNVPQLADTLFERTASSSWVVVFKALITTHHLMMYGNERFIQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKALSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINAAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLTQTTRGSYIAPSSLLEALEQHLASLEGKKT 297          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein-like [Source:NCBI gene;Acc:103029285])

HSP 1 Score: 341.658 bits (875), Expect = 1.911e-106
Identity = 159/290 (54.83%), Postives = 217/290 (74.83%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR+ AA+YSL GS + + + KATT E+S PKKKHLDYL +CTNE+NV++P+LA+ L +RT  +SWVVV K  ITTHHLM +GNE+F QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRIVAAQYSLTGSAISKAISKATTHEVSGPKKKHLDYLIHCTNEMNVNVPQLADTLFERTASSSWVVVFKALITTHHLMMYGNERFIQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKALSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINAAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLTQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein-like [Source:NCBI gene;Acc:103029285])

HSP 1 Score: 340.887 bits (873), Expect = 4.055e-106
Identity = 162/297 (54.55%), Postives = 220/297 (74.07%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGV--GDKASL-----GLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR+ AA+YSL GS + + + KATT E+S PKKKHLDYL +CTNE+NV++P+LA+ L +RT  +SWVVV K  ITTHHLM +GNE+F QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+  GD   L     G    P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRIVAAQYSLTGSAISKAISKATTHEVSGPKKKHLDYLIHCTNEMNVNVPQLADTLFERTASSSWVVVFKALITTHHLMMYGNERFIQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKALSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINAAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLTQTTRGSYIAPSSLLEALEQHLASLEGKKT 297          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Sea Lamprey
Match: picalmb (phosphatidylinositol binding clathrin assembly protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6795])

HSP 1 Score: 357.836 bits (917), Expect = 9.094e-117
Identity = 171/318 (53.77%), Postives = 233/318 (73.27%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNKTSLDSDEVKVPASTPASLTIKINKPETT 1036
            +GQS+ DR++AA++S+ GS + + V KATT E+  PKKKHLDYLT CTNE+NVSIP+LA+ L +R   +SWVVV K  +TTHHLM +GNE+F QYLA++NT  +L N+VDK+   GY+MS +++ YSKY+NEK+ +YR MAFDF +IKRG  +G++R M +EKL+KTLPI+Q Q+D LL+F+ T  DL N V+NSAF LL+KDLIRL+A YN+G+INL+E YF MN K+CKE+LD+YK FL R  +V++F+ VAE  G+ DK  +  L   P  +L+ LE HLA+LE  KT    D     +S   SL+  ++   TT
Sbjct:    2 SGQSITDRIAAAQHSVTGSAVAKAVCKATTHEVMGPKKKHLDYLTACTNEINVSIPQLADTLFERAVNSSWVVVFKALVTTHHLMCYGNERFIQYLASRNTLFNLANYVDKSGVQGYDMSTFIRRYSKYLNEKAYSYRQMAFDFTRIKRGV-EGVMRTMNTEKLLKTLPIVQSQLDALLDFEVTPNDLTNGVINSAFMLLFKDLIRLFACYNDGIINLLEKYFEMNKKNCKEALDLYKKFLTRMTRVSEFLKVAECVGI-DKGDIPDLTQAPSSLLDALEQHLASLEGKKT---KDVPMTASSRSTSLSTAVSALSTT 314          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006622.1 (pep scaffold:Pmarinus_7.0:GL476457:519972:582649:1 gene:ENSPMAG00000005949.1 transcript:ENSPMAT00000006622.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.46 bits (537), Expect = 1.454e-58
Identity = 98/200 (49.00%), Postives = 145/200 (72.50%), Query Frame = 2
Query:  356 KFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASL-GLQAVPPKVLETLENHLANLEKNK 952
            +F QYLA++NT  +L NF+DK+   GY+MS +V+ YSKY+NEK+ +YR MAFDF ++KRG ++G++R M  EKL+K LP+LQGQ+D LL+FDA+  DL N V+N+AF+LL+KD+IRL+A YN+G+INL+E +F +     K++L++YK FL R  +V +F  +AE  G+ DK  +  +   P  +LE +E H+A  E  K
Sbjct:    1 RFIQYLASRNTLFNLSNFLDKSGVQGYDMSTFVRRYSKYLNEKAYSYRQMAFDFTRVKRG-NEGLMRSMNVEKLLKALPVLQGQVDALLDFDASPSDLSNGVINAAFSLLFKDMIRLFACYNDGVINLLEKFFELKKTQSKDALELYKKFLTRMTRVAEFFKIAEQIGI-DKGDIPDIAQAPSSLLEAMEQHVAIQEAKK 198          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Yeast
Match: YAP1802 (Protein of the AP180 family, involved in clathrin cage assembly; binds Pan1p and clathrin; YAP1802 has a paralog, YAP1801, that arose from the whole genome duplication [Source:SGD;Acc:S000003473])

HSP 1 Score: 95.1301 bits (235), Expect = 8.895e-21
Identity = 67/263 (25.48%), Postives = 133/263 (50.57%), Query Frame = 2
Query:  158 VIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFD-----FCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHL 931
            V  AT  +++PPK+K++D + + T+     + E+   L  R    +W +V K  I  H ++  G +  +    + N  +     +  T+       + ++ Y +Y+  +   Y  +  D     +  +K G  +    ++  ++ +  +  L+ QI+ L+    +  DL N +L  AF LL +DL+ LY + NEG+I L+E +F ++ +  K +LD+YK F++ TE V +++ +  G  VG K  + ++ +  K++ +LE HL
Sbjct:    9 VKGATKIKMAPPKQKYVDPILSGTSSAR-GLQEITHALDIRLSDTAWTIVYKALIVLHLMIQQGEKDVTLRHYSHNLDVFQLRKISHTTKWSSNDMRALQRYDEYLKTRCEEYGRLGMDHLRDNYSSLKLGSKN----QLSMDEELDHVESLEIQINALIRNKYSVSDLENHLLLYAFQLLVQDLLGLYNALNEGVITLLESFFELSIEHAKRTLDLYKDFVDMTEYVVRYLKI--GKAVGLKIPV-IKHITTKLINSLEEHL 263          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Yeast
Match: YAP1801 (Protein of the AP180 family, involved in clathrin cage assembly; binds Pan1p and clathrin; YAP1801 has a paralog, YAP1802, that arose from the whole genome duplication [Source:SGD;Acc:S000001204])

HSP 1 Score: 93.2041 bits (230), Expect = 3.939e-20
Identity = 72/276 (26.09%), Postives = 137/276 (49.64%), Query Frame = 2
Query:  158 VIKATTEEISPPKKKHLD-YLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSL-SLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFC-------KIKRGRDDGILRRMPSEKL-MKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            V  AT  + +PPK+K+LD  L   +NE +    E+ + L  R    +W +V K+ +  H ++  G++  +    ++N     + N      S   +M + +  Y  Y+  +   +  +  D+        K+  G       +  S  + +  +  L+ QI  L++   TQ DL N ++   F LL +DL+ LY + NEG+I L+E +F ++H + + +LD+YK F++ TE V +++   + AG+       ++ +  K++ +LE HL  +E +KT
Sbjct:    8 VKGATKIKSAPPKQKYLDPILLGTSNEEDFY--EIVKGLDSRINDTAWTIVYKSLLVVHLMIREGSKDVALRYYSRNLEFFDIENIRGSNGSASGDM-RALDRYDNYLKVRCREFGKIKKDYVRDGYRTLKLNSGNYGSSRNKQHSINIALDHVESLEVQIQALIKNKYTQYDLSNELIIFGFKLLIQDLLALYNALNEGIITLLESFFELSHHNAERTLDLYKTFVDLTEHVVRYLKSGKTAGLKIPV---IKHITTKLVRSLEEHL--IEDDKT 275          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Nematostella
Match: EDO33508 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS13])

HSP 1 Score: 213.772 bits (543), Expect = 1.919e-64
Identity = 98/201 (48.76%), Postives = 138/201 (68.66%), Query Frame = 2
Query:  356 KFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTS 958
            +F QY+A++ TS +L  F+DK+   GY+MS +V+ Y+ Y+NEK+ +YR M +DFC+ KRG++DG+LR M S KL+K LP+LQ Q D LLE D    +L N V+N AF LL+KDLIRL+A YN+G+INL+E YF M  K CK +LD+YK F+ R ++V++F+  AE  G   +    L   P  +L+ LENH   LEK K +
Sbjct:    2 RFIQYMASRTTSFTLQGFLDKSGVQGYDMSTFVRRYANYLNEKAWSYREMGYDFCRCKRGKEDGVLRAMDSTKLLKALPVLQKQTDALLEVDIKSTELSNGVINCAFVLLFKDLIRLFACYNDGVINLLEKYFDMPKKECKAALDIYKRFVTRMDRVSEFMKTAEDVGFDKEDIPDLSKAPNSLLDALENHYQALEKGKAT 202          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Nematostella
Match: EDO33509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS14])

HSP 1 Score: 107.842 bits (268), Expect = 6.103e-28
Identity = 47/87 (54.02%), Postives = 63/87 (72.41%), Query Frame = 2
Query:   95 SLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNE 355
            S+VD++ AA++S+ GS L +   KAT+ E+  PK+KH+DYL  CTN  NVSIP LAE L +R   +SWVVV K+  T HHLM++GNE
Sbjct:    2 SVVDKLDAARHSITGSNLAKIACKATSREVMGPKRKHVDYLIQCTNTDNVSIPNLAEILFERCTNSSWVVVFKSLCTFHHLMSYGNE 88          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein [Source:NCBI gene;Acc:101164596])

HSP 1 Score: 343.969 bits (881), Expect = 2.439e-108
Identity = 160/290 (55.17%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT EIS PKKKHLDYL +CTNE+NV+IP+LA+ L +RT  +SWVVV K  I THHLM +GNE+F+QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+NSAF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRITAAQHSMTGSAISKAVCKATTHEISGPKKKHLDYLIHCTNEMNVNIPQLADTLFERTANSSWVVVFKALIATHHLMMYGNERFTQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKAMSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINSAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLSQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein [Source:NCBI gene;Acc:101164596])

HSP 1 Score: 344.354 bits (882), Expect = 9.250e-108
Identity = 160/290 (55.17%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT EIS PKKKHLDYL +CTNE+NV+IP+LA+ L +RT  +SWVVV K  I THHLM +GNE+F+QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+NSAF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRITAAQHSMTGSAISKAVCKATTHEISGPKKKHLDYLIHCTNEMNVNIPQLADTLFERTANSSWVVVFKALIATHHLMMYGNERFTQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKAMSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINSAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLSQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein [Source:NCBI gene;Acc:101164596])

HSP 1 Score: 343.969 bits (881), Expect = 1.015e-107
Identity = 160/290 (55.17%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT EIS PKKKHLDYL +CTNE+NV+IP+LA+ L +RT  +SWVVV K  I THHLM +GNE+F+QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+NSAF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRITAAQHSMTGSAISKAVCKATTHEISGPKKKHLDYLIHCTNEMNVNIPQLADTLFERTANSSWVVVFKALIATHHLMMYGNERFTQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKAMSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINSAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLSQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Match: si:ch211-200p22.4 (phosphatidylinositol-binding clathrin assembly protein [Source:NCBI gene;Acc:101164596])

HSP 1 Score: 343.969 bits (881), Expect = 2.693e-107
Identity = 160/290 (55.17%), Postives = 218/290 (75.17%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKT 955
            +GQS+ DR++AA++S+ GS + + V KATT EIS PKKKHLDYL +CTNE+NV+IP+LA+ L +RT  +SWVVV K  I THHLM +GNE+F+QYLA++NT  +L NF+DK +  GY+MS +++ YS+Y+NEK+ +YRL+A DF K+KRG  DG++R M +EKL+KTLPI+Q Q+D LL+F A   +L N V+NSAF LL+KD IRL+A+YNEG+INL+E YF M    CK++LD+YK FL R  K+++F+ VAE  G+       L   P  +LE LE HLA+LE  KT
Sbjct:    2 SGQSITDRITAAQHSMTGSAISKAVCKATTHEISGPKKKHLDYLIHCTNEMNVNIPQLADTLFERTANSSWVVVFKALIATHHLMMYGNERFTQYLASRNTLFNLNNFLDKGALQGYDMSTFIRRYSRYLNEKAMSYRLVAVDFTKMKRGI-DGVMRTMNTEKLIKTLPIIQNQLDALLDFQANPNELTNGVINSAFMLLFKDSIRLFAAYNEGVINLLEKYFDMKKNQCKDALDIYKKFLYRMTKLSEFLKVAEQVGIDQGDIPDLSQAPSSLLEALEQHLASLEGKKT 290          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Match: picalmb (phosphatidylinositol binding clathrin assembly protein [Source:NCBI gene;Acc:101168971])

HSP 1 Score: 339.732 bits (870), Expect = 1.614e-106
Identity = 156/289 (53.98%), Postives = 215/289 (74.39%), Query Frame = 2
Query:   86 TGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            +GQS+ DR++AA++S+ GS + + V KATT EI  PKKKHLDYL +CTNE+NV+IP+LA+ L +RT   SWVVV K+ ITTHHLM +GNE+F QYLA++NT  +L NF+DK+   GY+MS +++ YS+Y+NEK+ +YR +AFDF K+KRG  DG++R M +EKL+KT+PI+Q Q+D LL+F+    +L N V+N+AF LL+KD IRL+A+YNEG+INL+E YF M    CKE LD+YK FL R  ++++F+ VAE  G+       L   P  +LE LE HLA+LE  K
Sbjct:    2 SGQSITDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIHCTNEMNVNIPQLADSLFERTTNTSWVVVFKSLITTHHLMVYGNERFVQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGV-DGVMRTMNTEKLLKTIPIIQNQMDALLDFNVNANELTNGVINAAFMLLFKDSIRLFAAYNEGIINLLEKYFDMKKTQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLEALEQHLASLEGKK 289          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Planmine SMEST
Match: SMESG000020797.1 (SMESG000020797.1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 702/710 (98.87%), Postives = 703/710 (99.01%), Query Frame = 2
Query:   47 MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDEVKVPASTPASLTIKINKPETTQYTKKSNQSTXXXXXXXXXXKVQESNTSHEPQNNISGNVLSSDKTAEVAVRTQLRRPEQQHSVAVTVKXXXXXXXXXXXXXXTQNRSRDVSPAKNEPHAKENNDEDFFSHLRDESSANLEITPTTPVNGRASPFSADEKPLESPPSFWNSNISSNEPDKQVGNVDFESAFNESSLEGSKQNHNEMNLFETDLLGLDICDDSTNKPITPVESKNSAYADLDDIFALGSCESSILTDAPLAPSAVSPMASRGFNDDVMTSFXXXXXXXXXXXXXXXXXXXXXXXXXRQASTILPTNKPSKPSDAAFNDTLADLAQSLGKRETKWSSPKPQTLAGKSRDNVGISTGPTINWXXXXXXXXXXXXXXXXXXXXXXXXXLFADLLG 2176
            MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMN KSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDEVK PASTPASLTIKINKPETTQYTKKSNQSTPPHPPKPEAPKVQE NTSHEPQNNISGNVLSSDKTAEVAVRTQLRRPEQQHSVAVTVKRPGRSPSPARPPRPTQNRSRDVSPAKNEPHAKENNDEDFFSHLRDESSANLEITPTTPVNGRASPFSADEKPLESPPSFWNSNISSNEPDKQVGNVDFESAFNES  EGSKQNHNEMNLFETDLLGLDICDDSTNKPITPVESKNSA+ADLDDIFALGSCESSILTDAPLAPSAVSPMASRG NDDVMTSFTTISPSYSSNNSISNTSTLTNV STRQASTILPTNKPSKPSDAAFNDTLADLAQSLGKRETKWSSPKPQTLAGKSRDNVGISTGPTINWAANTTAAGNNGNTTSISSSNNNNDNLFADLLG
Sbjct:    1 MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNRKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNKTSLDSDEVKAPASTPASLTIKINKPETTQYTKKSNQSTPPHPPKPEAPKVQELNTSHEPQNNISGNVLSSDKTAEVAVRTQLRRPEQQHSVAVTVKRPGRSPSPARPPRPTQNRSRDVSPAKNEPHAKENNDEDFFSHLRDESSANLEITPTTPVNGRASPFSADEKPLESPPSFWNSNISSNEPDKQVGNVDFESAFNESLPEGSKQNHNEMNLFETDLLGLDICDDSTNKPITPVESKNSAFADLDDIFALGSCESSILTDAPLAPSAVSPMASRGLNDDVMTSFTTISPSYSSNNSISNTSTLTNVASTRQASTILPTNKPSKPSDAAFNDTLADLAQSLGKRETKWSSPKPQTLAGKSRDNVGISTGPTINWAANTTAAGNNGNTTSISSSNNNNDNLFADLLG 710          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Planmine SMEST
Match: SMESG000072544.1 (SMESG000072544.1)

HSP 1 Score: 400.208 bits (1027), Expect = 4.382e-129
Identity = 182/302 (60.26%), Postives = 237/302 (78.48%), Query Frame = 2
Query:   47 MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            MA K VKQL GNGTGQS +DR++AAKYS+ GSGL + V KATTEE++ PKKKHL+YL  CTNE NVSIPELA  LI+RTQQ++WV+V K+ IT HHLMN+GNE+FSQYLA+ N+ LSL NF D+T     +MS++V+ YS+Y+ +K+ +YR MAFDFCKIKRG+++G+LR+M +EKLMKT+PIL+ Q+D +L+FDA   ++ + ++ SAF LLYKD IRL+A+YN+GMINLIE YF MN K C+E+L+ YK F +R ++V KF+ +AE  G GDK  L LQ VP  VLE LENHL  L+  K
Sbjct:    1 MAGKTVKQLYGNGTGQSFMDRVNAAKYSVTGSGLAKIVCKATTEEMAAPKKKHLEYLVQCTNEPNVSIPELANLLIERTQQSNWVIVFKSLITIHHLMNYGNERFSQYLASNNSHLSLSNFTDRTGIQAIDMSKFVRQYSRYVEQKARSYRDMAFDFCKIKRGKENGVLRKMSAEKLMKTIPILEAQLDSMLDFDANGSEINHVIVYSAFVLLYKDAIRLFATYNDGMINLIEKYFLMNRKQCREALNCYKNFTKRMDRVNKFLRLAEDIGCGDKDGLELQPVPVSVLEALENHLNYLDGKK 302          
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Planmine SMEST
Match: SMESG000072544.1 (SMESG000072544.1)

HSP 1 Score: 394.815 bits (1013), Expect = 5.331e-127
Identity = 182/306 (59.48%), Postives = 237/306 (77.45%), Query Frame = 2
Query:   47 MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPKKKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNFGNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTYRLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKDLVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMYKAFLERTEKVTKFVTVAEG----AGVGDKASLGLQAVPPKVLETLENHLANLEKNK 952
            MA K VKQL GNGTGQS +DR++AAKYS+ GSGL + V KATTEE++ PKKKHL+YL  CTNE NVSIPELA  LI+RTQQ++WV+V K+ IT HHLMN+GNE+FSQYLA+ N+ LSL NF D+T     +MS++V+ YS+Y+ +K+ +YR MAFDFCKIKRG+++G+LR+M +EKLMKT+PIL+ Q+D +L+FDA   ++ + ++ SAF LLYKD IRL+A+YN+GMINLIE YF MN K C+E+L+ YK F +R ++V KF+ +AE      G GDK  L LQ VP  VLE LENHL  L+  K
Sbjct:    1 MAGKTVKQLYGNGTGQSFMDRVNAAKYSVTGSGLAKIVCKATTEEMAAPKKKHLEYLVQCTNEPNVSIPELANLLIERTQQSNWVIVFKSLITIHHLMNYGNERFSQYLASNNSHLSLSNFTDRTGIQAIDMSKFVRQYSRYVEQKARSYRDMAFDFCKIKRGKENGVLRKMSAEKLMKTIPILEAQLDSMLDFDANGSEINHVIVYSAFVLLYKDAIRLFATYNDGMINLIEKYFLMNRKQCREALNCYKNFTKRMDRVNKFLRLAENYIQDIGCGDKDGLELQPVPVSVLEALENHLNYLDGKK 306          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PICALM5.675e-10653.98phosphatidylinositol binding clathrin assembly pro... [more]
PICALM1.268e-10553.98phosphatidylinositol binding clathrin assembly pro... [more]
PICALM1.404e-10553.98phosphatidylinositol binding clathrin assembly pro... [more]
PICALM1.838e-10553.98phosphatidylinositol binding clathrin assembly pro... [more]
SNAP914.170e-10553.45synaptosome associated protein 91 [Source:HGNC Sym... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-116.523e-11256.40Phosphatidylinositol-binding clathrin assembly pro... [more]
unc-114.581e-11156.40Phosphatidylinositol-binding clathrin assembly pro... [more]
unc-117.611e-11156.40Phosphatidylinositol-binding clathrin assembly pro... [more]
unc-117.649e-11156.40Phosphatidylinositol-binding clathrin assembly pro... [more]
unc-111.357e-11056.40Phosphatidylinositol-binding clathrin assembly pro... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lap4.926e-11256.70gene:FBgn0086372 transcript:FBtr0334888[more]
lap6.758e-11254.46gene:FBgn0086372 transcript:FBtr0081572[more]
lap1.051e-11156.70gene:FBgn0086372 transcript:FBtr0334886[more]
lap1.060e-11054.46gene:FBgn0086372 transcript:FBtr0305153[more]
lap3.270e-10954.64gene:FBgn0086372 transcript:FBtr0305155[more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-200p22.44.777e-11054.67si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
picalmb4.917e-10953.79phosphatidylinositol binding clathrin assembly pro... [more]
si:ch211-200p22.41.601e-10754.48si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
picalma1.990e-10752.94phosphatidylinositol binding clathrin assembly pro... [more]
si:ch211-200p22.43.113e-10754.48si:ch211-200p22.4 [Source:ZFIN;Acc:ZDB-GENE-081104... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fktn1.151e-10653.63fukutin [Source:Xenbase;Acc:XB-GENE-971788][more]
fktn2.079e-10653.63fukutin [Source:Xenbase;Acc:XB-GENE-971788][more]
fktn6.841e-10653.63fukutin [Source:Xenbase;Acc:XB-GENE-971788][more]
fktn7.381e-10653.63fukutin [Source:Xenbase;Acc:XB-GENE-971788][more]
fktn1.167e-10553.63fukutin [Source:Xenbase;Acc:XB-GENE-971788][more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Picalm3.480e-10653.98phosphatidylinositol binding clathrin assembly pro... [more]
Picalm5.590e-10653.98phosphatidylinositol binding clathrin assembly pro... [more]
Picalm8.347e-10653.98phosphatidylinositol binding clathrin assembly pro... [more]
Picalm1.283e-10553.98phosphatidylinositol binding clathrin assembly pro... [more]
Picalm1.574e-10553.98phosphatidylinositol binding clathrin assembly pro... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VI75|PICAL_DROME6.774e-11154.46Phosphatidylinositol-binding clathrin assembly pro... [more]
sp|Q9XZI6|PICAL_CAEEL1.726e-10956.40Phosphatidylinositol-binding clathrin assembly pro... [more]
sp|O55012|PICAL_RAT5.312e-10553.98Phosphatidylinositol-binding clathrin assembly pro... [more]
sp|Q13492|PICAL_HUMAN8.829e-10553.98Phosphatidylinositol-binding clathrin assembly pro... [more]
sp|Q7M6Y3|PICAL_MOUSE1.249e-10453.98Phosphatidylinositol-binding clathrin assembly pro... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LQS74.965e-14265.50ENTH domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2LIF76.619e-14265.50ENTH domain-containing protein OS=Opisthorchis fel... [more]
A0A3Q0KRJ14.517e-13865.16Putative phosphatidylinositol-binding clathrin ass... [more]
G4VLB84.989e-13765.16Putative phosphatidylinositol-binding clathrin ass... [more]
A0A183QJ832.514e-13458.24ENTH domain-containing protein OS=Schistosoma rodh... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-200p22.42.056e-10853.67phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.44.169e-10853.67phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.41.788e-10654.55phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.41.911e-10654.83phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.44.055e-10654.55phosphatidylinositol-binding clathrin assembly pro... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
picalmb9.094e-11753.77phosphatidylinositol binding clathrin assembly pro... [more]
ENSPMAT00000006622.11.454e-5849.00pep scaffold:Pmarinus_7.0:GL476457:519972:582649:1... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YAP18028.895e-2125.48Protein of the AP180 family, involved in clathrin ... [more]
YAP18013.939e-2026.09Protein of the AP180 family, involved in clathrin ... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO335081.919e-6448.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335096.103e-2854.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-200p22.42.439e-10855.17phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.49.250e-10855.17phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.41.015e-10755.17phosphatidylinositol-binding clathrin assembly pro... [more]
si:ch211-200p22.42.693e-10755.17phosphatidylinositol-binding clathrin assembly pro... [more]
picalmb1.614e-10653.98phosphatidylinositol binding clathrin assembly pro... [more]
back to top
BLAST of Phosphatidylinositol-binding clathrin assembly protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020797.10.000e+098.87SMESG000020797.1[more]
SMESG000072544.14.382e-12960.26SMESG000072544.1[more]
SMESG000072544.15.331e-12759.48SMESG000072544.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018266 ID=SMED30018266|Name=Phosphatidylinositol-binding clathrin assembly protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2424bp
CGATCTATTAGTTCAAATTTAAAGTTATTATTTATAAACGCTGAAAATGG
CGAGTAAAGTTGTAAAACAATTAGCAGGAAATGGTACTGGTCAAAGTTTG
GTAGACAGAATGAGTGCAGCCAAATATAGTTTAGCTGGTTCAGGCTTAGG
AAGAGGTGTAATTAAAGCAACTACTGAAGAAATATCGCCTCCAAAAAAGA
AACATTTGGATTACTTGACCAATTGTACAAATGAAGTCAATGTTTCGATT
CCAGAATTAGCTGAATATCTTATTGATCGTACGCAACAAGCATCTTGGGT
TGTAGTTTTAAAAACTTTTATAACAACTCATCATTTGATGAATTTTGGAA
ATGAAAAATTTTCTCAATACCTAGCTGCCAAAAACACTTCATTATCCTTG
CCTAATTTTGTAGATAAGACAAGTTCCATTGGCTATGAAATGTCACAATA
TGTGAAACCGTATTCAAAGTATATCAATGAAAAATCGTCAACTTATCGTT
TAATGGCGTTTGATTTCTGTAAAATAAAACGAGGGCGAGATGATGGAATC
CTGAGAAGGATGCCATCTGAGAAATTAATGAAGACTCTTCCAATTTTGCA
AGGCCAAATAGATATTTTATTGGAATTTGATGCTACTCAAAAAGATCTTG
TGAATCCTGTTCTTAATTCGGCATTCACATTGTTGTATAAGGATTTAATT
CGATTGTATGCCTCATACAATGAAGGAATGATTAATCTAATTGAATTATA
TTTTTCAATGAATCACAAATCTTGCAAAGAAAGTCTTGACATGTATAAAG
CCTTTTTGGAAAGAACAGAAAAAGTTACTAAATTTGTTACTGTTGCTGAG
GGTGCTGGAGTGGGAGATAAAGCATCATTGGGTTTACAAGCTGTGCCTCC
TAAAGTACTTGAAACTTTAGAAAATCATTTAGCTAATTTAGAGAAAAACA
AAACTTCATTGGATTCGGATGAAGTTAAAGTTCCTGCATCTACTCCTGCA
TCGTTGACAATTAAAATTAATAAACCCGAAACTACTCAATATACTAAGAA
ATCTAATCAATCTACTCCACCTCATCCGCCGAAACCAGAAGCTCCCAAAG
TTCAAGAATCAAATACATCCCATGAACCTCAAAATAACATTTCAGGAAAT
GTTTTATCGAGCGATAAAACTGCTGAAGTAGCCGTTCGTACTCAGTTGAG
AAGACCTGAGCAGCAACATTCTGTCGCTGTCACCGTTAAACGACCTGGAA
GGTCTCCATCTCCAGCAAGACCTCCTAGACCTACTCAAAATAGATCCCGG
GATGTTTCCCCTGCTAAAAACGAACCACATGCTAAAGAAAATAACGACGA
AGATTTTTTTAGTCATCTCCGTGATGAATCAAGTGCTAATTTGGAAATTA
CTCCTACCACTCCTGTCAATGGCAGAGCAAGTCCTTTCTCTGCAGATGAA
AAGCCTCTCGAATCACCGCCATCATTTTGGAATTCTAACATTTCAAGCAA
TGAACCAGATAAACAAGTTGGCAATGTTGATTTCGAATCTGCTTTCAATG
AATCTTCACTGGAAGGTTCAAAACAAAATCACAATGAAATGAATTTATTC
GAGACCGATTTATTGGGTCTTGATATATGCGATGATTCAACAAACAAACC
CATTACTCCTGTTGAATCCAAAAATTCAGCTTATGCTGATCTAGATGACA
TTTTTGCTTTGGGATCTTGTGAATCTAGCATTCTGACTGATGCTCCTTTA
GCACCTTCAGCCGTGAGTCCGATGGCTTCTAGGGGTTTTAATGATGACGT
TATGACGTCATTTACAACAATCAGCCCTAGCTATAGTAGTAATAACTCTA
TTTCCAATACATCGACCCTTACAAACGTTACATCAACAAGACAGGCTTCA
ACTATTCTACCGACTAATAAACCGAGCAAACCTTCCGATGCTGCATTTAA
TGATACATTGGCTGATCTAGCCCAAAGTCTCGGTAAGCGTGAAACAAAGT
GGTCTTCACCAAAGCCTCAAACATTAGCAGGCAAATCAAGAGATAATGTA
GGTATATCAACCGGCCCAACAATTAATTGGGCTGCTAACACCACTGCAGC
TGGGAATAATGGAAACACGACTTCCATTTCATCGTCTAATAACAATAATG
ACAATCTATTTGCTGATTTGCTGGGTTGATCATCGTCGATTTAGACTGCA
TATTAGTTAGATATTAGCCATCATTGTGATTTTGTTTTATCATCGATTTT
GTTCTATTTTATATGTAGTGAGACTTTAAGCAGATTTATGGGATTTATCT
AGATTCTAGTCGTGTTTGATTCGAAATTTGGGGTTGACTGAAAATTCTCT
ATGTCTTCATTCTATACATGCGTTTGGATTGATTTAAAATATATCTTTGA
TACAAATATTTAGCTTTTCTGAAA
back to top

protein sequence of SMED30018266-orf-1

>SMED30018266-orf-1 ID=SMED30018266-orf-1|Name=SMED30018266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=711bp
MASKVVKQLAGNGTGQSLVDRMSAAKYSLAGSGLGRGVIKATTEEISPPK
KKHLDYLTNCTNEVNVSIPELAEYLIDRTQQASWVVVLKTFITTHHLMNF
GNEKFSQYLAAKNTSLSLPNFVDKTSSIGYEMSQYVKPYSKYINEKSSTY
RLMAFDFCKIKRGRDDGILRRMPSEKLMKTLPILQGQIDILLEFDATQKD
LVNPVLNSAFTLLYKDLIRLYASYNEGMINLIELYFSMNHKSCKESLDMY
KAFLERTEKVTKFVTVAEGAGVGDKASLGLQAVPPKVLETLENHLANLEK
NKTSLDSDEVKVPASTPASLTIKINKPETTQYTKKSNQSTPPHPPKPEAP
KVQESNTSHEPQNNISGNVLSSDKTAEVAVRTQLRRPEQQHSVAVTVKRP
GRSPSPARPPRPTQNRSRDVSPAKNEPHAKENNDEDFFSHLRDESSANLE
ITPTTPVNGRASPFSADEKPLESPPSFWNSNISSNEPDKQVGNVDFESAF
NESSLEGSKQNHNEMNLFETDLLGLDICDDSTNKPITPVESKNSAYADLD
DIFALGSCESSILTDAPLAPSAVSPMASRGFNDDVMTSFTTISPSYSSNN
SISNTSTLTNVTSTRQASTILPTNKPSKPSDAAFNDTLADLAQSLGKRET
KWSSPKPQTLAGKSRDNVGISTGPTINWAANTTAAGNNGNTTSISSSNNN
NDNLFADLLG*
back to top
Aliases
The feature 'Phosphatidylinositol-binding clathrin assembly protein' has the following synonyms
Synonym
Smed_29424
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013809ENTH
IPR008942ENTH_VHS
IPR011417ANTH_dom
IPR014712Clathrin_AP_dom2
IPR018281Ribosomal_S3Ae_CS
Vocabulary: molecular function
TermDefinition
GO:0005543phospholipid binding
GO:0030276clathrin binding
GO:00055451-phosphatidylinositol binding
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0048268clathrin coat assembly
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0030136clathrin-coated vesicle
GO:0005622intracellular
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 288..308
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 421..443
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 318..339
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..474
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 645..668
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 355..378
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 445..461
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 647..668
NoneNo IPR availablePANTHERPTHR22951:SF4CLATHRIN COAT ASSEMBLY PROTEIN AP180coord: 15..436
NoneNo IPR availablePANTHERPTHR22951CLATHRIN ASSEMBLY PROTEINcoord: 15..436
NoneNo IPR availableCDDcd16985ANTH_N_AP180coord: 34..150
e-value: 4.38723E-61
score: 198.415
NoneNo IPR availableSUPERFAMILYSSF89009GAT-like domaincoord: 164..294
IPR013809ENTH domainSMARTSM00273enth_2coord: 32..157
e-value: 1.5E-20
score: 84.3
IPR013809ENTH domainPROSITEPS50942ENTHcoord: 26..157
score: 26.027
IPR011417AP180 N-terminal homology (ANTH) domainPFAMPF07651ANTHcoord: 37..296
e-value: 4.2E-55
score: 186.7
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 8..158
e-value: 2.7E-44
score: 152.5
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 38..159
IPR014712Phosphoinositide-binding clathrin adaptor, domain 2GENE3DG3DSA:1.20.58.150coord: 159..309
e-value: 5.3E-46
score: 158.0