Telomerase-binding protein EST1A

Overview
NameTelomerase-binding protein EST1A
Smed IDSMED30018250
Length (bp)5941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Telomerase-binding protein EST1A (SMED30018250) t-SNE clustered cells

Violin plots show distribution of expression levels for Telomerase-binding protein EST1A (SMED30018250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Telomerase-binding protein EST1A (SMED30018250) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Telomerase-binding protein EST1A (SMED30018250) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30018250 tr5_9369mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30018250 tr5_9369mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30018250 tr5_9369mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30018250SMESG000051442.1 dd_Smed_v4_10632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018250SMESG000051442.1 dd_Smed_v4_10632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018250SMESG000058734.1 SMESG000057289.1 SMESG000076438.1 SMESG000071011.1 SMESG000052064.1 SMESG000039181.1 SMESG000038459.1 SMESG000037745.1 SMESG000034409.1 SMESG000030447.1 SMESG000003965.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000048922.1 SMESG000029226.1 Contig50916newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018250SMESG000058734.1 SMESG000057289.1 SMESG000076438.1 SMESG000071011.1 SMESG000052064.1 SMESG000039181.1 SMESG000038459.1 SMESG000037745.1 SMESG000034409.1 SMESG000030447.1 SMESG000003965.1 SMESG000065288.1 SMESG000065178.1 SMESG000062279.1 SMESG000061056.1 SMESG000048922.1 SMESG000029226.1 Contig50916uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018250SMESG000029612.1 SMESG000029602.1 Contig12391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018250SMESG000029612.1 SMESG000029602.1 Contig12391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30018250SMESG000014375.1 Contig44115newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30018250SMESG000014375.1 Contig44115uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Match: SMG6 (SMG6 nonsense mediated mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:17809])

HSP 1 Score: 442.195 bits (1136), Expect = 2.047e-128
Identity = 301/917 (32.82%), Postives = 471/917 (51.36%), Query Frame = 3
Query: 1329 EMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXX-------XXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPS---IDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            E+QL  ++  S D  SP+  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P+ +  P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD+ARY E  ++++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q           RK KK T          +EIWIHP      +                        D + +    S+   +L+K F LSFL++HGKLF +I ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL +R   +  E A+ +  S                         + +W+DWM+ +P+ WNPPP+  D   LPS   +D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  GT  E   E     D  E +E E    +  I +L+ K+  L  K  E+ RR E  +  L DH    R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE++F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  DFMP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  592 ELQLSNLL--SRDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVKDPN-VENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKYALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKKSTFRHVGDDTTRLEIWIHPSHPRSSQGTESGK------------------DSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLD---LPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHS-QMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 1418          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Match: SMG6 (SMG6 nonsense mediated mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:17809])

HSP 1 Score: 263.462 bits (672), Expect = 1.225e-75
Identity = 186/568 (32.75%), Postives = 287/568 (50.53%), Query Frame = 3
Query: 2355 MENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPS---IDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL +R   +  E A+ +  S                         + +W+DWM+ +P+ WNPPP+  D   LPS   +D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  GT  E   E     D  E +E E    +  I +L+ K+  L  K  E+ RR E  +  L DH    R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE++F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  DFMP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:    1 METFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLD---LPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHS-QMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 510          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Match: SMG6 (SMG6 nonsense mediated mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:17809])

HSP 1 Score: 263.462 bits (672), Expect = 1.225e-75
Identity = 186/568 (32.75%), Postives = 287/568 (50.53%), Query Frame = 3
Query: 2355 MENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPS---IDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL +R   +  E A+ +  S                         + +W+DWM+ +P+ WNPPP+  D   LPS   +D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  GT  E   E     D  E +E E    +  I +L+ K+  L  K  E+ RR E  +  L DH    R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE++F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  DFMP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:    1 METFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLD---LPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHS-QMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 510          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Match: SMG7 (SMG7 nonsense mediated mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:16792])

HSP 1 Score: 92.0485 bits (227), Expect = 8.040e-18
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Match: SMG7 (SMG7 nonsense mediated mRNA decay factor [Source:HGNC Symbol;Acc:HGNC:16792])

HSP 1 Score: 92.4337 bits (228), Expect = 8.076e-18
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   62 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 255          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Celegans
Match: smg-6 (Suppressor with Morphological effect on Genitalia [Source:UniProtKB/TrEMBL;Acc:Q1T6W7])

HSP 1 Score: 83.1889 bits (204), Expect = 1.758e-15
Identity = 56/197 (28.43%), Postives = 103/197 (52.28%), Query Frame = 3
Query: 3438 RKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLID----HKKFIIIVPLIVVNELENLSKTYQL--KDDVDIH-----ARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEW 3995
            R+ ++D +       + I P +L+ DTN  I  L  +K L++    +KKF I+VP  V++EL+ ++K   L  K + + H     ++AK A+ +L+E+  +   ++  +T+ G  + T++  +E +   E  TNDD+ILN      +  P    P   +    + +  VL+TGDR L +KA+  + P + +  F +W
Sbjct: 1045 REQMIDEQRGLGKTTIVIHPEYLIPDTNVLIGDLQLMKNLLETAQKNKKFQILVPTTVLDELQYIAKLSPLDSKSNSEAHDPERISKAKIAVAWLKEQAKQKTGHLYTLTTTGKRLPTLSIVSEDLEGHEMTTNDDMILNSALRWSESLPGSTAPSATE----ISQKCVLITGDRGLTIKAIGNNFPCRGISNFTKW 1237          

HSP 2 Score: 77.0258 bits (188), Expect = 1.444e-13
Identity = 89/393 (22.65%), Postives = 150/393 (38.17%), Query Frame = 3
Query: 1413 ELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTG--HGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPET---------------GSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYA----------------------NRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMY 2474
            EL ++Y  VI  D+ Y   AG+EQ L++  FY  +E +R   N+    A P  +  +    K+ + G  + +N++ + E  F    TD          + + S  P  E                 S T+K    S  + L+ LGDL RY  +I+ S ++  ++  Y K+  L P  G PYNQL ++  Y+                       R +D  +  TR LA S+P+  A   L    +  R T     +     +    K+      R +   +IWIHP                   T  + D   +++   +   ++     +LH+       ++ G L  KI M++F  V        +A LS      S+ +L     + +Y
Sbjct:  520 ELANIYSQVIIHDVIYSFTAGLEQKLFRQAFYKCIESLRTGSNS----AAPDARLIRAVTQKLLLNGIVYYENLIATYETQFHVALTDA---------LTWQSGSPSDEELCEQYIELPIGIQKFDSATQKTAIKSLSRHLISLGDLHRYKSLIDGSENYEISKSCYQKSSQLWPSTGHPYNQLGIVVYYSMLYRSARRARLVPVDVLSRQRQKRVIDEFFCLTRALACSHPYEVAKDRLKQRIDAMR-TKVAKYQPVLDKESGIVKEQGNVLRRLQRIRQIWIHP------------------ITETSQDGTGERIVDDVLVHFMEHSKAKLHRRAVSYLCDTFGMLVTKIGMDHFESVSERAFGLLYASLSKSETDFSADQLVKFSAMFIY 880          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Celegans
Match: smg-6 (Suppressor with Morphological effect on Genitalia [Source:UniProtKB/TrEMBL;Acc:Q1T6W7])

HSP 1 Score: 77.0258 bits (188), Expect = 1.431e-13
Identity = 89/393 (22.65%), Postives = 150/393 (38.17%), Query Frame = 3
Query: 1413 ELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTG--HGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPET---------------GSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYA----------------------NRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMY 2474
            EL ++Y  VI  D+ Y   AG+EQ L++  FY  +E +R   N+    A P  +  +    K+ + G  + +N++ + E  F    TD          + + S  P  E                 S T+K    S  + L+ LGDL RY  +I+ S ++  ++  Y K+  L P  G PYNQL ++  Y+                       R +D  +  TR LA S+P+  A   L    +  R T     +     +    K+      R +   +IWIHP                   T  + D   +++   +   ++     +LH+       ++ G L  KI M++F  V        +A LS      S+ +L     + +Y
Sbjct:  363 ELANIYSQVIIHDVIYSFTAGLEQKLFRQAFYKCIESLRTGSNS----AAPDARLIRAVTQKLLLNGIVYYENLIATYETQFHVALTDA---------LTWQSGSPSDEELCEQYIELPIGIQKFDSATQKTAIKSLSRHLISLGDLHRYKSLIDGSENYEISKSCYQKSSQLWPSTGHPYNQLGIVVYYSMLYRSARRARLVPVDVLSRQRQKRVIDEFFCLTRALACSHPYEVAKDRLKQRIDAMR-TKVAKYQPVLDKESGIVKEQGNVLRRLQRIRQIWIHP------------------ITETSQDGTGERIVDDVLVHFMEHSKAKLHRRAVSYLCDTFGMLVTKIGMDHFESVSERAFGLLYASLSKSETDFSADQLVKFSAMFIY 723          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Celegans
Match: smg-7 (SMG-7; Suppressor with Morphological effect on Genitalia [Source:UniProtKB/TrEMBL;Acc:G5EF47])

HSP 1 Score: 62.7734 bits (151), Expect = 1.861e-9
Identity = 36/109 (33.03%), Postives = 66/109 (60.55%), Query Frame = 3
Query: 1704 IFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFE 2030
            +F +R+P     S+    V+++   +LL +GDL RY E      ++ KA+ +Y ++  + P +G  +NQL +IS    ++L+++Y++TR L A+  FPTAS  L+ +F+
Sbjct:  112 VFLNRKP---IKSKKNSRVFMAY--VLLRMGDLMRYKE------NYPKAQEYYEQSCRINPADGAVWNQLGLISSLGAKNLESVYFHTRALHATMEFPTASGGLTNIFK 209          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Fly
Match: Smg6 (gene:FBgn0039260 transcript:FBtr0084796)

HSP 1 Score: 100.523 bits (249), Expect = 1.046e-20
Identity = 65/222 (29.28%), Postives = 106/222 (47.75%), Query Frame = 3
Query: 1386 WQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDE 2051
            W++   +  +L D ++ ++   L +  +  ++   WK +FY++               L + Q DQ          H   +L         +     K + +    ++D         SR    + + AQ+LL+ LGDL RY      ++D+ +A  +Y +AQ LVP NG P+NQLAVISIY ++  DA+YYY R+L  SN   +A +SL  LF+E R+  E
Sbjct:  190 WKNFCYIHDQLQDAFKQLLLEQLKFVCEHKVDVFFWKLLFYNVRNY------------LKRQQTDQ---------AHTHTLL---------LIEQAIKFYRM----LYDKLMAKCVASSRCDSALKVVAQRLLICLGDLTRYRVNHVKATDYMEAARYYQRAQELVPGNGAPFNQLAVISIYHHKRFDAVYYYVRSLLTSNSIQSAKESLLDLFDEIRRKYE 377          

HSP 2 Score: 98.2117 bits (243), Expect = 5.771e-20
Identity = 68/193 (35.23%), Postives = 108/193 (55.96%), Query Frame = 3
Query: 3477 VELEIRPLFLVLDTNCYIDYLSNI-KLLIDHKKFIIIVPLIVVNELENLSKTYQL------KDDVDIH------ARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWA-DIRRS 4013
            + +E+RP +L+ DTNC+ID L +  KL  + K++ +I+PL VV EL+ LSK  +L      K    IH      +RAK++L+F++     A   V+  T++G+F+    +   A+   E  +NDD IL     + K    +   +  D    +  ++VL+T DRNLR+KALSR++ V  L  F++WA D R S
Sbjct:  765 IYIEVRPRYLLPDTNCFIDCLEDFEKLSTEFKRYTLIIPLTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSRAKKSLEFIKS----AKGNVKCATTKGSFVNASVF---ALVEEEYLSNDDKILATAMAVSKTAKTE---QCTDGKCFIQTELVLITTDRNLRVKALSRNLAVSALDEFLQWAKDCRES 947          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Zebrafish
Match: smg6 (SMG6 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-081107-52])

HSP 1 Score: 437.187 bits (1123), Expect = 3.846e-126
Identity = 302/929 (32.51%), Postives = 474/929 (51.02%), Query Frame = 3
Query: 1323 SLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEET-RKTDEM---MXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEI----------------FDEWAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTD-----DWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANL--KFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVD-------IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S E+QL  ++  S +  S +  + +  +R+EL+ +Y  VI +D+++ +   ++Q LWK+VFY ++E  R  + + ++   PQ        IK  +      IL+ G  +F S+   +  +    L+   D          +T K   +SAQ+ ++  GD+ARY E  + S+++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEE  RK D++   +++  +      K  T          +EIWI P + +   + T  +                  D +   +  ++   +L+K F LSFL++HGKLF K+ ME+FP V + +L EF ALL H P PL S R+  I+ INM+ +   + Q         RS  ++ A  + L  F LL QR  E+                FDE  + E +        P DL  LLP + +W+DWM+ HPE WNPPP      +  S D +  ++ LC   +R+           H  VL    +AD   + +   + LEE+ ++SGF+P+L         +D  +T + TD     D   +  L  F + LCG   PLL +      YI          L   I+ ++K +   +D I  +  L    + EID      G+  +                         I +L+ +R  L  K  +++ RR ++  +++L        +E+E+RP +LV DTN +ID+L  ++ L+    +I++VPLIV+ EL+ L+K    ++ V        +  RA+ A+ FLE+ F+  D  +RA+TSRG  +E+IA+R+E  S  +G  NDDVIL+CC H C+DK  DFMP E++ P+ L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  707 SQELQLSNLL--SRERLSQEGLERMAQLRAELLTIYERVILTDIEFSDSQNVDQTLWKNVFYQVIERFRQLLKDQNSDTAPQ--------IKTMLM----TILEEGAVFFDSLLQKLQSVFQFKLQDYMDCMAIRARPLRKTVKYALISAQRCMICQGDIARYREQASESANYGKARSWYLKAQQIAPKNGRPYNQLALLAVYTKRKLDAVYYYMRSLAASNPILTAKESLMSLFEEAKRKADQVERRLKQDSDGSAHGPKGHTGGRRGEDAARVEIWIRPSEVSGTSRPTGSESGK---------------DSEQDGELGALSASDLNKRFILSFLHAHGKLFTKVGMESFPAVANRVLLEFRALLQHSPSPLGSTRMLQIITINMFTI--YNAQIRAKGQGETRSALEEQAISLGLAMFGLLVQRCTELLKETPTEPIPAEELGEFDEMDDEEGMVR--VSVFPHDLRELLPSMKVWSDWMLGHPEKWNPPPCS----MQGSPDVWQCLADLCNSFSRVY----------HGEVLLYKADADGEGDEELRVLQLEEDKMLSGFVPLL------AAPQDACYTDQGTDAAIAADCKRVTVLKYFLEALCGQEEPLLAFK--GGKYISMAAP-----LTPSINTENKAQEQEDDVIVEESSLSAS-EGEIDGEMEGDGSEDD-------------------------IRELRARRHALAHKLAQQQKRRDKI--QAVLQ---TGGQLEIEVRPFYLVPDTNGFIDHLEGLRKLLACGTYILVVPLIVITELDGLAKGQDSREGVGNGAHARQVQDRARAAVMFLEKAFESRDPSIRALTSRGNTLESIAFRSEDTSGQKG-NNDDVILSCCLHYCQDKAKDFMPAERNGPVRLRREVVLLTDDRNLRVKALTRNVPVRDIPAFLIWAKV 1543          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Zebrafish
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-030131-9122])

HSP 1 Score: 90.1225 bits (222), Expect = 2.684e-17
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  +++              K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K    SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   32 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQS------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQSSTSAIVKPQPSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Zebrafish
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-030131-9122])

HSP 1 Score: 89.7373 bits (221), Expect = 2.739e-17
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  +++              K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K    SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   32 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQS------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQSSTSAIVKPQPSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Zebrafish
Match: smg5 (SMG5 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-050913-144])

HSP 1 Score: 71.633 bits (174), Expect = 9.657e-12
Identity = 54/224 (24.11%), Postives = 103/224 (45.98%), Query Frame = 3
Query: 1401 SVRSELMDL-YRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFD---------SRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRK 2042
            S+R++L +L  + +    +DY  +A  E+ LW+ V+Y ++++I+             N+K   S+  +        I  +G  +F  +   I   + ++L+   D          R+ P    S+  +   ++  + L++LGDLARY   +        A  +Y +A  + P  G P+NQL  ++     +++A YYY R + +  PF  A  +L  LF++  K
Sbjct:   51 SLRNKLRELCVKLMFLHPVDYGRKA--EELLWRKVYYEVIQVIKT------------NKKHIHSRSALECAYRTHLI--AGVGFFQHLLLYIQSHYQLELQDCIDWTHVTDPLIGRKKPVSATSKEMEWAQMACHRCLVYLGDLARYQNELAGVEAEQLAERFYHQALSVAPHVGMPFNQLGTLAGSKFYNVEATYYYLRCIQSETPFDGAYGNLKRLFDKASK 258          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Match: mgme1 (mitochondrial genome maintenance exonuclease 1 [Source:Xenbase;Acc:XB-GENE-1008562])

HSP 1 Score: 440.269 bits (1131), Expect = 2.396e-128
Identity = 313/1012 (30.93%), Postives = 503/1012 (49.70%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTI--NLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEET-RKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKE-DYV-SMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXXXX------------XXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVD---SCTYIP-TVIKE-GSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARA-----KEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P  +G  ++   +   SN + PG         P    + P+  SPL  T  +M H      + TL +       +   +    + E+QL  ++  S D  S +    + S+RSEL+ +Y   + SD+++ +Q  ++Q LWK+VFY ++E  R F+    + +          +I+  +      +L  G  +F S+   +   +   LE   D      +   +  K   +SAQ+ ++  GD+ARY E   ++S++ KAR WYLKAQ + PKNGRPYNQLA+++IY  R LDA+YYY R+LAASNP  TA +SL  LFEET RK D++ ++QQ+          TT         EIWIHP                             +  R+  E D + ++   +L+K F LSFL++ GKLF +I ME FP V   +L+EF ALL H P P+ S R+  ++ INM+ ++    +A         S+ Q+ A+ + L  F+LL  R I++ +   +       G      +   +                 +W+DWM+ HP+ WNPPP+    L  P++D +G++++ C  +  + +   P    P               ++    +L E+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +      S   +P T+ KE GS    +G   +D+++V+IE+  +  E   +  + +  E                                      L+ K+  L  K E+ +R +   +++LD +   R ++LEI PLFLV DTN +I++L  ++ L+  + +I+++PLIV++EL+ L+K  +       HARA     ++A++FLE+ F+  D Y+RA+TSRG  +++IA+R+E +S  +G  NDD+IL CC H CKDK  +FM   KD+PI L R+VVLLT DRNLR+KAL+RH+PV+ +  F++WA +
Sbjct:  466 SDNPYYYPRSPFTYGGFSMPYSVGT-SNGMYPGAYYPGFPPQPGQFASGPYSGSPL--TPEEMEHQ-----VRTLQH-----QELNRMLRMADNQELQLSNLL--SRDGMSTEGLNRMASLRSELLQVYERCLLSDIEFSDQHNVDQLLWKNVFYQVIEKFRHFLKETSSDS---------EEIRRKLL----QVLDEGTAFFDSLLQKLQVTYQFKLEEYMDGMAIRSKPLRKMVKFALISAQRCMICQGDIARYREQAADTSNYGKARSWYLKAQQIAPKNGRPYNQLALLAIYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKADQLEQKQQKERGVSHTSDDTTRS-------EIWIHPI----------------------------RRGRESGECDALDALSPSDLNKRFLLSFLHAQGKLFTRIGMETFPLVAKKVLKEFQALLQHSPSPIGSTRMLQLMAINMFAVNNSQSKAGQAEGSC--SVVQEQATSLGLSMFSLLVCRCIQLLNVQKKAHCPRGKGQSMEEEEDDDIKVSSFIPDLKELLPSVKVWSDWMLGHPDTWNPPPNSLADLKEPALDVWGVLAEFCNALTSVNQSEVPLYKDPD--------------DDLSLLILEEDRLLSGFVPLL-AAPQEPCYVEKTSDKIIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTIGKETGSP---EGNQMEDQDDVVIEEYEEDSEPESSGAEHDFRE--------------------------------------LRAKKQELARKVEEQKRRQQKIQAVLDGKT--RLLQLEICPLFLVPDTNGFINHLPGLEHLLSCQIYILVIPLIVIHELDGLAKGQEFDQRNADHARALQEKARKAIQFLEQGFEARDPYLRALTSRGNELDSIAFRSEDISGQKG-NNDDLILCCCLHYCKDKAKEFMHSRKDEPIRLRREVVLLTDDRNLRVKALTRHVPVRDIPAFLKWAKV 1353          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Match: mgme1 (mitochondrial genome maintenance exonuclease 1 [Source:Xenbase;Acc:XB-GENE-1008562])

HSP 1 Score: 436.802 bits (1122), Expect = 8.362e-127
Identity = 315/1005 (31.34%), Postives = 505/1005 (50.25%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTI--NLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEET-RKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKE-DYV-SMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXX-----XXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVD---SCTYIP-TVIKE-GSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARA-----KEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P  +G  ++   +   SN + PG         P    + P+  SPL  T  +M H         L+ ++  +       NQ    E+QL  ++  S D  S +    + S+RSEL+ +Y   + SD+++ +Q  ++Q LWK+VFY ++E  R F+    + +          +I+  +      +L  G  +F S+   +   +   LE   D      +   +  K   +SAQ+ ++  GD+ARY E   ++S++ KAR WYLKAQ + PKNGRPYNQLA+++IY  R LDA+YYY R+LAASNP  TA +SL  LFEET RK D++ ++QQ+          TT         EIWIHP                             +  R+  E D + ++   +L+K F LSFL++ GKLF +I ME FP V   +L+EF ALL H P P+ S R+  ++ INM+ ++    +  +       S+ Q+ A+ + L  F+LL  R I++ +   +           +           LLP + +W+DWM+ HP+ WNPPP+    L  P++D +G++++ C  +  + +   P    P               ++    +L E+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +      S   +P T+ KE GS    +G   +D+++V+IE+  +  E   +  + +  E                                      L+ K+  L  K E+ +R +   +++LD +   R ++LEI PLFLV DTN +I++L  ++ L+  + +I+++PLIV++EL+ L+K  +       HARA     ++A++FLE+ F+  D Y+RA+TSRG  +++IA+R+E +S  +G  NDD+IL CC H CKDK  +FM   KD+PI L R+VVLLT DRNLR+KAL+RH+PV+ +  F++WA +
Sbjct:  511 SDNPYYYPRSPFTYGGFSMPYSVGT-SNGMYPGAYYPGFPPQPGQFASGPYSGSPL--TPEEMEHQVRTLQHQELNRMLRMAD------NQ----ELQLSNLL--SRDGMSTEGLNRMASLRSELLQVYERCLLSDIEFSDQHNVDQLLWKNVFYQVIEKFRHFLKETSSDS---------EEIRRKLL----QVLDEGTAFFDSLLQKLQVTYQFKLEEYMDGMAIRSKPLRKMVKFALISAQRCMICQGDIARYREQAADTSNYGKARSWYLKAQQIAPKNGRPYNQLALLAIYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKADQLEQKQQKERGVSHTSDDTTRS-------EIWIHPI----------------------------RRGRESGECDALDALSPSDLNKRFLLSFLHAQGKLFTRIGMETFPLVAKKVLKEFQALLQHSPSPIGSTRMLQLMAINMFAVNNSQSKGMMPEGSC--SVVQEQATSLGLSMFSLLVCRCIQLLNVQKKAHCPRGKEDDDIKVSSFIPDLKELLPSVKVWSDWMLGHPDTWNPPPNSLADLKEPALDVWGVLAEFCNALTSVNQSEVPLYKDPD--------------DDLSLLILEEDRLLSGFVPLL-AAPQEPCYVEKTSDKIIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTIGKETGSP---EGNQMEDQDDVVIEEYEEDSEPESSGAEHDFRE--------------------------------------LRAKKQELARKVEEQKRRQQKIQAVLDGKT--RLLQLEICPLFLVPDTNGFINHLPGLEHLLSCQIYILVIPLIVIHELDGLAKGQEFDQRNADHARALQEKARKAIQFLEQGFEARDPYLRALTSRGNELDSIAFRSEDISGQKG-NNDDLILCCCLHYCKDKAKEFMHSRKDEPIRLRREVVLLTDDRNLRVKALTRHVPVRDIPAFLKWAKV 1391          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Match: mgme1 (mitochondrial genome maintenance exonuclease 1 [Source:Xenbase;Acc:XB-GENE-1008562])

HSP 1 Score: 433.335 bits (1113), Expect = 1.290e-125
Identity = 315/1005 (31.34%), Postives = 505/1005 (50.25%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTI--NLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEET-RKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKE-DYV-SMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXX-----XXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVD---SCTYIP-TVIKE-GSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARA-----KEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P  +G  ++   +   SN + PG         P    + P+  SPL  T  +M H         L+ ++  +       NQ    E+QL  ++  S D  S +    + S+RSEL+ +Y   + SD+++ +Q  ++Q LWK+VFY ++E  R F+    + +          +I+  +      +L  G  +F S+   +   +   LE   D      +   +  K   +SAQ+ ++  GD+ARY E   ++S++ KAR WYLKAQ + PKNGRPYNQLA+++IY  R LDA+YYY R+LAASNP  TA +SL  LFEET RK D++ ++QQ+          TT         EIWIHP                             +  R+  E D + ++   +L+K F LSFL++ GKLF +I ME FP V   +L+EF ALL H P P+ S R+  ++ INM+ ++    +  +       S+ Q+ A+ + L  F+LL  R I++ +   +           +           LLP + +W+DWM+ HP+ WNPPP+   P   P++D +G++++ C  +  + +   P    P               ++    +L E+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +      S   +P T+ KE GS    +G   +D+++V+IE+  +  E   +  + +  E                                      L+ K+  L  K E+ +R +   +++LD +   R ++LEI PLFLV DTN +I++L  ++ L+  + +I+++PLIV++EL+ L+K  +       HARA     ++A++FLE+ F+  D Y+RA+TSRG  +++IA+R+E +S  +G  NDD+IL CC H CKDK  +FM   KD+PI L R+VVLLT DRNLR+KAL+RH+PV+ +  F++WA +
Sbjct:  511 SDNPYYYPRSPFTYGGFSMPYSVGT-SNGMYPGAYYPGFPPQPGQFASGPYSGSPL--TPEEMEHQVRTLQHQELNRMLRMAD------NQ----ELQLSNLL--SRDGMSTEGLNRMASLRSELLQVYERCLLSDIEFSDQHNVDQLLWKNVFYQVIEKFRHFLKETSSDS---------EEIRRKLL----QVLDEGTAFFDSLLQKLQVTYQFKLEEYMDGMAIRSKPLRKMVKFALISAQRCMICQGDIARYREQAADTSNYGKARSWYLKAQQIAPKNGRPYNQLALLAIYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKADQLEQKQQKERGVSHTSDDTTRS-------EIWIHPI----------------------------RRGRESGECDALDALSPSDLNKRFLLSFLHAQGKLFTRIGMETFPLVAKKVLKEFQALLQHSPSPIGSTRMLQLMAINMFAVNNSQSKGMMPEGSC--SVVQEQATSLGLSMFSLLVCRCIQLLNVQKKAHCPRGKEDDDIKVSSFIPDLKELLPSVKVWSDWMLGHPDTWNPPPNSLLPSQ-PALDVWGVLAEFCNALTSVNQSEVPLYKDPD--------------DDLSLLILEEDRLLSGFVPLL-AAPQEPCYVEKTSDKIIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVPDTIGKETGSP---EGNQMEDQDDVVIEEYEEDSEPESSGAEHDFRE--------------------------------------LRAKKQELARKVEEQKRRQQKIQAVLDGKT--RLLQLEICPLFLVPDTNGFINHLPGLEHLLSCQIYILVIPLIVIHELDGLAKGQEFDQRNADHARALQEKARKAIQFLEQGFEARDPYLRALTSRGNELDSIAFRSEDISGQKG-NNDDLILCCCLHYCKDKAKEFMHSRKDEPIRLRREVVLLTDDRNLRVKALTRHVPVRDIPAFLKWAKV 1390          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:394870])

HSP 1 Score: 89.3521 bits (220), Expect = 6.184e-17
Identity = 56/213 (26.29%), Postives = 101/213 (47.42%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRR------PPPETGS----RTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S +          +G+    ++    Y+  Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRTNPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSSQLGIISNKQMHSGTVVKPQSSSCAYI-CQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:394870])

HSP 1 Score: 88.9669 bits (219), Expect = 6.893e-17
Identity = 56/213 (26.29%), Postives = 101/213 (47.42%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRR------PPPETGS----RTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S +          +G+    ++    Y+  Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRTNPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSSQLGIISNKQMHSGTVVKPQSSSCAYI-CQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Match: Smg6 (Smg-6 homolog, nonsense mediated mRNA decay factor (C. elegans) [Source:MGI Symbol;Acc:MGI:2144117])

HSP 1 Score: 441.039 bits (1133), Expect = 2.842e-128
Identity = 314/1016 (30.91%), Postives = 500/1016 (49.21%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQ-----SNFITPGTINLMRAPPST--LTTP---HIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXX-------XXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P        +G+ P+Q     +N + PG        PS   + +P     MSP     H  V       L+ L  +           NQ    E+QL  ++  S D  S +  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P++   P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD++RY E  N+++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q           RK KK T          +EIWIHP      +                        D + +    S+   +L+K F LSFL++HGKLF +I ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL QR   +  + A+ +  S                         + +W+DWM+ +P+ WNPPP+  D  L  ++D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  G   E   E     D  E +E E    +  I +L+ K+  L  K  + +R +   +++L+ +   R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE +F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  D+MP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  503 SDNPYYYPRTPGPASQYPYAGYSPLQYPVGPTNGMYPGAYYPGYPAPSGQYVCSPLPASTMSPEEIEQH--VRNMQQQELHRLLRVAD---------NQ----ELQLSNLL--SRDRISTEGMEKMAQLRTELLQLYERCILLDIEFSDSQNVDQILWKNAFYQVIEKFRQLLKDPNS-ENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKYALISAQRSMICQGDISRYREQANDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDMSPDKWRKGKKSTFRHVGDDTTRLEIWIHPSHSRSAQGTESGK------------------DSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAASLGLAMFSLLVQRCTCLLKDSAKAQLSSPEDQEDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLDLPLQVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGKQLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDQSQMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLERRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDYMPTSKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 1417          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Match: Smg6 (Smg-6 homolog, nonsense mediated mRNA decay factor (C. elegans) [Source:MGI Symbol;Acc:MGI:2144117])

HSP 1 Score: 166.007 bits (419), Expect = 3.765e-44
Identity = 99/282 (35.11%), Postives = 159/282 (56.38%), Query Frame = 3
Query: 1329 EMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXX-------XXXXXXXXXXXXXXXGCIEIWIHP 2153
            E+QL  ++  S D  S +  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P++   P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD++RY E  N+++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q           RK KK T          +EIWIHP
Sbjct:   53 ELQLSNLL--SRDRISTEGMEKMAQLRTELLQLYERCILLDIEFSDSQNVDQILWKNAFYQVIEKFRQLLKDPNS-ENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKYALISAQRSMICQGDISRYREQANDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDMSPDKWRKGKKSTFRHVGDDTTRLEIWIHP 320          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Match: Smg7 (Smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [Source:MGI Symbol;Acc:MGI:2682334])

HSP 1 Score: 90.1225 bits (222), Expect = 2.713e-17
Identity = 57/216 (26.39%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + S              Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   41 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHSSTIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 234          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Match: Smg7 (Smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [Source:MGI Symbol;Acc:MGI:2682334])

HSP 1 Score: 89.7373 bits (221), Expect = 2.887e-17
Identity = 57/216 (26.39%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLS-------------AQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + S              Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHSSTIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Match: Smg7 (Smg-7 homolog, nonsense mediated mRNA decay factor (C. elegans) [Source:MGI Symbol;Acc:MGI:2682334])

HSP 1 Score: 89.7373 bits (221), Expect = 3.069e-17
Identity = 57/216 (26.39%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLS-------------AQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + S              Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHSSTIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Match: sp|Q86US8|EST1A_HUMAN (Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2)

HSP 1 Score: 442.195 bits (1136), Expect = 9.828e-128
Identity = 301/917 (32.82%), Postives = 471/917 (51.36%), Query Frame = 3
Query: 1329 EMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXX-------XXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPS---IDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            E+QL  ++  S D  SP+  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P+ +  P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD+ARY E  ++++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q           RK KK T          +EIWIHP      +                        D + +    S+   +L+K F LSFL++HGKLF +I ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL +R   +  E A+ +  S                         + +W+DWM+ +P+ WNPPP+  D   LPS   +D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  GT  E   E     D  E +E E    +  I +L+ K+  L  K  E+ RR E  +  L DH    R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE++F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  DFMP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  592 ELQLSNLL--SRDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVKDPN-VENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKYALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKKSTFRHVGDDTTRLEIWIHPSHPRSSQGTESGK------------------DSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLD---LPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHS-QMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDFMPASKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 1418          
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Match: sp|P61406|EST1A_MOUSE (Telomerase-binding protein EST1A OS=Mus musculus OX=10090 GN=Smg6 PE=1 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.988e-127
Identity = 314/1016 (30.91%), Postives = 500/1016 (49.21%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQ-----SNFITPGTINLMRAPPST--LTTP---HIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXX-------XXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P        +G+ P+Q     +N + PG        PS   + +P     MSP     H  V       L+ L  +           NQ    E+QL  ++  S D  S +  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P++   P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD++RY E  N+++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q           RK KK T          +EIWIHP      +                        D + +    S+   +L+K F LSFL++HGKLF +I ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL QR   +  + A+ +  S                         + +W+DWM+ +P+ WNPPP+  D  L  ++D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +       +  V                                DT  K    E+ S  G   E   E     D  E +E E    +  I +L+ K+  L  K  + +R +   +++L+ +   R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE +F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  D+MP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  503 SDNPYYYPRTPGPASQYPYAGYSPLQYPVGPTNGMYPGAYYPGYPAPSGQYVCSPLPASTMSPEEIEQH--VRNMQQQELHRLLRVAD---------NQ----ELQLSNLL--SRDRISTEGMEKMAQLRTELLQLYERCILLDIEFSDSQNVDQILWKNAFYQVIEKFRQLLKDPNS-ENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKYALISAQRSMICQGDISRYREQANDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDMSPDKWRKGKKSTFRHVGDDTTRLEIWIHPSHSRSAQGTESGK------------------DSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAASLGLAMFSLLVQRCTCLLKDSAKAQLSSPEDQEDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLDLPLQVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYVSVAPVP-------------------------------DTMGK----EMGSQEGKQLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDQSQMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLERRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDYMPTSKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 1417          
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Match: sp|Q5RAK6|EST1A_PONAB (Telomerase-binding protein EST1A OS=Pongo abelii OX=9601 GN=SMG6 PE=2 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 3.304e-127
Identity = 321/1016 (31.59%), Postives = 512/1016 (50.39%), Query Frame = 3
Query: 1050 SSNSTSYPTVPIMHGIQTISGFIPVQ-----SNFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIK-SLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXX-------XXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXX--------XXXXWTDWMVTHPEYWNPPPSHRDPLLLPS---IDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEEN-LISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            S N   YP  P        +G+ P+Q     +N + PG        PS    P++ SPL  ++     +P++   + + N+  +    +H + ++  + E+QL  ++  S D  SP+  + +  +R+EL+ LY   I  D+++ +   ++Q LWK+ FY ++E  R  + +P+ +  P+  ++++ ++           L  G ++F S+   +   +   LE   D      +   +T K   +SAQ+ ++  GD+ARY E   +++++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEET++  E M ++Q            K KK T          +EIWIHP      +                        D + +    S+   +L+K F LSFL++HGKLF +I ME FP V   +L+EF  LL H P P+ S R+  ++ INM+ +   + Q     +   RS+ Q+ A+ + L  F+LL  R   +  E A+ +  S                         + +W+DWM+ +P+ WNPPP+  D   LPS   +D +  ++  C  +  + +   P    P               ++  T ++LEE+ L+SGF+P+L   P+     +    K    D   +  L  F + LCG   PLL +                         KD   V +    D+       + KE+    S  GT  E   E     D  E +E E    +  I +L+ K+  L  K  E+ RR E  +  L DH    R +ELEIRPLFLV DTN +ID+L+++  L++ +K+I++VPLIV+NEL+ L+K  +       +AR     A+++++FLE++F+  D  +RA+TSRG  +E+IA+R+E ++   G  NDD+IL+CC H CKDK  DFMP  K++PI L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  504 SDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYPGPYYPGYPTPSG---PYVCSPLPASTM----SPEEVEQH-MRNLQQQE---LHRLLRVADNQELQLSNLL--SRDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVKDPN-VENPEQIRNRLLEL-----------LDEGSDFFDSLLQKLQVTYKFKLEDYIDGLAIRSKPLRKTVKYALISAQRCMICQGDIARYREQARDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTRRKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFELSPDQWRKGKKSTFRHVGDDTTRLEIWIHPSHPRSSQGTESGK------------------DSEQENGLGSLSPSDLNKRFILSFLHAHGKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVH--NSQLKDCFSEECRSVIQEQAAALGLAMFSLLVCRCTYLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLKELLPSVKVWSDWMLGYPDTWNPPPTSLD---LPSHVAVDVWSTLADFCNILTAVNQSEVPLYKDP---------------DDDLTLLILEEDRLLSGFVPLL-AAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAF-------------------------KDGKYVSVAPAPDT-------MGKEM---VSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGEDDIRELRAKKLALARKIAEQQRRQEKIQAVLEDHS-QMRQMELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSEDITGQLG-NNDDLILSCCLHYCKDKAKDFMPTSKEEPIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV 1418          
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Match: sp|Q92540|SMG7_HUMAN (Protein SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 4.374e-17
Identity = 58/216 (26.85%), Postives = 100/216 (46.30%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHTSAIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Match: sp|Q5RJH6|SMG7_MOUSE (Protein SMG7 OS=Mus musculus OX=10090 GN=Smg7 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.147e-16
Identity = 57/216 (26.39%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLS-------------AQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  ++               K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K  + S              Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQG------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQTHSSTIVKPQSSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 226          
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Match: A0A4S2KZU3 (PINc domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010463 PE=4 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 418/1212 (34.49%), Postives = 607/1212 (50.08%), Query Frame = 3
Query:  858 VSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFS--QHVSSNSTSYPTVPIMH-----GIQTISGFIPVQSNFITPGTINLMR---APPSTLTTPHIMSPLRFTSHQMVHTPDDP-ALYTLSNIVSKS-------------PV------VVHCVNQIKSLEMQLDVMI-------RSSCDISSP------------------DWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQK----DQVSKIKMSVTGHGQNI-----LQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCI---EIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKE----------------------DYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVN------------------------NYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHY---------------RVLSDSKEADKAI-------NNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEI--AQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKK-FIIIVPLIVVNELENLSK------TYQLKDDVD--------IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSW-SEGETNDDVILNCCQHLCKDKPVDFMPRE----------KDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
             S ++D+  HGGLIHLP++++I +S    +          N    +    KP V+VRP+FS  Q  S + T   T+   H     GI       P QS+  T  +++ ++      +     + M  L     +  H  DD  +L  +  + SK              PV      +   + QI  L+  L  ++       R+   +  P                   WW +V  +R  L  L+ SVI  DLD+CN A +EQ +WKSVFY+ +EL+R++I++P++  L +  +    +Q  + +  +T   Q+I     + SGE    ++   I  +H + L  +    RPPPET SRTR+LVYLSAQKL+LFLGDLARY E++N   +F KAR WY +AQLL+PKNGR YNQLAV+++Y +RHLDA+YYY RTLAASNPF TASQSLS LF E R   E + RQ    K +                   EIW+HP DG             +    + +    QKV  ++ E                      +Y +M LIEL + F L+F+++HGKL+ KI ME FPEV S  LQ F  LL+ +PCPLS+ RLC + I+NMY +DR     +  N                           LRS+H DHA+R  LDFF+LLC+R  ++  E    +  +      LP D  LLL  L LW++WM+ HPE+W PPP+HRDP L P ++D+ LI+ LCT+    + R      RP Y               RV     E D +         N +   L EE + +GF PMLD +PK+Y      WT E   D++ +EK+ LFGDFLCGI+ P+L Y+VD   Y   + +E SER +   D +    +  E  +   E +    +K          T  EAS +                     I  L+ +RA L+ + E+  R   WR + +       +R VELE+ P++L+ DTNCYID+L  I  L      + ++VP++VVNEL+ L++      +++  DD +        I  RA+ A+ +LE +F   +  +RA+T+RG+FMETIA+R E     + G+ NDDVIL CC H CK+ P  F  R            ++P+ +HR++VLLT DRNLRLKAL+ ++PV+PL+ F+ W+ +
Sbjct:  165 TSAKTDTTKHGGLIHLPKDIDIYQSSDEPKAGISRQPKRGN----QGGTTKPVVVVRPSFSKVQRYSESETLGSTLAADHHGDTKGIGHDGVGFP-QSSRTTSASVSALQNTWTDTAKAAYQYYMQALSQMDQERQHPFDDANSLSNVGTVNSKQGAQRSATSSNFAMPVQAPNEKISAVIQQIVQLDAALTALLIPPGICARALPCVEPPPAHPQPGKQWTEPQLLILRWWSTVERLRERLFTLFESVILFDLDFCNTAHVEQGMWKSVFYTALELMRSWISHPESTNLVRTDRKVEDEQSVEEREQITSLLQHICLSDVIASGETRLSNLLDRIQTIHRVRLAPLIADGRPPPETRSRTRRLVYLSAQKLMLFLGDLARYKELLNGERNFGKARSWYQRAQLLIPKNGRSYNQLAVLAVYTSRHLDAMYYYMRTLAASNPFATASQSLSALFNEIRPRAENLIRQLRKPKNEPNAPHHGPFGNPNNRFQRAEIWVHPIDGQTTVLQGARRLVYLPPPTNAS---TQKVSTKLGEMDLDTNCDNEDDDDEDAQAELEEYANMSLIELSRQFGLTFIHAHGKLYTKIGMETFPEVASLALQAFSGLLAQKPCPLSAERLCQLCIVNMYNVDRAVSLTNASNLSTIKRTESDSKTPKIQPISHLAGVETLRSVHHDHAARFALDFFSLLCRRTAQLLQEPVPQDAPA----WWLPPDARLLLSALRLWSEWMILHPEHWLPPPNHRDPTLRPCLNDWQLIASLCTQAANWMNRNP---LRPRYEELTPTTSMVLQSKDRVEGQDLEEDTSAEAHAYLGGNFENAFLFEEAVCAGFKPMLDLVPKMYTY-SGHWTAETVADFVRVEKIVLFGDFLCGIDSPVLSYDVDRGAYEAVIEREMSERKE---DKQTDPSISDERRVSESESVGFSGEKPPVPYEPVEETEYEASGD---------------------IVALQRQRALLQRQLEEESRLAAWRWNAIRQAASGGRRAVELEVHPIYLLPDTNCYIDWLEGIATLAQRSSNYTVLVPIVVVNELDTLARYGSSSNSWRTADDEEGDVTRAGLIQERARAAITYLEHEFAHRNTRLRALTARGSFMETIAFRNEINGGRAPGQVNDDVILACCNHFCKEDPERFSSRRGNDQGFVGESNNQPMRIHREIVLLTSDRNLRLKALNINVPVRPLRTFVNWSRL 1336          
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Match: G4VE87 (PINc domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_131650 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 428/1258 (34.02%), Postives = 636/1258 (50.56%), Query Frame = 3
Query:  825 NSNTEIKDKAIVSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFSQ---HVSSNSTSYPTVPIMHGI---QTISGFIPVQSNFITPGTI---NLMRAPPSTLTTP-----------HIMSPLRFTSHQMV---------HTPDDPALYTLSNIVSKSP--VVVHCVNQIKSLEMQLDVMI----------------RSSCDI----SSPD-----WWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIAL-PQNQKDQ-------------VSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDE---MMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMP-------------------------LIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDR---VSQQASVVNNY-------------------------------------ALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTK----VNRL-----VERGTPALS---RPHYRVLSDSK---EADKAI---------NNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEI--AQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDH-KKFIIIVPLIVVNELENLSK---TYQLKDDVD----------------IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSW-SEGETNDDVILNCCQHLCKDKPVDFMPR-------------EKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            NS +     A ++ E+ +  HGGLI LP++++I       Q    + +     V S  S  KP V+VRP+FS    H  + ST   +    HG+   + I+       N ++P          +P + L  P              +  +F+S   +         H  + P   T  + +++ P  ++   + QI  L+  L  ++                +S  ++    + P+     WW +V  +R  L  L+ SVI +DLD+CN A +EQ +WKSVFY+++E +R++I NP +  L P+  K++             + KI +S       ++  G     S+   I  +H+I L  +    RPPPET SRTR+LVYLSAQKL+LFLGDLARY E +    +F KAR WY KAQLLVPKNGR YNQLAV+++Y +RHLDA++YY RTLAASNPF TASQSL+ LF E R   +   M  ++ ++   +      ++ N +    EIWIHP DG                     D+      + I++   S P                         LIEL K F L+F+++HGKL+ KI ME FPEV S  LQ    LL+ +PCPLS+ RLC + ++NM+ +DR   ++ Q + +NN                                      ALRS+H DHA+R  LD F+L+C+RA ++  E    +  SN G +   A + L    L  WT+WM+ HPE+W PPP+HRDP L P +DD+ L++KLCT+    + RL      E  TP  S   R    +  D K   ++DK+          N  K   L EE  ++GF PMLD  PKIY    D W  E   D++ +EKL LFGD+LCGI  P+L+YN+D   Y   + +E SERLQD     D N  I ++   SD +L+ + K++++ ++  +     +S++ T  ++               IA L+ +RA L+ + ++  R + WR++ +       QR VE+E+RP++L+ DTNCYID+L  I  L      + ++VP++VVNEL+ LS+   +      VD                I  RAK A+ +LE +F+  +  +RA+T+RG+ METIAYR E     + G+TNDDVIL CCQH CK+    F  R             + ++P+ L R+VVLLT DRNLRLKAL+ +IP +PL+ F+ W+ +
Sbjct:  141 NSRSLTNTCANLTSENSTEKHGGLILLPKDVDI-----FQQNTQNSRSFRREAVRSDSS--KPVVVVRPSFSNPYNHPRTTSTRSDS----HGVDESKYINQCKQKSDNDMSPRCFVSDASTESPTTVLPVPWTDAAKAAFYQFFKTQTKFSSSPSLQAERPSSTHHFANQPTCLTPGSAITQPPNEMIASAMQQIVQLDATLSALLIPPGLCAQSMVLFEPLQSDPELGREWTEPEALFLRWWGTVKRLRDSLFLLFESVIVADLDFCNTAHVEQGMWKSVFYTVLESLRSWIENPQSTQLIPKVDKNEETTKLLQSQLVNLIQKICIS------EVIDFGSNQLASLLERIQSIHHIQLGPLLSDGRPPPETKSRTRRLVYLSAQKLMLFLGDLARYRETLVGERNFGKARNWYQKAQLLVPKNGRSYNQLAVLALYTSRHLDAMFYYMRTLAASNPFATASQSLAALFNEIRPRAQNMIMQFQKPKTESVQPHCSGFSSYNPRFQRAEIWIHPIDGQTTVIQGGRRLMHSNIKPTI-DESNNIQGKSIQKLNSSTPELEVDNEDEDDEEAQAEAEEYANISLIELSKQFGLAFIHAHGKLYTKIGMETFPEVASLTLQALSGLLAQKPCPLSTERLCQLFVVNMFNVDRAASMTNQTNTMNNSVKNRISESKINVNNDNKIPLNIGMDNFVPSSRLTEIEALRSVHHDHAARFALDTFSLVCRRAAQLLQETPPMD--SNPGWISPDARILLSALCL--WTEWMILHPEHWLPPPNHRDPTLRPHLDDWLLVAKLCTEAASWLTRLSVKPNYEEITPTTSLVLRLKGELNCDEKLDDDSDKSSTLYHIFEDGNLYKATFLSEEAFVAGFKPMLDLTPKIYYYTGD-WDPETVADFVRIEKLVLFGDYLCGIETPVLNYNIDQAVYESVIQRESSERLQD--KRVDVNANIKQN--SSDINLENEEKRQLELMSVLNDNKNLSSDDGTIESNSVLTD----------IAALQRQRAFLQKQLDEEARLDAWRRNAIRQAASGGQRAVEIEVRPIYLLPDTNCYIDWLEGIATLAQKSSNYTVLVPIVVVNELDTLSRFGSSSSGGGGVDRPYEAAVGGEVTRAGLIQERAKLAINYLEYQFEHRNSRLRALTARGSLMETIAYRNEINGGRTPGQTNDDVILTCCQHFCKEDSDRFQLRNLTEGVDLSMQGGQNNQPMRLVREVVLLTSDRNLRLKALNVNIPARPLRTFVNWSRL 1361          
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Match: A0A504YEK1 (Telomerase binding protein EST1A OS=Fasciola gigantica OX=46835 GN=FGIG_08273 PE=4 SV=1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 369/1021 (36.14%), Postives = 540/1021 (52.89%), Query Frame = 3
Query: 1383 WWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQ----------NQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXX---GCIEIWIHPXXXXXXXXXXX---------------------XXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKL---FTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRV-------------------SQQASVVNNY---------------------------ALRSLHQDHASRMTLDFFALLCQRAIEIFDE---------WAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRP-------------------HYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEI--AQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKK-FIIIVPLIVVNELENLSK---------TYQ----LKDDVD------IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSE-GETNDDVILNCCQHLCKDKP-------------VDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            WW +V+ +R  L  L+ SVI SDLDYCN A +EQ +WKSVFY+++EL+R++I+NP++  + Q          N+++ V  +   +    +++++ GE+   S+   +  +++I L  +    RPPPET SRTR+LVYLSAQKL+LFLGDLARY E++    +F KAR WY KAQLLVPKNGR YNQLAV+++Y +RHLDA+ YY RTLAASNPFPTASQSL+ LF E R   E + RQ    K +       + +        +EIWIHP DG                                +        ND+  +    + +E+Y +M LIE  KL   F L F+ +HGKL+ KI ME FPEV S  LQ F  LL+ +PCPLS+ RLC + ++NMY +DR                    S+ +   + +                            LRS+H DHA+R  LD F+LLC+R   +  E         W   +       L+L              ++WM+ HPE+W PPP+HRDP L P ++D+ L+++LCT+    + R +   +RP                    Y V    K++   ++  +   L EE  ++GF PMLD IPK+Y    D WT E   D++ +EKL LFGDFLCGI PP+L Y++D   Y   + +E SE+ QD    +  N + +    DS++   +   K   E +S    NT+  + Q S AD               IA L++KRA L+ + E+  R   WR++ +       +R VELE+RP++L+ DTNCYID+L  I  L      + ++VP++VVNEL+ L++         T++    +++D +      I  RA  A+ +LE +F   +  +RA+T+RG+F+ETIAYR E     E G+TNDDVIL CC H CKD                +F   + ++P+ + R+VVLLT DRNLRLKA + ++P +PL+ F+ W+ +
Sbjct:   51 WWTAVHRLRERLFSLFESVILSDLDYCNTAHVEQGMWKSVFYTVLELLRSWISNPESTGMLQVDPHSSSGNSNEENDVLFVLRHICL--KDVIEVGEDRLCSLLDRVQSINHIYLAPLLADGRPPPETRSRTRRLVYLSAQKLMLFLGDLARYREILLGDRNFGKARNWYQKAQLLVPKNGRSYNQLAVLAMYTSRHLDAMCYYMRTLAASNPFPTASQSLAALFNEIRPRAENLMRQLRRPKAEVTNSHHASFHSADPRFQRVEIWIHPLDGQTTVLQGARRLVYLPTPTTCSSQKNISRPSQSSSDWDRVGENDEDDEDAQAE-QEEYANMSLIEASKLSRQFGLMFIYAHGKLYTKIGMETFPEVASMALQAFSGLLAQKPCPLSAERLCQLCVVNMYNVDRAMSLTTHVGSISSTMEKQSGSKASGAFDRFDRPHYSGSKSEMDRSEIQPISRLSGSETLRSVHHDHAARFALDAFSLLCRRTAHLLQEPIPDGEPTWWIPPDARLLLSALRLW-------------SEWMILHPEHWLPPPNHRDPTLRPYLNDWKLVAELCTRAANWLNRNS---TRPEYEEANPTTSLVLCLKGLSEYEVEDGEKQSRDLVHEFQAAFLFEEAYVAGFKPMLDLIPKLYRYTGD-WTAETVADFVRIEKLVLFGDFLCGIEPPVLTYDLDRAIYESAIERESSEKKQD----RPSNSLPLNYSRDSNDSTSSPNDKSKPETSS---HNTDLKDSQAS-AD---------------IAALQLKRALLQHQLEEEARLAAWRRNAISQAASGGRRAVELEVRPIYLLPDTNCYIDWLEGIATLAQRSSNYTVLVPIVVVNELDILARFGSSSSNGSTWRSGRLVEEDSEVTRAGLIQERAHRAITYLEHEFAVRNTRLRALTARGSFLETIAYRTEINGGREPGQTNDDVILACCNHFCKDDSDRLCLGGFGRNADQEFPGEQTNQPMRIVREVVLLTSDRNLRLKATNINVPARPLRTFVNWSRL 1028          
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Match: A0A419PZW2 (COP9 signalosome complex subunit 5 OS=Clonorchis sinensis OX=79923 GN=CSN5 PE=4 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 1.472e-177
Identity = 363/985 (36.85%), Postives = 516/985 (52.39%), Query Frame = 3
Query: 1383 WWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQK----DQVSKIKMSVTGHGQNI-----LQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCI---EIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKE----------------------DYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVN------------------------NYALRSLHQDHASRMTLDFFALLCQRAIEIFDE---------WAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHY---------------RVLSDSKEADKAI-------NNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEI--NSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEI--AQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKK-FIIIVPLIVVNELENLSK------TYQLKDDVD--------IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSW-SEGETNDDVILNCCQHLCKDKPVDFMPRE----------KDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLK 3980
            WW +V  +R  L  L+ S+I  DLD+CN A +EQ +WKSVFY+ +EL+R++I++P++  L +  +    +Q  + +  +T   Q+I     + SGE    ++   I  +H + L  +    RPPPET SRTR+LVYLSAQKL+LFLGDLARY E++N   +F KAR WY +AQLL+PKNGR YNQLAV+++Y +RHLDA+YYY RTLAASNPF TASQSLS LF E R   E + RQ    K +         +         EIW+HP DG             +    +T     QKV  +  E                      +Y +M LIEL + F L+F+++HGKL+ KI ME FPEV S  LQ F  LL+ +PCPLS+ RLC + I+NMY +DR     +  N                           LRS+H DHA+R  LDFF+LLC+R  ++  E         W  ++       L+L              ++WM+ HPE+W PPP+HRDP L P ++D+ LI+ LCT+    + R      RP Y               RV     E D +         N +   L EE + +GF PMLD +PK+Y      WT E   D++ +EK+ LFGDFLCGI+ P+L Y+VD   Y   + +E SER +D      + +  I D     E        E   +       T  EAS +                     I  L+ +RA L+ + E+  R   WR++ +       +R VELE+ P++L+ DTNCYID+L  I  L      + ++VP++VVNEL+ L++      +++  DD +        I  RA+ A+ +LE +F   +  +RA+T+RG+FMETIA+R E     + G+ NDDVIL CC H CK+ P  F  R            ++P+ +HR++VLLT DRNLRLKAL+ ++PV+PL+
Sbjct:  237 WWSTVERLRERLFTLFESIILFDLDFCNTAHVEQGMWKSVFYTALELMRSWISHPESTNLVRTDRKVEDEQSVEEREQITSLLQHICLSDVIASGETRLSNLLDRIQTIHRVRLAPLLADGRPPPETRSRTRRLVYLSAQKLMLFLGDLARYKELLNGERNFGKARSWYQRAQLLIPKNGRSYNQLAVLAVYTSRHLDAMYYYMRTLAASNPFATASQSLSALFNEIRPRAENLIRQLRKPKNEPNAPHHGPFSNPNNRFQRAEIWVHPIDGQTTVLQGARRLVYLPPPTNTG---TQKVSTKPGEVDLDTNCDNEDDDDEDAQAELEEYANMSLIELSRQFGLTFIHAHGKLYTKIGMETFPEVASLALQAFSGLLAQKPCPLSAERLCQLCIVNMYNVDRAVSLTNTSNLSTIKRTESDSKTPKIQPISHLAGVETLRSVHHDHAARFALDFFSLLCRRTAQLLQEPVPQDAPAWWLPSDARLLLSALRLW-------------SEWMILHPEHWLPPPNHRDPTLRPCLNDWQLIASLCTQAANWMNRNP---LRPRYEELTPTTSMVLQSKDRVEGQDLEEDTSAEAHTYLGGNFENAFLFEEAVCAGFKPMLDLVPKMYTY-SGHWTAETVADFVRVEKIVLFGDFLCGIDSPVLSYDVDRGAYEAVIEREMSERKED-----KQTDPSISDERRVSESGSVGFGDEKPSVPYEPVEETEHEASGD---------------------IVALQRQRALLQRQLEEESRLAAWRRNAIRQAASGGRRAVELEVHPIYLLPDTNCYIDWLEGIATLAQRSSNYTVLVPIVVVNELDTLARYGSSSNSWRTADDEEGDVTRAGLIQERARAAITYLEHEFAHRNTRLRALTARGSFMETIAFRNEINGGRAPGQVNDDVILACCNHFCKEDPERFSSRRGNDQGYVGESNNQPMRIHREIVLLTSDRNLRLKALNINVPVRPLR 1175          
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Match: A0A068YBR0 (Telomerase binding protein EST1A OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000831300 PE=4 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 5.356e-177
Identity = 408/1213 (33.64%), Postives = 606/1213 (49.96%), Query Frame = 3
Query:  885 HGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFSQHVSSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSK--SPVVVHCVNQIKSLEMQLDVMI----------------RSSCDISSPD-------WWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPD-TIALPQNQKDQVSK----------IKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEET---------RKTDEMMXXXXXXXXXXXXXXXXXXXXXXXG---CIEIWIHPXXXXXXXXXXXXXXXXXXXXXXX------------------------NDDPKQKVDRQI-KEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVS---QQASV-------------------------------VNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRL---------VERGTPALS-------RPHY-RVLSDSKEADKAINNK-----KTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKN--EVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQ--RFVELEIRPLFLVLDTNCYIDYLSNI-KLLIDHKKFIIIVPLIVVNELENL------------------------SKTYQLKDDVD-----IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSE-GETNDDVILNCCQHLCKDKPVDF--------MPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADIR 4007
            HGGLIHLP+N+ I    S +  N    A  D  + S                    SN +                   + S+  +PG    + A P+  T+    + LR    Q+   P+      L+ + SK  SP V   V QI  ++  L+ ++                +S   +  P+       WW ++ ++RS LM  Y  VI  DLD+CN A IEQ +WKSVFY+++E +R +I NP  T  LP+ ++ +  +          IK+      +++++ GE     +   +  + +I L+ +    RPPPE+GSRT +L+Y+SAQKL+L+LGDLARY E+IN   +F KAR WY KAQLL+PK+G+PYNQLA+++IY +RH DA+ YY R+LAASNPFPTASQSLS LF E          +K+         S  +        +    +G    +EIWIHP +GT+     +       A   T                        +D+ ++  + Q   E+Y +M LIEL KLF L F+++HG+LF KI ME FPEV S  LQ    LL+ +PCPLS  RLC IL++NM+ +DR +    Q++V                               V +  LRS+H DHA+R  LD F+L+C+RA ++F    E+   S      L  DL +LLP L LWT+WM+ HPE+W+PPP+HRDP L P +DD+ L++++CT   +          V+  TP  +       R H      D  +A   + N+     K   L EE + +GF PMLD IPK+Y    D W  E    +I +EK+ LFGDFLCGI PP+L Y+VD   Y P V     E  + G   K  +  +   E P  SD + + +++     +              T+     ++   EE E  + I  L+ +RA L+ +  + RR E WR+  +    A   R +E+E+RP++++ DTNCYID+L  + +L      + ++VP++V NEL+NL                        S + +           I  RAK A+ FLE +F++ +  +RA+T++G+ +ETIAYR EA    + G+ NDDVIL CC+  CK+                 K++P+ + R+VVLLT DRNLRLKALS +IP +PL+ F+EW+ ++
Sbjct:  132 HGGLIHLPKNVNIFNQSSPNGGNL-GSAQRDACLKS--------------------SNKSG------------------IHSSRESPGEGTTVGALPTISTS----AGLRGKDLQLFEQPNGAYSSVLAQLSSKPSSPTVAEAVYQIMQIDSALNALLVPPGQCISHIPPLPDEQSENKLQMPESERLFLRWWATLENLRSSLMVNYERVILEDLDFCNAAQIEQGMWKSVFYTVLEFLRPWIANPYLTGLLPKPEESESGQAVAAAACSRMIKLIRKVCLEDVIRIGEHRLTGLLNRLQAIRHIHLDYVLSEGRPPPESGSRTCRLMYISAQKLMLYLGDLARYEEIINGGQNFGKARSWYQKAQLLIPKSGKPYNQLALLAIYTSRHFDAMCYYMRSLAASNPFPTASQSLSALFNEVHTHGAEFLRKKSTSSQWPPGYSSSQTGLSSNRASNIFTRGRPKRVEIWIHPVNGTETIVQGNRSLTVPNAAARTEAWRKSKKIVGTANSLSLPSDELLDDENEEGEEAQADAEEYANMSLIELTKLFGLHFMHAHGQLFTKIGMETFPEVASMALQALSGLLAQRPCPLSEDRLCQILMVNMFNLDRAAIFTAQSAVGMVAAIGRSKIGAAEVSRRQQQQQLLQRKPKVESETLRSVHHDHAARFALDTFSLICRRAAKLF---TESRAESRTSGDWLHPDLRILLPALRLWTEWMILHPEHWSPPPNHRDPTLHPRLDDWRLVAEMCTHAAQWFAGVKSAPSVKEITPTTALVVQLHLRKHMAEADGDHPDATAELVNRIPAFLKYTTLFEETVCAGFKPMLDLIPKMYQYSGD-WDAESVAHYIRIEKILLFGDFLCGIEPPVLSYDVDKAIYEPVV---ECESFEQGPIKKSASCYQSDSESPTGSDAESEVEVQSGGKSV--------------TAALKAEKEEGIEENEGGEEICALRRRRAVLRSQLTEARRLEAWRQQAVRQAAAGGPRGIEIEVRPIYILPDTNCYIDWLEGVARLTQTSSNYTVLVPIVVFNELDNLASQDRAFAFNSIEIAFAQYLTNPSSTSSEFNGSSGGRANLIQERAKAAIAFLEGEFNRRNPRLRALTAKGSMLETIAYRNEANGGKQPGQINDDVILTCCRRFCKEVLAQISAEGNLVSTAESKNQPMRVTREVVLLTSDRNLRLKALSLNIPARPLRPFVEWSSLK 1280          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Match: smg6 (SMG6 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-081107-52])

HSP 1 Score: 429.483 bits (1103), Expect = 7.787e-125
Identity = 298/936 (31.84%), Postives = 470/936 (50.21%), Query Frame = 3
Query: 1254 ALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXX---XXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEW-AETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDS--CTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANL--KFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDI------HAR-----AKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            A+ T    V     +V  +    S E+QL  ++  S +  SP+    +  +R+EL+ LY  VI +D+++ +   ++Q LWK+VFY ++E  R  + + D+   PQ +        M +T     IL+ G  +F ++   +  +    LE   D          +T K   +SAQ+ ++  GD+ARY E  ++S+++ KAR WYLKAQ + PKNGRPYNQLA++++Y  R LDA+YYY R+LAASNP  TA +SL  LFEE ++  E + R+++               +        EIWI P                + +    N+  K   D +      S+   +L+K F LSFL++HGKLF K+ ME+FP V   +LQEF ALL H P PL S R+  I+ INM+ +     + +       RS+ ++  + + L  F LL QR  ++  E  AE E++         ADL  LLP + +W+DWM+ HPE WNPPP   DP      D +  +++LC  + R+     P      Y+   D  E D+ +          + +++GF+P+L   P+     D +       D   +  L  F + LCG   PLL +         +P V  +  E         DKNE                        +  H  N E   + +                +  I +L+ +R  L  +  +++ RR ++  +++L        +ELEIRP +LV DTN +ID+L  ++ L+    ++++VPLIV+ EL+ L+K  + +D   +      HA+     AK A+ FLE+ F+  +  +RA+TSRG  +E+IA+R+E  S  +G  NDD+IL+CC H C+DK  DFMP  ++ P+ L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  531 AIATEEAEVQTRGELVKMLRLADSQELQLSNLL--SRERLSPEGLDRMAQLRAELLTLYERVILTDIEFSDSQNLDQALWKNVFYQVIERFRQLLKDQDSDTAPQLRA-------MLLT-----ILEEGAMFFDTLLQKLQTIFQFKLEDYMDGMAIRARPLRKTVKYALISAQRCMICQGDIARYREQASDSANYGKARSWYLKAQQIAPKNGRPYNQLALLAVYTKRKLDAVYYYMRSLAASNPILTAKESLMSLFEEAKRKAEQIERRRKQDSEGSVCGPRGRGWSRGEDATRQEIWIRP-----------SGHPGVPSRTAGNESSK---DSEQDGGLSSLNASDLNKRFILSFLHTHGKLFTKVGMESFPAVAGRVLQEFRALLQHSPSPLGSTRMLQIMTINMFTIHYAQTRET-------RSVLEEQTTSLGLAMFGLLVQRCTDLLKETPAEEESMVR--VSAFSADLRELLPSVKVWSDWMLGHPEQWNPPPYSVDP------DVWQCLAELCNALARVHHSEIPL-----YKADGDG-EGDEELRLLVLEE---DGMLAGFVPLL-AAPQEPCYIDPQTDTAMASDCKRVTVLKYFLEALCGQEEPLLAFKGGKYISVAVPPVPSQQVE---------DKNE------------------------SQVHEQNQEVEGDGS----------------EDDIKELRARRHALTHELAQQQKRRDKI--QAVLQ---TGGQLELEIRPFYLVPDTNGFIDHLEGLRKLLACGSYVLVVPLIVITELDGLAKGQESRDGDCVGVGGAAHAKMVQECAKAAVTFLEKGFEAREPGLRALTSRGNQLESIAFRSEDTSGQKG-NNDDLILSCCLHYCQDKAKDFMPANREGPVRLRREVVLLTDDRNLRVKALTRNVPVRDIPAFLSWAKV 1358          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:103037658])

HSP 1 Score: 89.7373 bits (221), Expect = 2.952e-17
Identity = 59/216 (27.31%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +             +L    K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K    SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   32 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQI------------TSLQSQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQSSTSAIVKPQPSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:103037658])

HSP 1 Score: 89.3521 bits (220), Expect = 3.013e-17
Identity = 59/216 (27.31%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSA-------------QKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +             +L    K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K    SA             Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   32 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQI------------TSLQSQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQSSTSAIVKPQPSSCSYICQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:103037658])

HSP 1 Score: 75.8702 bits (185), Expect = 4.374e-13
Identity = 53/203 (26.11%), Postives = 91/203 (44.83%), Query Frame = 3
Query: 1407 RSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            R  L DLY+ ++ +DL+Y     +EQ+LW   F + +             +L    K++ +  +  V  +    L++   ++  +  ++  + N+DL     S     + G  + K    SA      +         I     F +A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   33 RQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQI------------TSLQSQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSS----QLGIISNKQSSTSA-----IVKPQPSSCSYICQCVCFLQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 214          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Match: smg5 (SMG5 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:103035711])

HSP 1 Score: 67.781 bits (164), Expect = 1.130e-10
Identity = 52/224 (23.21%), Postives = 102/224 (45.54%), Query Frame = 3
Query: 1401 SVRSELMDL-YRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFD---------SRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRK 2042
            S+R++L +L  + +    +DY  +A  E+ LW+ V+Y ++++I+             N+K   S+  +        I  +G  ++  +   I   + ++L+   D          R+ P     +  +   ++  + L++LGDLARY   +        A  +Y +A  + P  G P+NQL  ++     +++A YYY R + +  PF  A  +L  LF++  K
Sbjct:   51 SLRNKLRELCVKLMFLHPVDYGRKA--EELLWRKVYYEVIQVIKT------------NKKHIHSRSALECAYRTHLI--AGVGFYQHLLLYIQSHYQLELQDCIDWTHVTDPLIGRKKPVSATPKEMEWAQMACHRCLVYLGDLARYQNELAGVEAEQLAERFYHQALSVSPHVGMPFNQLGTLAGSKFYNVEATYYYLRCIQSETPFEGAYGNLKRLFDKAAK 258          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Sea Lamprey
Match: smg5 (SMG5 nonsense mediated mRNA decay factor [Source:ZFIN;Acc:ZDB-GENE-050913-144])

HSP 1 Score: 64.3142 bits (155), Expect = 3.113e-10
Identity = 55/248 (22.18%), Postives = 109/248 (43.95%), Query Frame = 3
Query: 1335 QLDVMIRSS--C-DISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFD---------SRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRK 2042
            +LD +I SS  C ++  P+     N +R   + L   +    +DY  +A  E+ LW+ V+Y ++  ++A            N+K   ++  M         L +G  ++  +   +   + ++L+   D         + + P    SR  +   ++    L++LGDLARY   +        +  +YL+A  + P  G P NQL  ++   + +++A YYY R + +   F  A  ++  +F + +K
Sbjct:   27 RLDTIISSSSVCQEVFKPENVSQRNKLRELCVQL---MFLHPVDYGRKA--EELLWRKVYYEVIHAVKA------------NRKQLQTRGSMECAYRTH--LVAGVGFYQHLLLTLQSHYQLELQACIDWTHVVDTLSAVKKPAVVSSRALEWARMACHHCLIYLGDLARYQNELGVIDTHHLSERFYLQALAVAPHVGMPLNQLGTLAGNRSYNVEAAYYYMRCIQSEVGFDGAVGNMRRVFIKAKK 255          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Nematostella
Match: EDO34379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ8])

HSP 1 Score: 104.76 bits (260), Expect = 7.203e-23
Identity = 65/219 (29.68%), Postives = 106/219 (48.40%), Query Frame = 3
Query: 1416 LMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDL---------------EVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLF 2027
            L DLY+ ++ +DL+      IEQ+LW S F S ++ +R            Q  +D+    K  V       L++   ++I +  ++   +++DL               +V   S+RP  ++        Y   Q  L+ LGD+ARY +      D T+A ++Y  A +LVP NG+PYNQLA+++     HL  +Y+Y R++A  N FP AS +L   F
Sbjct:   27 LQDLYKRILLNDLELALDKKIEQDLWNSAFKSQIDFLR------------QKARDKKCTSKNEVQAVLTLFLETASGFYIQLLQELCMTYDLDLPGHARSSHLGLLDDGDVNSSSKRPHTQS-------CYYVCQDCLVHLGDIARYCD------DATQAEVFYRHALVLVPSNGQPYNQLAILASARGDHLGTVYFYCRSIAVKNQFPAASTNLHKTF 220          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Nematostella
Match: EDO42311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W9])

HSP 1 Score: 65.4698 bits (158), Expect = 2.189e-11
Identity = 46/189 (24.34%), Postives = 80/189 (42.33%), Query Frame = 3
Query: 1479 EQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGS----RTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEE 2033
            E+ LW+ VFY +++ +R              Q  +VS     +    ++ L S   Y+  +   +  L+  +L+ +         T S            + Q+ LL++GDLARY +          A  +Y +A  L P+ G P+NQL  + +  +   + +Y+Y R L A   F     +L  LFE+
Sbjct:   56 EELLWRKVFYDVIQWLR--------------QHRKVSPNDEHLESSCRSHLISASGYYYHLLIQLQSLYGTNLKGVVSWTAQGLHTASGIDAEVADWALRACQRCLLYMGDLARYQQEFEGEKSIKLAERFYCEALHLNPQLGMPHNQLGTLLVSQSCGAEGVYHYLRCLIAKESFEGTEGNLVRLFEK 230          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Nematostella
Match: EDO31223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYI2])

HSP 1 Score: 51.6026 bits (122), Expect = 3.826e-6
Identity = 46/168 (27.38%), Postives = 80/168 (47.62%), Query Frame = 3
Query: 3498 LFLVLDTNCYIDYLSNIKLLIDH-----KKFIIIVPLIVVNELENL-SKTYQLK-----------DDVDIHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKAL 3950
            L+++LDTN  + +L  I  L D       + ++IVP IV+ EL++L S +++ +               + A+A++A++FL   F+     +R         +T+A   E VS    E+NDD IL+CC        + F  +  +       + VL + D+NL  KA+
Sbjct:  570 LYIILDTNILLSHLKFITELKDFPIEGVGRPVLIVPWIVMQELDSLKSDSWKFRKGKIINAENKESQRGVDAQARQAVRFLHSCFEANHPRIRG--------QTLAESLEHVSDLPEESNDDRILHCC--------LMFQMKASNG------NAVLFSNDQNLCSKAM 715          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Match: smg6 (SMG6 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:101166408])

HSP 1 Score: 410.223 bits (1053), Expect = 9.481e-117
Identity = 301/941 (31.99%), Postives = 459/941 (48.78%), Query Frame = 3
Query: 1329 EMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXX---XXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEW-AETETISNNGXXXXXXXXXXXXXXXXX--------------WTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLD--QIPKIYLLEDDKWTKEQ-TDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVI----KEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFK-EEKNRRFELWRKSLLDHEIAQRFVELE--IRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSK--------------------TYQLKDDVD-IHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADI 4004
            E+QL  ++  S D  S D    +  +R++L+ LY  VI +D+++ +   ++Q LWK+VFY ++E  R  + +P     P  +        M +T     +L  G ++F ++   +  ++   LE   D          +T K   +SAQ+ ++  GD+ARY E   +S+++ KAR WYLKAQ + PKNGRPYNQLA+++IY  R LDA+YYY R+LAASNP  TA +SL  LFEE ++  E + +++        +        ++ +   +EIWI P+  T                           D +   +  S+   +L K F LSFL++HGKLF K+ ME+FP V S ++QEF  LL H    L S  +  I+ INM+    V    S       RS+ Q+ ++ + L  FALL QR  E+  E  AE+  +++    +        +  +                W+DWM+ HP  WNPPP   D     S D +  ++ LC  V   V+     L    Y+V SD  E D+ +       L E+ L++GF+P+L   Q P  Y+   DK T E    D   +  L  F + LCG   PLL +       + T       E +   QD +   ++ +VI+E    ++  L    ++E D     H  N                           I QLK +   L  K  ++ +R +  +  L      Q   +LE  IRPLFLV DTN +ID+L  +K ++    +II+VPLIV+ EL+ L+K                     Y     V  +  +A+ A+ FLE+ F+  +  +RA+TSRG  +E+IA+R+E  S  +G  NDDVIL+CC H CKDK  DFMP +K+  + L R+VVLLT DRNLR+KAL+R++PV+ +  F+ WA +
Sbjct:  783 EVQLSNLL--SRDRVSADGLDRMAQLRADLLGLYEQVILTDIEFSDSQNVDQALWKNVFYQVIERFRQLLKDPSYDNTPHIRN-------MLLT-----LLDEGAQFFDALLQKVQTVYQFTLEDYMDGMAIRARPLRKTVKYALISAQRCMICQGDIARYREQATDSANYGKARSWYLKAQQIAPKNGRPYNQLALLAIYTKRKLDAVYYYMRSLAASNPILTAKESLMSLFEEAKRKAEQLEQRRRQENEGGSQGPAVRGRRKDEESSRVEIWIRPNGQTATPFNKRGGSESSR-------------DSEQDGELGSLSATDLKKRFILSFLHAHGKLFTKVGMESFPGVASRVIQEFKTLLQHGASLLGSTNILQIITINMFA---VHNSQSKGEEGETRSVLQEQSTALGLGMFALLVQRCTELLKEIPAESIQVADGEEEEEKTGEPEGMVRVSAFPLDLRELLPGIKVWSDWMLGHPHQWNPPPCGID----CSPDVWQYLANLCN-VLAHVDHEEVLL----YKVDSDEGENDEELT---VLQLKEDKLLAGFVPLLAAPQEP-CYI---DKHTDEAIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKYISVATSASNNQSEDARNRQDSLTENEQADVILE----AESSLSASEEEEEDFDGGGHSGND--------------------------IRQLKARHHALTNKLAQRQKRLDKIQAVL------QPGGQLELEIRPLFLVPDTNGFIDHLEGLKKVLHCGSYIIVVPLIVITELDGLAKGQDTFGGGLGSRGRSTGSRGNYNSAAHVRAVQDKARLAVAFLEKGFEAREPCLRALTSRGNQLESIAFRSEDTSGQQG-NNDDVILSCCLHYCKDKAKDFMPPQKNGTVRLQREVVLLTDDRNLRVKALTRNVPVRDIPSFLSWAKV 1640          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:101155720])

HSP 1 Score: 88.5817 bits (218), Expect = 5.413e-17
Identity = 59/223 (26.46%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 1395 VNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRR----------------PPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            V + R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  +++              K++ +  +  V  +    L++   ++  +  ++  + N+DL     S +                P P + S      Y+  Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   28 VWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQS------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVRSSQLGIISNKQGSGGAIVTPQPSSCS------YI-CQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:101155720])

HSP 1 Score: 88.5817 bits (218), Expect = 6.081e-17
Identity = 59/223 (26.46%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 1395 VNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRR----------------PPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            V + R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  +++              K++ +  +  V  +    L++   ++  +  ++  + N+DL     S +                P P + S      Y+  Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   28 VWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQS------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVRSSQLGIISNKQGSGGAIVTPQPSSCS------YI-CQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Match: smg7 (SMG7 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:101155720])

HSP 1 Score: 88.1965 bits (217), Expect = 6.510e-17
Identity = 59/223 (26.46%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 1395 VNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRR----------------PPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSL 2015
            V + R  L DLY+ ++ +DL+Y     +EQ+LW   F + +  +++              K++ +  +  V  +    L++   ++  +  ++  + N+DL     S +                P P + S      Y+  Q  L+ LGD+ARY          ++A  +Y  A  LVP NG+PYNQLA+++     HL  ++YY R++A   PFP AS +L
Sbjct:   28 VWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAFKNQITTLQS------------QAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVRSSQLGIISNKQGSGGAIVTPQPSSCS------YI-CQHCLVHLGDIARYRNQT------SQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAVKFPFPAASTNL 225          
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Match: smg5 (SMG5 nonsense mediated mRNA decay factor [Source:NCBI gene;Acc:101173007])

HSP 1 Score: 69.3218 bits (168), Expect = 4.277e-11
Identity = 51/224 (22.77%), Postives = 103/224 (45.98%), Query Frame = 3
Query: 1401 SVRSELMDL-YRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFD---------SRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRK 2042
            S+R++L +L  + +    +DY  +A  E+ LW+ V+Y ++++I+             N+K   S+  +        I  +G  ++  +   +   + ++L+   D          R+ P     +  +   ++  + L++LGDLARY   +        A  +Y +A  ++P  G P+NQL  ++     +++A YYY R + +  PF  A  +L  LF++  K
Sbjct:   51 SLRNKLRELCVKLMFLHPVDYGRKA--EELLWRKVYYEVIQVIKT------------NKKHVHSRSALECAYRTHLI--AGVGFYQHLLLYVQSHYQLELQDCIDWTHVTDPLIGRKKPVSASPKEMEWAQMACHRCLVYLGDLARYQNELAGVETEQLAERFYHQALSVMPHVGMPFNQLGTLAGSKFYNVEATYYYLRCIQSDAPFEGAYGNLKRLFDKAAK 258          

HSP 2 Score: 55.0694 bits (131), Expect = 9.270e-7
Identity = 40/137 (29.20%), Postives = 64/137 (46.72%), Query Frame = 3
Query: 3375 LKIKRANLKFKEEKNRRFELWRK----------SLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARAKEALKFLEEKFDKADQYVRAITSRGTFME 3755
            L+  +A  +  EE+ RR  L R           S L+  + Q   +  + P +LV DT     +LS I+ L     FIII+P  V++ L+ L K          +A A++ ++FLE +F K ++Y+R     G   E
Sbjct:  898 LQQAKAQFRMAEEEARRNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSSMSP-YLVPDTAALCQHLSLIRQLAGSGCFIIIIPRAVIDGLDALKKE---------NAGARDGIRFLESEFRKGNRYIRCQKESGRSFE 1024          
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Match: SMESG000051442.1 (SMESG000051442.1)

HSP 1 Score: 2404.79 bits (6231), Expect = 0.000e+0
Identity = 1313/1315 (99.85%), Postives = 1313/1315 (99.85%), Query Frame = 3
Query:   81 MASKKNKKPDQEIYRPPKSDRSNYDVNDKSHERTFYNSNHKKKVIKSDVEEKIKKPEGQTKIASRDGKSNPYYYEGDTSXXXXXXXXXXXXXXXXXXXXXXXKDDYEYESYNDKKRYSSAHYVDDNYYQSYDSRYYKTVDYNXXXXXXXXXXXXXXXXERPYKSPDERPRQKVQTNYXXXXXXXXXXXXXXXXXXXENYEDKKPVNYEYNQNVRSRQNSYNKDFTDTRLFNPYKTESDIMSGKSVKPSNSNTEIKDKAIVSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFSQHVSSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMXXXXXXXXXXXXXXXXXXXXXXXGCIEIWIHPXXXXXXXXXXXXXXXXXXXXXXXNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGXXXXXXXXXXXXXXXXXWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTXXXXXXXXXHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADIRRSFRRK 4025
            MASKKNKKPDQEIYRPPKSDRSNYDVNDKSHERTFYNSNHKKKVIKSDVEEKIKKPEGQTKIASRDGKSNPYYYEGDTSGNYYNEDYGYYKYDSYSPRYPKYKDDYEYESYNDKKRYSSAHYVDDNYYQSYDSRYYKTVDYNSFKPQSKFKSYQSYSYERPYKSPDERPRQKVQTNYQKKPDKQQKVKKETKPNKPENYEDKKPVNYEYNQNVRSRQNSYNKDFTDTRLFNPYKTESDIMSGKSVKPSNSNTEIKDK IVSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFSQHVSSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMRRQQESIKRKKKKQTTTTENRKKGCIEIWIHPDDGTKEKKVTDDDDADILATFDTNDDPKQKVDRQ KEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGPLQLPADLSLLLPPLCLWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTEQAEEEEREHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADIRRSFRRK
Sbjct:    1 MASKKNKKPDQEIYRPPKSDRSNYDVNDKSHERTFYNSNHKKKVIKSDVEEKIKKPEGQTKIASRDGKSNPYYYEGDTSGNYYNEDYGYYKYDSYSPRYPKYKDDYEYESYNDKKRYSSAHYVDDNYYQSYDSRYYKTVDYNSFKPQSKFKSYQSYSYERPYKSPDERPRQKVQTNYQKKPDKQQKVKKETKPNKPENYEDKKPVNYEYNQNVRSRQNSYNKDFTDTRLFNPYKTESDIMSGKSVKPSNSNTEIKDKPIVSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDNVVTSKISDNKPTVMVRPTFSQHVSSNSTSYPTVPIMHGIQTISGFIPVQSNFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIVSKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLYRSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKDQVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPPETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLLVPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFEETRKTDEMMRRQQESIKRKKKKQTTTTENRKKGCIEIWIHPDDGTKEKKVTDDDDADILATFDTNDDPKQKVDRQFKEDYVSMPLIELHKLFTLSFLNSHGKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIMDRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETETISNNGPLQLPADLSLLLPPLCLWTDWMVTHPEYWNPPPSHRDPLLLPSIDDFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLLEENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGINPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDLDTKLKKEIDEINSTHGTNTEASNEQTSWADLTEQAEEEEREHQKRIAQLKIKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYIDYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARAKEALKFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCCQHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLKRFMEWADIRRSFRRK 1315          
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Match: SMESG000035043.1 (SMESG000035043.1)

HSP 1 Score: 182.57 bits (462), Expect = 2.322e-46
Identity = 85/91 (93.41%), Postives = 87/91 (95.60%), Query Frame = -3
Query: 5091 MAREKYNDVILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHVGEFAYQIMMLAERAFGDRARWNEATLALVKDQFWAGLS 5363
            MAREKYNDVILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHV EFAYQIMMLA+RAFGDRA WNEATL LVKDQFWA +S
Sbjct:    1 MAREKYNDVILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHVREFAYQIMMLAKRAFGDRALWNEATLTLVKDQFWAAVS 91          
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Match: SMESG000018010.1 (SMESG000018010.1)

HSP 1 Score: 130.183 bits (326), Expect = 8.161e-31
Identity = 73/185 (39.46%), Postives = 107/185 (57.84%), Query Frame = -3
Query: 4962 IPVKPYNGNPGEFPEFMSEYFQMARALGLSEPVMILRLPLYLKGMAREKYNDVILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHVGEFAYQIMMLAERAFGDRARWNEATLA---LVKDQFWAGLSSAMRNALSLHIGDNFEELTRKAVLIESSI----EKVNNFAVSANKSD 5495
            +PV  Y G+  EF +FM EY+  A A G ++PVM+ RLPLYLK  A+E    +   N    W++L+  L N+++ GD  RI+RQ+FYNR Q S E V EFA+ +  LA++AF  +    +       L++DQF  G    +R AL     +NF+EL +KA+ IE ++    +K  +FAV   K D
Sbjct:   35 LPVNQYRGDAVEFTDFMGEYYMYATAYGWTQPVMVQRLPLYLKRTAQEAGQQLDKRNIGNDWSKLKDELANKLISGDIKRIMRQKFYNRVQRSEESVSEFAHYLTTLADKAFEVKQEQPDTVKQIRELLQDQFLMGADKEIRKALCYVDFNNFDELVKKAMQIELNLKNTEKKAQSFAVIYKKRD 219          
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 130.183 bits (326), Expect = 1.409e-29
Identity = 72/191 (37.70%), Postives = 111/191 (58.12%), Query Frame = -3
Query: 4962 DFLRYPTIPVKPYNGNPGEFPEFMSEYFQMARALGLSEPVMILRLPLYLKGMAREKYNDV---ILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHVGEFAYQIMMLAERAFG---DRARWNEATLALVKDQFWAGLSSAMRNALSLHIGDNFEELTRKAVLIESSIEKVNNFAVSANKSD 5516
            D+     +PV+ Y G+P EF +F ++Y+  A A G S+ +M+ RLPLYLKG ARE +  +   ++AN    W +L+ AL  +++ GD  RI+RQ+FYNR Q   E V EFAY +  LAE+AF    ++    +    L++DQF  G+   ++ AL     +NF+EL +KA+ IE +++     A S    D
Sbjct: 1565 DYASCQKLPVQQYGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIAND---WTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAEKAFEIKPEQVDVVKQVKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTID 1752          
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 123.25 bits (308), Expect = 1.764e-27
Identity = 82/275 (29.82%), Postives = 132/275 (48.00%), Query Frame = -3
Query: 4851 DFLRYPTIPVKPYNGNPGEFPEFMSEYFQMARALGLSEPVMILRLPLYLKGMAREKYNDV---ILANHPVAWNELRVALTNRILPGDATRILRQQFYNRRQNSGEHVGEFAYQIMMLAERAFG---DRARWNEATLALVKDQFWAGLSSAMRNALSLHIGDNFEELTRKAVLIE-------------SSIEKVNNFAVSANKSD--------------------------------IECFNCHKRGHLSKDCTSKRSN--SPGDKLCTRCGRNNH 5516
            D+     +PV+ Y G+P +F +FM++Y+  A A G S+ +M+ RL L LKG ARE +  +    +AN    W +L+ AL  +++ GD  RI+RQ+FYNR Q   E V EFAY +  LA++AF    ++    +    L++DQF  G+   ++ AL     +NF+EL +K + IE             ++I++  + +VS  K++                                ++C +C K GH    C  K ++  SP    C  C R  H
Sbjct:   34 DYASCQKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIAND---WTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGH 305          
The following BLAST results are available for this feature:
BLAST of Telomerase-binding protein EST1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMG62.047e-12832.82SMG6 nonsense mediated mRNA decay factor [Source:H... [more]
SMG61.225e-7532.75SMG6 nonsense mediated mRNA decay factor [Source:H... [more]
SMG61.225e-7532.75SMG6 nonsense mediated mRNA decay factor [Source:H... [more]
SMG78.040e-1826.85SMG7 nonsense mediated mRNA decay factor [Source:H... [more]
SMG78.076e-1826.85SMG7 nonsense mediated mRNA decay factor [Source:H... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smg-61.758e-1528.43Suppressor with Morphological effect on Genitalia ... [more]
smg-61.431e-1322.65Suppressor with Morphological effect on Genitalia ... [more]
smg-71.861e-933.03SMG-7; Suppressor with Morphological effect on Gen... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Smg61.046e-2029.28gene:FBgn0039260 transcript:FBtr0084796[more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
smg63.846e-12632.51SMG6 nonsense mediated mRNA decay factor [Source:Z... [more]
smg72.684e-1726.85SMG7 nonsense mediated mRNA decay factor [Source:Z... [more]
smg72.739e-1726.85SMG7 nonsense mediated mRNA decay factor [Source:Z... [more]
smg59.657e-1224.11SMG5 nonsense mediated mRNA decay factor [Source:Z... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgme12.396e-12830.93mitochondrial genome maintenance exonuclease 1 [So... [more]
mgme18.362e-12731.34mitochondrial genome maintenance exonuclease 1 [So... [more]
mgme11.290e-12531.34mitochondrial genome maintenance exonuclease 1 [So... [more]
smg76.184e-1726.29SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg76.893e-1726.29SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smg62.842e-12830.91Smg-6 homolog, nonsense mediated mRNA decay factor... [more]
Smg63.765e-4435.11Smg-6 homolog, nonsense mediated mRNA decay factor... [more]
Smg72.713e-1726.39Smg-7 homolog, nonsense mediated mRNA decay factor... [more]
Smg72.887e-1726.39Smg-7 homolog, nonsense mediated mRNA decay factor... [more]
Smg73.069e-1726.39Smg-7 homolog, nonsense mediated mRNA decay factor... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86US8|EST1A_HUMAN9.828e-12832.82Telomerase-binding protein EST1A OS=Homo sapiens O... [more]
sp|P61406|EST1A_MOUSE1.988e-12730.91Telomerase-binding protein EST1A OS=Mus musculus O... [more]
sp|Q5RAK6|EST1A_PONAB3.304e-12731.59Telomerase-binding protein EST1A OS=Pongo abelii O... [more]
sp|Q92540|SMG7_HUMAN4.374e-1726.85Protein SMG7 OS=Homo sapiens OX=9606 GN=SMG7 PE=1 ... [more]
sp|Q5RJH6|SMG7_MOUSE2.147e-1626.39Protein SMG7 OS=Mus musculus OX=10090 GN=Smg7 PE=2... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2KZU30.000e+034.49PINc domain-containing protein OS=Opisthorchis fel... [more]
G4VE870.000e+034.02PINc domain-containing protein OS=Schistosoma mans... [more]
A0A504YEK10.000e+036.14Telomerase binding protein EST1A OS=Fasciola gigan... [more]
A0A419PZW21.472e-17736.85COP9 signalosome complex subunit 5 OS=Clonorchis s... [more]
A0A068YBR05.356e-17733.64Telomerase binding protein EST1A OS=Echinococcus m... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smg67.787e-12531.84SMG6 nonsense mediated mRNA decay factor [Source:Z... [more]
smg72.952e-1727.31SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg73.013e-1727.31SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg74.374e-1326.11SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg51.130e-1023.21SMG5 nonsense mediated mRNA decay factor [Source:N... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smg53.113e-1022.18SMG5 nonsense mediated mRNA decay factor [Source:Z... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO343797.203e-2329.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423112.189e-1124.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312233.826e-627.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smg69.481e-11731.99SMG6 nonsense mediated mRNA decay factor [Source:N... [more]
smg75.413e-1726.46SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg76.081e-1726.46SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg76.510e-1726.46SMG7 nonsense mediated mRNA decay factor [Source:N... [more]
smg54.277e-1122.77SMG5 nonsense mediated mRNA decay factor [Source:N... [more]
back to top
BLAST of Telomerase-binding protein EST1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051442.10.000e+099.85SMESG000051442.1[more]
SMESG000035043.12.322e-4693.41SMESG000035043.1[more]
SMESG000018010.18.161e-3139.46SMESG000018010.1[more]
SMESG000080881.11.409e-2937.70SMESG000080881.1[more]
SMESG000057446.11.764e-2729.82SMESG000057446.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018250 ID=SMED30018250|Name=Telomerase-binding protein EST1A|organism=Schmidtea mediterranea sexual|type=transcript|length=5941bp
CCTTCTGGCTTTTAAATCTTTATTTTCTAAGTATACTGCTTAAATCTATT
TATAAGAATTATTTTTAAATTAATTTATCAATGGCATCTAAAAAAAATAA
GAAACCAGATCAAGAAATATATAGACCACCTAAATCTGATAGGTCTAATT
ATGATGTAAATGATAAAAGCCACGAAAGAACATTTTATAATTCTAATCAT
AAAAAGAAGGTTATTAAATCGGACGTTGAAGAGAAGATTAAAAAGCCAGA
AGGCCAAACTAAAATTGCTTCCAGAGATGGGAAGTCGAATCCATACTATT
ATGAAGGAGACACTAGTGGAAATTATTATAACGAAGATTATGGATATTAT
AAATATGACTCTTATTCACCAAGATATCCTAAATATAAAGATGATTATGA
ATATGAAAGCTATAATGACAAAAAAAGGTACAGCAGTGCTCATTATGTTG
ATGATAATTATTACCAATCGTATGACTCTCGTTATTACAAAACAGTTGAT
TATAATTCTTTTAAACCGCAATCTAAATTTAAAAGTTATCAATCATATTC
ATACGAAAGACCTTATAAATCTCCAGATGAAAGACCTCGCCAAAAAGTCC
AGACTAATTATCAAAAAAAACCTGATAAACAGCAAAAAGTTAAAAAAGAA
ACAAAACCTAATAAACCAGAAAATTATGAAGATAAAAAACCTGTGAATTA
TGAATACAATCAAAATGTTCGCAGTCGTCAAAATTCTTACAACAAAGATT
TCACAGATACTCGGTTATTTAACCCGTATAAAACCGAGTCTGACATAATG
AGTGGTAAATCAGTAAAACCCAGCAATTCTAATACAGAAATTAAAGACAA
AGCAATTGTCTCATTGGAATCCGATTCTCATATCCACGGAGGATTGATTC
ATTTACCAGAGAATTTAGAAATTAAAAAATCTGGCAGTGTTTCCCAAATT
AATTCTCCAGCAGTAGCAGCGTCTGACAATGTGGTAACTTCGAAAATCAG
TGATAACAAACCGACTGTGATGGTTAGACCGACATTTTCACAACATGTTT
CGTCGAATTCCACATCCTACCCCACAGTTCCGATAATGCATGGAATCCAA
ACTATTTCTGGGTTCATTCCAGTTCAGTCGAATTTCATAACGCCAGGAAC
AATAAATTTAATGCGAGCACCACCATCAACATTAACGACACCGCATATTA
TGTCCCCTCTTAGATTTACCTCTCATCAGATGGTTCATACTCCCGATGAC
CCTGCTCTCTACACATTGTCAAATATAGTCAGCAAATCGCCTGTAGTTGT
CCATTGTGTTAATCAAATCAAATCATTGGAAATGCAATTAGACGTTATGA
TCAGATCATCTTGTGATATATCTTCACCTGATTGGTGGCAATCTGTTAAC
AGTGTCAGATCAGAGCTCATGGATCTCTACCGATCTGTAATTACGAGCGA
TCTCGATTATTGTAATCAAGCTGGCATTGAACAAAATTTATGGAAATCAG
TTTTCTATTCCATAATGGAACTGATCCGTGCATTTATCAATAATCCCGAT
ACAATTGCTTTACCTCAAAATCAAAAAGACCAAGTGAGTAAAATTAAAAT
GAGCGTCACCGGTCACGGTCAGAATATTTTACAATCTGGTGAGGAGTACT
TTATCAGTATTTTCACCGACATTTCTAAATTGCACAATATCGATTTGGAG
GTAATTTTTGACAGTAGGCGCCCGCCACCAGAAACTGGATCTCGAACTAG
AAAACTCGTATATTTGAGTGCTCAAAAGTTGTTGTTGTTCCTTGGAGATT
TAGCTCGATATTCAGAAATGATCAATAACTCATCAGATTTTACAAAAGCA
CGAATTTGGTATCTGAAAGCTCAATTGCTTGTACCAAAAAATGGTAGACC
TTACAATCAACTGGCAGTGATATCCATTTATGCAAATCGTCATTTAGATG
CATTGTATTATTATACTCGTACATTGGCTGCCAGTAATCCATTTCCTACT
GCGTCTCAAAGTCTTTCATTTCTCTTTGAAGAAACTCGGAAAACCGATGA
AATGATGCGGCGACAACAGGAATCTATTAAACGGAAAAAAAAGAAACAAA
CTACAACAACGGAAAACCGTAAAAAAGGCTGTATTGAAATATGGATTCAT
CCAGATGATGGAACCAAAGAAAAGAAAGTTACAGATGACGACGATGCAGA
CATTTTAGCGACATTTGACACAAATGACGATCCAAAACAAAAAGTCGACA
GGCAAATCAAAGAAGATTACGTCAGTATGCCTCTAATTGAATTACACAAA
CTGTTCACGTTGTCCTTCCTTAATAGTCACGGGAAACTATTTGGAAAAAT
TAATATGGAAAATTTTCCCGAAGTTTGCTCAACAATGCTCCAGGAATTCT
GGGCATTATTGTCTCACCAACCCTGTCCATTATCAAGTTATCGCCTGTGC
AACATATTGATCATAAATATGTATATTATGGACCGAGTTAGTCAACAGGC
ATCGGTCGTTAACAATTACGCTTTAAGATCATTACACCAAGATCATGCTT
CGCGAATGACATTAGATTTCTTTGCGCTTCTTTGTCAAAGAGCCATTGAA
ATATTTGATGAGTGGGCAGAGACTGAGACTATATCAAATAATGGCCCTCT
TCAATTACCGGCTGATTTAAGCTTGTTATTACCGCCTTTATGCCTATGGA
CAGACTGGATGGTTACACATCCTGAGTATTGGAATCCACCTCCTAGTCAT
CGTGATCCATTACTTCTTCCCAGTATCGATGACTTTGGTCTAATTTCAAA
ACTTTGTACTAAAGTTAACCGGCTTGTTGAAAGAGGTACTCCGGCATTAA
GCCGGCCACACTATCGAGTATTATCCGATTCTAAAGAAGCAGACAAAGCA
ATTAATAATAAAAAAACATTTGTTTTGCTCGAAGAAAACCTAATCAGCGG
ATTTCTTCCGATGCTTGACCAAATACCTAAAATTTATTTATTAGAAGATG
ATAAATGGACAAAAGAACAAACAGATGATTGGATTCATCTGGAAAAATTA
TCACTATTTGGTGATTTCTTGTGCGGTATTAATCCGCCGTTATTGGATTA
CAATGTCGATAGTTGTACTTACATACCTACTGTGATAAAAGAGGGCTCTG
AACGGCTGCAGGATGGAATTGATGCAAAAGACAAAAATGAAGTTATTATT
GAGGATCCGATTGATTCTGATGAAGATCTCGATACGAAATTGAAAAAAGA
AATCGATGAAATCAATTCAACTCATGGAACCAATACAGAAGCATCCAACG
AACAGACTTCATGGGCTGATTTAACAGAACAGGCTGAAGAAGAAGAAAGA
GAACATCAAAAGCGTATTGCACAGTTGAAAATCAAACGTGCAAATTTAAA
ATTTAAAGAAGAAAAAAATCGTCGATTTGAATTATGGCGCAAATCTTTGC
TCGATCATGAAATAGCGCAGAGATTTGTAGAATTAGAAATCCGTCCTTTA
TTCCTAGTTCTCGACACGAATTGCTATATCGATTATTTATCCAACATTAA
ACTGCTCATCGATCATAAAAAGTTCATTATAATCGTTCCGTTGATAGTTG
TAAATGAATTAGAAAATCTCTCAAAAACATATCAATTAAAAGACGACGTT
GACATACATGCCAGAGCAAAGGAAGCTTTGAAATTTCTAGAGGAAAAGTT
CGATAAAGCTGATCAATATGTTAGAGCAATAACATCTCGTGGAACCTTTA
TGGAAACGATTGCATATCGAGCTGAAGCTGTCAGTTGGTCAGAAGGTGAA
ACCAATGATGATGTCATTCTCAATTGCTGTCAGCATCTGTGCAAGGATAA
ACCCGTTGATTTCATGCCTAGAGAGAAAGATAAACCTATAACTCTCCATC
GCGACGTTGTTCTGTTAACTGGAGATCGTAACTTGCGTCTGAAAGCTCTC
AGTCGACATATTCCAGTGAAACCACTGAAAAGATTTATGGAATGGGCAGA
TATCAGAAGAAGTTTTCGTAGAAAATAGAATATTTTGAATCAGATTTCAT
TGATATTTTATAACAGCTATAAGGAGTGAATCTTTATTGTCATAGGAATC
GCAGCTGCCTATGAATATAAATATATATATATATAGTGTAATATTGATCA
TCATCATCATCATCATTGGGTCAGCACATTCTGATTTATTGGCTAGATCG
ATTAGATTTTCTGAGCCTTCAATGGTGCATCAACAGTTCTATTCGATATC
TGCACATTATTTCCCGGATTATCTATGCAGCTTCTCTTCGTTTTATCGTC
ATGTTTCCTTGTTGACATTGAAATAGTTCCTCTTTAAATTGTGATTCGAT
GTTTTACAGATGTTTTTGTGTGTGTGTGTGTGTGTATCGGTGAGCTTTGT
ATAAATTTGGATTTTTTACTCAATATTATTGTGATCATTATCAATTTATC
GATAAATTAATGAGAGTTGTACGGATATAAATATTTTGCGTTTGCTGTTT
TTATTATTATTATTAGTATTAGCATTGTTATTGTTATTATTATTGTTGTT
ATTGACATTACCCATCTGATTCTGTGGACAAGAACGCATCATATGACCAA
ATTTTCCACATTTATGACACTTTACTTTACCTGTCGAATTTACCTCATCT
CTCTGTACATTATTATTTCGATAATTATTATTATTATTATTACTTTGAAA
ACCTCGATTTGAATTCCTATTATTATTATTATTATTAAAATTATTACCCT
GAGAATTTCCCCCGAATTTAGTTTTGCAAACTGACGCTACATGTCCCTTT
CGTTTACATTTATCGCAGCTTAAGTCCGAACATTTACAATCAATAGCGAG
ATGATTATTTCTCCCACATCTGGTACATAATTTATCCCCTGGTGAATTAC
TCCTCTTACTAGTACAATCTTTAGATAGATGTCCTCTTTTATGACAATTA
AAACACTCTATATCAGATTTATTCGCGCTAACTGCAAAATTATTTACTTT
CTCTATACTACTTTCTATTAAAACCGCTTTTCTCGTTAACTCTTCAAAAT
TATCGCCTATATGTAAACTCAATGCATTTCTCATGGCCGATGATAGACCT
GCCCAAAACTGGTCTTTAACTAATGCAAGGGTAGCCTCATTCCAACGGGC
TCTATCTCCAAATGCTCGTTCAGCTAGCATCATGATTTGATACGCAAATT
CTCCAACATGCTCACCCGAATTCTGTCGTCTATTGTAAAATTGCTGTCGT
AATATTCTCGTGGCATCCCCCGGTAAGATTCTGTTCGTTAATGCTACTCT
AAGCTCATTCCACGCTACTGGGTGGTTTGCTAAAATGACATCATTATATT
TTTCACGCGCCATACCTTTTAGATATAAGGGCAATCTTAAAATCATAACC
GGTTCAGAGAGGCCTAATGCTCTCGCCATTTGAAAATATTCGGACATAAA
CTCAGGAAATTCACCTGGATTTCCATTATATGGTTTTACTGGTATTGTTG
GGTATCTCAAAAAATCCGCCGCTGGTGGTTGCTCTGGTATATTATTAACA
TTCGGTAAATTATTAACATTGGCCTATTTAGAGAATAGAATTTTCAATTT
GCCAATTTCCCATTAAATTTTCAAGTACTCTACGACATAATTTAGTAAAA
CTTTCAAGGACCCTACAGATTTGACATTTTTCCCAGCCAATTGGTTAATT
ATAGTTCGGAAATGGAGTCCCCAAGGTTTCTGTTAATTTGCTATTAATTT
GGTCGGCGAATAAACAATGTATCCGAAGAATGACATTTTTAATGAGCTAA
ATCGAGTTCAATTGTCTGTTCTTTTCTAATTTCCACATCTTCTCGGCAAA
ATTATACAAAGGTTTGATTTCTCCATGAAGAATATGGCGACATTTACCTA
TATTATAGTGTTGAAATTCGATGAAATAAAATACTATGCGC
back to top

protein sequence of SMED30018250-orf-1

>SMED30018250-orf-1 ID=SMED30018250-orf-1|Name=SMED30018250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1316bp
MASKKNKKPDQEIYRPPKSDRSNYDVNDKSHERTFYNSNHKKKVIKSDVE
EKIKKPEGQTKIASRDGKSNPYYYEGDTSGNYYNEDYGYYKYDSYSPRYP
KYKDDYEYESYNDKKRYSSAHYVDDNYYQSYDSRYYKTVDYNSFKPQSKF
KSYQSYSYERPYKSPDERPRQKVQTNYQKKPDKQQKVKKETKPNKPENYE
DKKPVNYEYNQNVRSRQNSYNKDFTDTRLFNPYKTESDIMSGKSVKPSNS
NTEIKDKAIVSLESDSHIHGGLIHLPENLEIKKSGSVSQINSPAVAASDN
VVTSKISDNKPTVMVRPTFSQHVSSNSTSYPTVPIMHGIQTISGFIPVQS
NFITPGTINLMRAPPSTLTTPHIMSPLRFTSHQMVHTPDDPALYTLSNIV
SKSPVVVHCVNQIKSLEMQLDVMIRSSCDISSPDWWQSVNSVRSELMDLY
RSVITSDLDYCNQAGIEQNLWKSVFYSIMELIRAFINNPDTIALPQNQKD
QVSKIKMSVTGHGQNILQSGEEYFISIFTDISKLHNIDLEVIFDSRRPPP
ETGSRTRKLVYLSAQKLLLFLGDLARYSEMINNSSDFTKARIWYLKAQLL
VPKNGRPYNQLAVISIYANRHLDALYYYTRTLAASNPFPTASQSLSFLFE
ETRKTDEMMRRQQESIKRKKKKQTTTTENRKKGCIEIWIHPDDGTKEKKV
TDDDDADILATFDTNDDPKQKVDRQIKEDYVSMPLIELHKLFTLSFLNSH
GKLFGKINMENFPEVCSTMLQEFWALLSHQPCPLSSYRLCNILIINMYIM
DRVSQQASVVNNYALRSLHQDHASRMTLDFFALLCQRAIEIFDEWAETET
ISNNGPLQLPADLSLLLPPLCLWTDWMVTHPEYWNPPPSHRDPLLLPSID
DFGLISKLCTKVNRLVERGTPALSRPHYRVLSDSKEADKAINNKKTFVLL
EENLISGFLPMLDQIPKIYLLEDDKWTKEQTDDWIHLEKLSLFGDFLCGI
NPPLLDYNVDSCTYIPTVIKEGSERLQDGIDAKDKNEVIIEDPIDSDEDL
DTKLKKEIDEINSTHGTNTEASNEQTSWADLTEQAEEEEREHQKRIAQLK
IKRANLKFKEEKNRRFELWRKSLLDHEIAQRFVELEIRPLFLVLDTNCYI
DYLSNIKLLIDHKKFIIIVPLIVVNELENLSKTYQLKDDVDIHARAKEAL
KFLEEKFDKADQYVRAITSRGTFMETIAYRAEAVSWSEGETNDDVILNCC
QHLCKDKPVDFMPREKDKPITLHRDVVLLTGDRNLRLKALSRHIPVKPLK
RFMEWADIRRSFRRK*
back to top

protein sequence of SMED30018250-orf-2

>SMED30018250-orf-2 ID=SMED30018250-orf-2|Name=SMED30018250-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MSEYFQMARALGLSEPVMILRLPLYLKGMAREKYNDVILANHPVAWNELR
VALTNRILPGDATRILRQQFYNRRQNSGEHVGEFAYQIMMLAERAFGDRA
RWNEATLALVKDQFWAGLSSAMRNALSLHIGDNFEELTRKAVLIESSIEK
VNNFAVSANKSDIECFNCHKRGHLSKDCTSKRSNSPGDKLCTRCGRNNHL
AIDCKCSDLSCDKCKRKGHVASVCKTKFGGNSQGNNFNNNNNNRNSNRGF
QSNNNNNNYRNNNVQRDEVNSTGKVKCHKCGKFGHMMRSCPQNQMGNVNN
NNNNNNNNANTNNNNKNSKRKIFISVQLSLIYR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0004521endoribonuclease activity
GO:0016787hydrolase activity
GO:0042162telomeric DNA binding
GO:0043021ribonucleoprotein complex binding
GO:0046872metal ion binding
GO:0070034telomerase RNA binding
GO:0070182DNA polymerase binding
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC
IPR002716PIN_dom
IPR011990TPR-like_helical_dom_sf
IPR029060PIN-like_dom_sf
IPR018834DNA/RNA-bd_Est1-type
IPR019458EST1
Vocabulary: biological process
TermDefinition
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000723telomere maintenance
GO:0006406mRNA export from nucleus
GO:0032210regulation of telomere maintenance via telomerase
GO:0035303regulation of dephosphorylation
GO:0043487regulation of RNA stability
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
GO:1904354negative regulation of telomere capping
Vocabulary: cellular component
TermDefinition
GO:0000781chromosome, telomeric region
GO:0005634nucleus
GO:0005694chromosome
GO:0005697telomerase holoenzyme complex
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol