serine/threonine-protein kinase MARK2-like

Overview
Nameserine/threonine-protein kinase MARK2-like
Smed IDSMED30018245
Length (bp)2185
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serine/threonine-protein kinase MARK2-like (SMED30018245) t-SNE clustered cells

Violin plots show distribution of expression levels for serine/threonine-protein kinase MARK2-like (SMED30018245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serine/threonine-protein kinase MARK2-like (SMED30018245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serine/threonine-protein kinase MARK2-like (SMED30018245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30018245SMESG000024843.1 dd_Smed_v4_5670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018245SMESG000024843.1 dd_Smed_v4_5670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Match: HUNK (hormonally up-regulated Neu-associated kinase [Source:HGNC Symbol;Acc:HGNC:13326])

HSP 1 Score: 119.783 bits (299), Expect = 2.789e-27
Identity = 83/264 (31.44%), Postives = 132/264 (50.00%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLID---------VKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPM-MEISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN-NY 2099
            +L  G F KV       +G++V +K +ID         V  +L RE  I  ++    + +  +++  E + +L M   PGG L   I + K L E+E  R   Q+++ +  LH++ ++H D+K EN++ D + N+KLIDFGL+   G     D      ++  G+  Y APEL        KID+WS G+ M  M+TG LPF V  P  +     K++  E  P+  ++S     F+   L  DP  RP  QQ + ++ +N NY
Sbjct:   67 KLGEGSFAKVREGLHVLTGEKVAIK-VIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNCAGILGYSDPF----STQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVE-PFSLRALYQKMVDKEMNPLPTQLSTGAISFLRSLLEPDPVKRPNIQQALANRWLNENY 324          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Match: PAK5 (p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;Acc:HGNC:15916])

HSP 1 Score: 118.242 bits (295), Expect = 7.651e-27
Identity = 77/255 (30.20%), Postives = 138/255 (54.12%), Query Frame = 3
Query: 1332 NLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILF------DKELIKYSE-VIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            N  ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++       D  +  YS  ++ DE  + + M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  451 NFIKIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDE--LWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELL 695          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Match: PAK5 (p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;Acc:HGNC:15916])

HSP 1 Score: 118.242 bits (295), Expect = 7.651e-27
Identity = 77/255 (30.20%), Postives = 138/255 (54.12%), Query Frame = 3
Query: 1332 NLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILF------DKELIKYSE-VIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            N  ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++       D  +  YS  ++ DE  + + M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  451 NFIKIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDE--LWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELL 695          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Match: PAK5 (p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;Acc:HGNC:15916])

HSP 1 Score: 118.242 bits (295), Expect = 7.651e-27
Identity = 77/255 (30.20%), Postives = 138/255 (54.12%), Query Frame = 3
Query: 1332 NLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILF------DKELIKYSE-VIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            N  ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++       D  +  YS  ++ DE  + + M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  451 NFIKIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDE--LWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELL 695          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 110.923 bits (276), Expect = 1.069e-26
Identity = 70/247 (28.34%), Postives = 134/247 (54.25%), Query Frame = 3
Query: 1362 GKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKY--SEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIES 2081
            G V+   D  +G++V +K++ +++    +E++I  IL  +E     ++ Y  S ++ DE  + + M YL GG+LT  + +  C+ E ++  +  + L  +  LH +++IH DIK +NI+   + +VKL DFG    I   +SK      +++  GT  +MAPE+        K+DIWS G++ +EM+ G+ P+    P + L  +      E +   ++S   + F++ CL +D   R +A++L+++
Sbjct:    4 GTVYTAMDVATGQEVAIKQM-NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDE--LWVVMEYLAGGSLTDVVTE-TCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK------RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQA 240          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 112.079 bits (279), Expect = 5.701e-25
Identity = 89/288 (30.90%), Postives = 139/288 (48.26%), Query Frame = 3
Query: 1323 DFENLNE---LANGGFGKVFICEDKKSGKQVVMKKLIDVK-----DSLHREILIGSILFDKELIKY---SEVIRDEKNIH--LTMPYLPGGTLTSNIQ-QLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNV-KLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNS--VKIDIWSFGMVMVEMVTGQLPFNVM-GPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 2132
            +  N NE   L  G +G V+   D  + +Q+V+K+ I+VK       L  EI + S L    +++Y     V +D  N H  + M ++PGG+L+S ++ +   + EN +     QIL  +  LH+ KI+H DIK +N++ +    V K+ DFG  K +              +  GT+ YMAPE+            DIWSFG  MVEM TG+ PF  M  P   + R+G    +   P  EI+   + FI  C   +   RP+A+ L++   I +    T+  + NK
Sbjct:  646 ELSNSNERVVLGKGTYGTVYAARDMDTQRQIVVKE-IEVKYDEEVQPLMEEISLHSTLCHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLAGLNPV------TETFTGTLQYMAPEVIDHGQRGYGAPADIWSFGCTMVEMATGRPPFVEMQNPQAAMFRVGMFKTHPPIP-TEITEKCRNFIKSCFLPEACDRPSAKDLLQDPFIYHNHHSTRSGSINK 925          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 106.301 bits (264), Expect = 6.747e-25
Identity = 74/268 (27.61%), Postives = 121/268 (45.15%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKLI-------DVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQ 2105
            DFE    L  G FG V++   K     V +K L         V+  L REI I S L    +IK      D K I+L + Y PGG +   +   K   E    +  ++I   +S  H+  +IH DIKPEN++  ++  +K+ DFG + +         S KR+    GT++Y+ PE+     +S  +D+W+ G++  E + G+ PF      +    + K  ++ +     +    +  I   L VDP  R T +Q+ E   I   ++
Sbjct:   29 DFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHA-------PSNKRQTMC-GTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAI-KAARFTYPD--SVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMME 285          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 109.768 bits (273), Expect = 7.120e-25
Identity = 76/262 (29.01%), Postives = 138/262 (52.67%), Query Frame = 3
Query: 1311 SKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKY--SEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            S + D++ + E + G    V     K S KQ+V  K ++++    RE+L   +   ++     ++++  S ++ DE  + + M ++ GG+LT  +   + + E ++  IS Q+L  +  LH  K+IH DIK ++I+   +  VKL DFG    +    S+++ R+R  S  GT  + A E+   +P   + DIWSFG++++EMV G+ PF    P Q + R+    +  F    ++S +L + +S C+  D N R  A+ L+
Sbjct:  229 SDLTDYKQIGEGSTG----VVEAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSILRQYQHPNIVRFFSSHLVDDE--LWVVMEFMEGGSLTDIVTATR-MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQL----SEEVPRRR--SLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLL 477          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 109.383 bits (272), Expect = 7.610e-25
Identity = 76/262 (29.01%), Postives = 138/262 (52.67%), Query Frame = 3
Query: 1311 SKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKY--SEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            S + D++ + E + G    V     K S KQ+V  K ++++    RE+L   +   ++     ++++  S ++ DE  + + M ++ GG+LT  +   + + E ++  IS Q+L  +  LH  K+IH DIK ++I+   +  VKL DFG    +    S+++ R+R  S  GT  + A E+   +P   + DIWSFG++++EMV G+ PF    P Q + R+    +  F    ++S +L + +S C+  D N R  A+ L+
Sbjct:  227 SDLTDYKQIGEGSTG----VVEAAYKISTKQIVAVKRMNLRKQQRRELLFNEVSILRQYQHPNIVRFFSSHLVDDE--LWVVMEFMEGGSLTDIVTATR-MTEPQIATISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQL----SEEVPRRR--SLVGTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLL 475          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 105.531 bits (262), Expect = 2.406e-24
Identity = 74/274 (27.01%), Postives = 127/274 (46.35%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVK------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVF---DNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMM--EISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            DF ++  L  G F KVF+ E K    Q+   K ID K      +SL  EI +   L    +++  +   +++ ++L M  + GG L   I       E +   +  Q+L  +  +H + ++H D+KPEN+++   D +  + + DFGL        SK       A++ GT  Y+APE+ ++ P    +D+WS G++   ++ G  PF       +  ++ K  +YEF      +IS+  K FI+  +  DP  R T Q  +    I+     T
Sbjct:   23 DFRDV--LGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLENEIKVLRKLRHNNIVQLFDTYDEKQFVYLVMELVTGGELFDRIVAKGSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLYYNQDEDSKIMISDFGL--------SKTEDSGVMATACGTPGYVAPEVLQQKPYGKAVDVWSIGVIAYILLCGYPPFYDESDANLFAQIIK-GEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHPWISGNTAYT 285          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 117.472 bits (293), Expect = 5.398e-27
Identity = 78/258 (30.23%), Postives = 137/258 (53.10%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE------LIKYSE-VIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            + ++ N++  G  G V I  DK +G+QV +KK+ D++    RE+L   ++  ++      +  YS  ++ DE  + + M YL GG LT  +   + + E ++  +  Q L  ++ LH   +IH DIK ++I+   +  VKL DFG    +    S++L +++  S  GT  +M+PE+    P   ++DIWS G++++EMV G+ PF    P Q + R+  +     K   ++S  L+ F+   L  DP  R TA +L+
Sbjct:  367 NLDHFNKIGEGSTGTVCIATDKSTGRQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHPNIVETYSSFLVNDE--LWVVMEYLEGGALTDIVTHSR-MDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQV----SQELPKRK--SLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSPRLQSFLDRMLVRDPAQRATAAELL 614          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 114.005 bits (284), Expect = 7.769e-26
Identity = 70/256 (27.34%), Postives = 134/256 (52.34%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            +  + ++  G  G V+   +  +G +V +K++ ++     +E++I  IL  +E     ++ Y +     + + + M YLPGG+LT  + +  C+ E ++  +  ++L  +  LH +++IH DIK +NI+   + +VKL DFG    I   +SK      + +  GT  +MAPE+        K+D+WS G++ +EMV G+ P+    P + L  +    K E K   ++S+  + F+  CL V+ + R +A  L++
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQM-NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSK------RTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 114.005 bits (284), Expect = 7.769e-26
Identity = 70/256 (27.34%), Postives = 134/256 (52.34%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            +  + ++  G  G V+   +  +G +V +K++ ++     +E++I  IL  +E     ++ Y +     + + + M YLPGG+LT  + +  C+ E ++  +  ++L  +  LH +++IH DIK +NI+   + +VKL DFG    I   +SK      + +  GT  +MAPE+        K+D+WS G++ +EMV G+ P+    P + L  +    K E K   ++S+  + F+  CL V+ + R +A  L++
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQM-NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSK------RTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 114.005 bits (284), Expect = 7.769e-26
Identity = 70/256 (27.34%), Postives = 134/256 (52.34%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            +  + ++  G  G V+   +  +G +V +K++ ++     +E++I  IL  +E     ++ Y +     + + + M YLPGG+LT  + +  C+ E ++  +  ++L  +  LH +++IH DIK +NI+   + +VKL DFG    I   +SK      + +  GT  +MAPE+        K+D+WS G++ +EMV G+ P+    P + L  +    K E K   ++S+  + F+  CL V+ + R +A  L++
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQM-NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSK------RTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 114.005 bits (284), Expect = 7.769e-26
Identity = 70/256 (27.34%), Postives = 134/256 (52.34%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKE-----LIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            +  + ++  G  G V+   +  +G +V +K++ ++     +E++I  IL  +E     ++ Y +     + + + M YLPGG+LT  + +  C+ E ++  +  ++L  +  LH +++IH DIK +NI+   + +VKL DFG    I   +SK      + +  GT  +MAPE+        K+D+WS G++ +EMV G+ P+    P + L  +    K E K   ++S+  + F+  CL V+ + R +A  L++
Sbjct:  430 YTKMEKIGQGASGTVYTAIESSTGMEVAIKQM-NLSQQPKKELIINEILVMRENKHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTET-CMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSK------RTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLK 677          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Match: stk24a (serine/threonine kinase 24a (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070424-52])

HSP 1 Score: 124.02 bits (310), Expect = 6.728e-30
Identity = 85/270 (31.48%), Postives = 140/270 (51.85%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDS------LHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L  +  G FG+VF   D ++ K VV  K+ID++++      + +EI + S      + KY      +  + + M YL GG+   ++     L E  +  I  +IL  +  LH  K IH DIK  N++   + +VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+  E  P +E   +  LK+F+  CL  DPN RPTA++L++ +LI  Y + T
Sbjct:   17 FTKLERIGKGSFGEVFKGIDNRTQK-VVAIKIIDLEEAEDEVEDIQQEITVLSQCDSLFITKYFGSYLKDTKLWIIMEYLGGGSAL-DLLGPGALDETHIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSEYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLF----LIPKENPPTLEGNYNKALKEFVDACLNKDPNFRPTAKELLKHKLIVRYSKKT 274          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Match: pak6a (p21 protein (Cdc42/Rac)-activated kinase 6a [Source:ZFIN;Acc:ZDB-GENE-130410-1])

HSP 1 Score: 122.865 bits (307), Expect = 1.081e-28
Identity = 81/259 (31.27%), Postives = 137/259 (52.90%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDK--------ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
             EN  ++  G  G V I  +K SG+ VV  K++D++    RE+L   ++  +        E+ K + V   E+ + + M YL GG LT+ + + + L E ++  +   +L  ++ LH   +IH DIK ++I+   +  +KL DFG    I    SKD+ +++  S  GT  +MAPE+  + P   ++D+WS G+++VEMV G+ P+    P   + RL   L    + + ++S  LK F+   LT DP  R +A  L+E
Sbjct:  319 LENFVKIGEGSTGVVCIAREKHSGR-VVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMFKSALV---EEELWVIMEYLQGGALTNIVSETR-LSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLSLDGRIKLSDFGFCAQI----SKDIPKRK--SLVGTPYWMAPEVISKSPYGTEVDVWSLGIMVVEMVDGEPPYFSETPVAAMKRLRDELAPTVRNVHQVSPMLKDFLDRMLTRDPLERASATDLLE 566          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Match: pak6a (p21 protein (Cdc42/Rac)-activated kinase 6a [Source:ZFIN;Acc:ZDB-GENE-130410-1])

HSP 1 Score: 122.865 bits (307), Expect = 1.730e-28
Identity = 81/259 (31.27%), Postives = 137/259 (52.90%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDK--------ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
             EN  ++  G  G V I  +K SG+ VV  K++D++    RE+L   ++  +        E+ K + V   E+ + + M YL GG LT+ + + + L E ++  +   +L  ++ LH   +IH DIK ++I+   +  +KL DFG    I    SKD+ +++  S  GT  +MAPE+  + P   ++D+WS G+++VEMV G+ P+    P   + RL   L    + + ++S  LK F+   LT DP  R +A  L+E
Sbjct:  419 LENFVKIGEGSTGVVCIAREKHSGR-VVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMFKSALV---EEELWVIMEYLQGGALTNIVSETR-LSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLSLDGRIKLSDFGFCAQI----SKDIPKRK--SLVGTPYWMAPEVISKSPYGTEVDVWSLGIMVVEMVDGEPPYFSETPVAAMKRLRDELAPTVRNVHQVSPMLKDFLDRMLTRDPLERASATDLLE 666          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Match: si:ch211-197l9.5 (si:ch211-197l9.5 [Source:ZFIN;Acc:ZDB-GENE-091204-323])

HSP 1 Score: 118.627 bits (296), Expect = 2.225e-28
Identity = 83/258 (32.17%), Postives = 129/258 (50.00%), Query Frame = 3
Query: 1353 GGFGKVFICEDKKSGKQVVMKKLIDVKDS---------LHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYI-GDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPM-MEISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN 2093
            G F KV +  +  +G++V +K +ID K +         + RE  I  ++    ++   E +  E   ++ M    GG L   I + K L E EV R + QIL+ +  LH+  I+H D+K EN + D   N+K++DFGL+  + GD  S DL      +  G+  Y APEL        K+D+WS G+ M  M+TG LPF V  P  I     K++  E  P+  +IS    +F+   L  +P  RPT +  +E + +N
Sbjct:   56 GSFAKVMLGMNISTGEKVAIK-VIDKKKARQDSYVLKNMKREPRIHQLIRHPNIVLLLETLETENCYYMAMELCGGGDLMDRICERKRLDEREVRRFTRQILSAVEHLHRHGIVHRDLKIENFLLDEHNNIKIVDFGLSNTLKGDSLSVDLLN----TQCGSPAYAAPELLAHKKYGPKVDVWSVGVSMFAMLTGTLPFTV-EPFNIKQLHQKMVNGEISPIPSDISKAAVEFVLSLLEPEPAKRPTVKAAMEDKWLN 307          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 116.316 bits (290), Expect = 3.475e-28
Identity = 80/265 (30.19%), Postives = 130/265 (49.06%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKL-IDVK---------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASS-PGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMM--EISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNY 2099
            L  G +G V+ C     G+ + +K++ +D           D L RE+ +   L    ++ +      E  + + M Y+PGG++++ + Q   L E   V  S QIL  ++ LH +++IH D+K  NI+      VKLIDFG A+ +   ++   S+     S  GT  +MAPE+  E  +  K DIWS G  + EM TG+ P   M     L  +G   +    P +  + S D K F+  CLT D   RP+A++L+    I+++
Sbjct:   27 LGKGAYGTVY-CGLTSQGQLIAVKQVALDASTSEIAEKEYDRLEREVDLLKNLKHTNIVGFLGTALSENIVSIFMEYIPGGSISNILGQFGPLPEKVFVLYSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGVVKLIDFGCARRLSCLQTSTGSKGDLLKSVHGTPYWMAPEVINETGHGRKSDIWSIGCTVFEMATGKPPLAHMNKMAALYYIGA--RRGLMPSLSDDFSTDAKDFVQACLTRDQRQRPSAEELLRHPFISHH 288          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Match: bri3bp (BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-943691])

HSP 1 Score: 117.472 bits (293), Expect = 1.260e-26
Identity = 75/252 (29.76%), Postives = 136/252 (53.97%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  435 KIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKDVHQVSSVLRGFLDLMLVREPSQRATAQELL 676          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Match: bri3bp (BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-943691])

HSP 1 Score: 117.472 bits (293), Expect = 1.426e-26
Identity = 75/252 (29.76%), Postives = 136/252 (53.97%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  464 KIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKDVHQVSSVLRGFLDLMLVREPSQRATAQELL 705          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Match: bri3bp (BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-943691])

HSP 1 Score: 117.472 bits (293), Expect = 1.437e-26
Identity = 75/252 (29.76%), Postives = 136/252 (53.97%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  489 KIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKDVHQVSSVLRGFLDLMLVREPSQRATAQELL 730          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Match: bri3bp (BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-943691])

HSP 1 Score: 117.087 bits (292), Expect = 1.485e-26
Identity = 75/252 (29.76%), Postives = 136/252 (53.97%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  437 KIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKDVHQVSSVLRGFLDLMLVREPSQRATAQELL 678          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Match: bri3bp (BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-943691])

HSP 1 Score: 117.087 bits (292), Expect = 1.536e-26
Identity = 75/252 (29.76%), Postives = 136/252 (53.97%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  452 KIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLRALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRVKDVHQVSSVLRGFLDLMLVREPSQRATAQELL 693          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Match: Pak7 (p21 (RAC1) activated kinase 7 [Source:MGI Symbol;Acc:MGI:1920334])

HSP 1 Score: 118.627 bits (296), Expect = 4.105e-27
Identity = 75/257 (29.18%), Postives = 139/257 (54.09%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKEL-------IKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
             +N  ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++        +  S ++ DE  + + M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  449 LDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDE--LWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELL 695          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Match: Pak7 (p21 (RAC1) activated kinase 7 [Source:MGI Symbol;Acc:MGI:1920334])

HSP 1 Score: 118.627 bits (296), Expect = 4.105e-27
Identity = 75/257 (29.18%), Postives = 139/257 (54.09%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKEL-------IKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
             +N  ++  G  G V I  +K +GKQV +KK+ D++    RE+L   ++  ++        +  S ++ DE  + + M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EM+ G+ P+    P Q + R+   L    K + ++S+ L+ F+   L  +P+ R TAQ+L+
Sbjct:  449 LDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM-DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDE--LWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELL 695          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Match: Gm4922 (predicted gene 4922 [Source:MGI Symbol;Acc:MGI:3644318])

HSP 1 Score: 115.931 bits (289), Expect = 9.926e-27
Identity = 86/293 (29.35%), Postives = 145/293 (49.49%), Query Frame = 3
Query: 1290 MTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVK--DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGL-AKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDP-NSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGK-LLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKK---YNSNK*FSF 2144
            ++ FE       +  L  L+  G  +V +C    +G  V +K L   +  +    E+ I  +L    ++   +VI  E+NI+L M    G  L + +Q+ +CL E+E   I  Q+L+ I   H   ++H D+KP+N++ D   NVK++DFGL A+++   + + L         G   ++ PE+    P +  K+DIW+ G+++  MVTG  PF     G  L  + K +L+  ++    +S DL+  I   L  +   RPTAQ L    L + +LQ  +K   ++SN   SF
Sbjct:   16 LSMFEEKEFTRQYTVLKTLSQHGTTEVRLCSHHLTGVTVAVKALKYQRWWEPKVSEVEIMKMLSHPNIVSLLQVIETEQNIYLIMEVAQGTQLHNRVQEARCLKEDEARSIFVQLLSAIGYCHGEGVVHRDLKPDNVIVDEHGNVKIVDFGLGARFMPGQKLERLC--------GAFQFIPPEIFLGLPYDGPKVDIWALGVLLYYMVTGIFPFV----GSTLSEISKEVLQGRYEIPYNLSKDLRSMIGLLLATNARQRPTAQDL----LSHPWLQEGEKTITFHSNGDTSF 292          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Match: Gm4922 (predicted gene 4922 [Source:MGI Symbol;Acc:MGI:3644318])

HSP 1 Score: 115.931 bits (289), Expect = 9.926e-27
Identity = 86/293 (29.35%), Postives = 145/293 (49.49%), Query Frame = 3
Query: 1290 MTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVK--DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGL-AKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDP-NSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGK-LLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKK---YNSNK*FSF 2144
            ++ FE       +  L  L+  G  +V +C    +G  V +K L   +  +    E+ I  +L    ++   +VI  E+NI+L M    G  L + +Q+ +CL E+E   I  Q+L+ I   H   ++H D+KP+N++ D   NVK++DFGL A+++   + + L         G   ++ PE+    P +  K+DIW+ G+++  MVTG  PF     G  L  + K +L+  ++    +S DL+  I   L  +   RPTAQ L    L + +LQ  +K   ++SN   SF
Sbjct:   16 LSMFEEKEFTRQYTVLKTLSQHGTTEVRLCSHHLTGVTVAVKALKYQRWWEPKVSEVEIMKMLSHPNIVSLLQVIETEQNIYLIMEVAQGTQLHNRVQEARCLKEDEARSIFVQLLSAIGYCHGEGVVHRDLKPDNVIVDEHGNVKIVDFGLGARFMPGQKLERLC--------GAFQFIPPEIFLGLPYDGPKVDIWALGVLLYYMVTGIFPFV----GSTLSEISKEVLQGRYEIPYNLSKDLRSMIGLLLATNARQRPTAQDL----LSHPWLQEGEKTITFHSNGDTSF 292          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Match: Hunk (hormonally upregulated Neu-associated kinase [Source:MGI Symbol;Acc:MGI:1347352])

HSP 1 Score: 116.701 bits (291), Expect = 1.515e-26
Identity = 82/264 (31.06%), Postives = 130/264 (49.24%), Query Frame = 3
Query: 1341 ELANGGFGKVFICEDKKSGKQVVMKKLID---------VKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPM-MEISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN-NY 2099
            +L  G F KV       +G++V +K +ID         V  +L RE  I  ++    + +  +++  E + +L M   PGG L   I + K L E E  R   Q+++ +  LH++ ++H D+K EN++ D + N+KLIDFGL+   G     D      ++  G+  Y APEL        KID+WS G+ M  M+TG LPF V  P  +     K++     P+  ++S     F+   L  DP  RP  QQ + ++ +N NY
Sbjct:   67 KLGEGSFAKVREGLHVLTGEKVAIK-VIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVMELCPGGNLMHKIYEKKRLDEAEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNCAGILGYSDPF----STQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVE-PFSLRALYQKMVDKAMNPLPTQLSTGAVNFLRSLLEPDPVKRPNIQQALANRWLNENY 324          
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Match: sp|Q10056|SHK2_SCHPO (Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shk2 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 3.874e-28
Identity = 94/338 (27.81%), Postives = 167/338 (49.41%), Query Frame = 3
Query: 1161 KPKTILEATKA-VANKFRRDRQDLYPISHW----IPDKPNDGDPYFQPMTFFELMSKMAD----------FENLNELANGGFGKVFICEDKKSGKQV-----VMKKLIDVKDSLHREILIGSILFDKE-----LIKY--SEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN 2093
            KPKT ++  K  +   F  D+  +  I       +P K +  +   + MT  + ++ + D          F   ++L  G  G V++ +    GKQ+     V  K ID++    +E+++  I   +E     ++ Y  S ++R E+++ + M Y+  G+LT  I++ K L E ++ RI  +    I  LH   IIH DIK +N++ DN  N+K+ DFG    + +  +K      + +  GT  +MAPE+ K++    K+DIWS G++++EM+  + P+    P + L  + K      K    +S +LK F++ CLT+D   R TA +L+    +N
Sbjct:  239 KPKTTIQTDKKHIIRPFIEDKSHVESIMTGKVTKVPVKADSKNTLSRRMTDRQALAMLKDSVTSHDPVEYFNVKHKLGQGASGSVYLAK-VVGGKQLGIFDSVAIKSIDLQCQTRKELILNEITVMRESIHPNIVTYLDSFLVR-ERHLWVVMEYMNAGSLTDIIEKSK-LTEAQIARICLETCKGIQHLHARNIIHRDIKSDNVLLDNSGNIKITDFGFCARLSNRTNK------RVTMVGTPYWMAPEVVKQNEYGTKVDIWSLGIMIIEMIENEPPYLREDPIRALYLIAKNGTPTLKKPNLVSKNLKSFLNSCLTIDTIFRATAAELLTHSFLN 567          
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Match: sp|O22932|CIPKB_ARATH (CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CIPK11 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.290e-27
Identity = 79/254 (31.10%), Postives = 130/254 (51.18%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLIDVK--------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPE-LTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            L  G F KVF   D+++G+ V +K L   K        +++ REI I   L    ++K  EV+  +  I   M ++ GG L + I +   L E+   R   Q+++ +   H   + H D+KPEN++ D   N+K+ DFGL+      R   L      +  GT  Y+APE L+K+     K+D+WS G+V+  +V G LPFN      ++    K+ K E++    +S DLK+F+S  L ++P  R T  ++++
Sbjct:   27 LGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANNIKREISIMRRLSHPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSEDLSRRYFQQLISAVGYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLH----TLCGTPAYVAPEILSKKGYEGAKVDVWSCGIVLFVLVAGYLPFN---DPNVMNMYKKIYKGEYRFPRWMSPDLKRFVSRLLDINPETRITIDEILK 273          
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Match: sp|Q10407|MKH1_SCHPO (MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mkh1 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.621e-27
Identity = 100/375 (26.67%), Postives = 187/375 (49.87%), Query Frame = 3
Query: 1074 DMDELFVKFDPSMIIV----RIKSEEYEMDVELKPKTIL----EATKA------------VANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNE--LANGGFGKVFICEDKKSGKQVVMKKL--------------IDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPN--SVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKP---MMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            D+D  F ++D   ++V    R+ S   ++ +  K K++     EA++A              N  RR    L+  S  +  KP+        +T   ++S+ A F+ +    + NG +GKVF+  +  +G+ + +K++               D+ DS++ EI + + L    +++Y    + E +I + + Y+ GG++   ++      E  V  +S Q+L  +S LH   IIH D+K +N++ D +   K+ DFG++K+  +    D +     S  G+I +MAPE+   D    S K+D+WS G V++EM+ G+ P++     Q + +LG   K    P   + ++S +  QF++ C TV+ +VRPTA++L+
Sbjct:  726 DVDRFFPRYDLDKVLVVDQSRMVSSPSKVSIRPKMKSVRLLAREASEARKEIRHNARRNKSGNLLRRSSTKLWG-SRIVELKPD------TTITSGSVVSQNATFKWMKGELIGNGTYGKVFLAMNINTGELIAVKQVEIPQTINGRHDQLRKDIVDSINAEISMIADLDHLNIVQYLGFEKTETDISIFLEYVSGGSIGRCLRNYGPFEEQLVRFVSRQVLYGLSYLHSKGIIHRDLKADNLLIDFDGVCKISDFGISKHSDNVYDNDAN----LSMQGSIFWMAPEVIHNDHQGYSAKVDVWSLGCVVLEMLAGRRPWSTDEAIQAMFKLGTEKKAPPIPSELVSQVSPEAIQFLNACFTVNADVRPTAEELL 1089          
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Match: sp|Q9CAD5|YODA_ARATH (Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.665e-27
Identity = 84/269 (31.23%), Postives = 139/269 (51.67%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLIDVKD---------SLHREILIGSILFDKELIKY--SEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNS-VKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTK 2114
            L  G FG V++  + +SG+   MK++    D          L +EI + S L  + +++Y  SE + D+  I+L   Y+ GG++   +Q+    GEN +   + QIL+ ++ LH    +H DIK  NI+ D    VK+ DFG+AK+I   +S  LS K      G+  +MAPE+ K    S + +DIWS G  ++EM T + P++       + ++G   +    P   +S + K F+  CL  +P  RPTA QL++   + N + M +
Sbjct:  406 LGMGSFGHVYLGFNSESGEMCAMKEVTLCSDDPKSRESAQQLGQEISVLSRLRHQNIVQYYGSETVDDKLYIYLE--YVSGGSIYKLLQEYGQFGENAIRNYTQQILSGLAYLHAKNTVHRDIKGANILVDPHGRVKVADFGMAKHI-TAQSGPLSFK------GSPYWMAPEVIKNSNGSNLAVDIWSLGCTVLEMATTKPPWSQYEGVPAMFKIGNSKELPDIP-DHLSEEGKDFVRKCLQRNPANRPTAAQLLDHAFVRNVMPMER 664          
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 9.486e-27
Identity = 71/262 (27.10%), Postives = 137/262 (52.29%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSI------------LFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPG-QILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
            +  G FG V++  +  SG+ + +K+++   +   +E     I            L    +++Y   +R+++ +++ + ++PGG+++S +++     E+ V   ++Q+L  +  LH   I+H DIK  NI+ DN+  +KL DFG +K + +  +   ++  K    GT  +MAPE+  +  +S   DIWS G  ++EMVTG+ P++        +  +G    +   P   IS+D   F+  CL  +PN+RPTA +L++   +
Sbjct:   74 IGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGCIKLADFGASKQVAELATISGAKSMK----GTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKSHPPIP-DNISSDANDFLLKCLQQEPNLRPTASELLKHPFV 330          
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Match: A0BZI1 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00033801001 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.200e-33
Identity = 92/264 (34.85%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 1317 MADFENLNE-LANGGFGKVFICEDKKSGKQVVMKKLIDVK-------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPF---NVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            ++DF+ + + L  G FG V + ++  +GK + MK +   +       D+L REI I   L    +IK      D+ N++L + Y  GG+L   I++ + L E+E     +Q    I  LHK KIIH DIKPEN++ DN+ N+K+ DFG +  +G+          K +  GTI YMAPE+ K    + K+DIW  G+++ EMV G+ PF   N     Q +L  G  LKY+      +S D K  IS  L  +P  RP+ Q ++
Sbjct:   66 ISDFQAMQQTLGQGSFGWVTLVKEISTGKLLAMKAMKKAELFKYCTVDNLKREIKIQRKLNHPNIIKLDSYFEDKTNVYLVLEYAEGGSLFKQIKKQRHLSEDEASHYLYQTCLGIDYLHKQKIIHRDIKPENLLLDNKGNIKICDFGWSTEMGNL---------KKAFCGTIEYMAPEMIKSQSTNYKLDIWCLGVLLYEMVQGKPPFTGRNDQEKCQAILS-GSPLKYD----EYVSEDCKSLISMILQQNPFNRPSIQGIL 315          
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Match: T1EDA5 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20194557 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.760e-31
Identity = 83/261 (31.80%), Postives = 136/261 (52.11%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKL-IDVKDSLHREILIGSILFD----KELIKYSEVIR------DEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN 2093
            L +G FG+VF+C D ++GK+  MK++ I  K+S H   ++ ++  +    KE +K+  +++      D     + M Y+PGG++   I+Q   L E   +  + Q+L  +  LHK  I+H D+K  NI+ DNE NVKL DFG +K     R + +S     +  GTI YM+PEL   +    K DIWS G  +VEM+TG  P++ +     + ++    +  +     +S   + F+S C T     RPT+ QL+    + 
Sbjct:   10 LGSGSFGQVFLCCDMETGKEYAMKQVHIFSKNSQHCSRVLSALREEINILKEGVKHPHIVQYFGCQDDGVVFSILMEYMPGGSVKDQIKQYGPLTERNTISYTKQVLLGLEYLHKKSIVHRDVKGANILRDNEGNVKLSDFGASK-----RLQTISNSIMQTQTGTIYYMSPELLDGNGYGRKTDIWSLGCSVVEMLTGHPPWHQLENFAAIFKIVTSDEPGYSLPDSVSKQARDFVSECFTRSLERRPTSSQLLYHSFVT 265          
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Match: A0BFM2 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00028374001 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.847e-31
Identity = 91/279 (32.62%), Postives = 141/279 (50.54%), Query Frame = 3
Query: 1320 ADFENLNE-LANGGFGKVFICEDKKSGKQVVMKKLIDVK-------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQ--ILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNS 2126
            +DF+++ + L  G FG V + ++ K+G    MK +   +       D+L REI I   L    +IK      D+ N++L + Y  GG+L   I++ + L E E     +Q    I  LHK KIIH DIKPEN++ D + N+K+ DFG +  + +          K +  GTI YMAPE+ K    + K+DIW  G+++ EMV G+ PF      +  + +  G+ LKYE      +S D K  I+  L  +P  RP+ Q +    L + ++    KY S
Sbjct:   36 SDFQSMQQTLGQGSFGWVTLVKEIKTGNLFAMKAMRKEELFKYCTVDNLKREIKIQRKLHHPNIIKLDSYFEDKTNVYLILEYAEGGSLFKKIKKERRLSEEEAFHYLYQTCLGIEYLHKMKIIHRDIKPENLLLDAKGNIKICDFGWSTEMDNL---------KKAFCGTIEYMAPEMIKSQSTNFKLDIWCLGVLLYEMVQGKPPFTGRNDQEKCVAILSGQQLKYE----EFVSEDCKALIAMILQANPFNRPSIQGI----LNHKWMSSKSKYQS 297          
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Match: A0A0C3Q3Q3 (Protein kinase domain-containing protein OS=Tulasnella calospora MUT 4182 OX=1051891 GN=M407DRAFT_244806 PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.100e-31
Identity = 83/261 (31.80%), Postives = 145/261 (55.56%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLI-------------DVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGD---FRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            + +G FG V++  D + G  + +K++               +  +L REI +   L  + +++Y +   D + +++ + Y+PGG++T+ ++      E+ V     QIL  ++ LH+  IIH DIK  NI+ DN   +K+ DFG++K I D   F +   +R  +AS  G++ +MAPE+ K+  +S K DIWS G V+VEM+TG+ PF      Q + R+G   K +  P  +IS + + F++    +D N+RP+A +L+E
Sbjct:  118 IGSGSFGSVYLGMDAQQGLLMAVKQVSLPTGNSANEERKKSMLSALEREIDLLKQLQHEHIVQYLDSSIDNQFLNIFLEYVPGGSITTLLKNYGAFEESLVKLWVRQILMGLNYLHEKGIIHRDIKGANILVDNRGGIKISDFGISKKIEDVDVFSAN--ARGHRASLQGSVFWMAPEVVKQTGHSSKADIWSVGCVIVEMLTGEHPFPKANQMQAMFRIGTYAKPDTPP--DISPEAEDFLAKTFEIDHNLRPSATELLE 374          
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Match: A0BWA1 (Protein kinase domain-containing protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00032670001 PE=4 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.476e-30
Identity = 88/269 (32.71%), Postives = 136/269 (50.56%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLIDVK-------DSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQ--ILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYN 2123
            L  G FG V +  + ++GK   MK +   +       D+L REI I   L    +I       D+ N++L + Y  GG+L   I++ + L E+E     +Q    I  LHK KIIH DIKPEN++ D + N+K+ DFG +  + +          K +  GTI YMAPE+ K    + K+DIW  G+++ EMV G+ PF      +  + +  G+ LKYE      +S D K  I+  L  +P  RP+ Q ++  + + +  Q +K YN
Sbjct:    5 LGQGSFGWVTLVREIQTGKLFAMKAMKKAELFKYCTIDNLKREIKIQRKLNHPHIIDLDSYFEDKTNVYLILEYAEGGSLFKRIKKQRRLSEDEAYHYLYQTCLGIEYLHKMKIIHRDIKPENLLLDAKGNIKICDFGWSTEMDNL---------KKAFCGTIEYMAPEMIKSQSTNYKLDIWCLGVLLYEMVQGKPPFTGKNDQEKCVAILSGQQLKYE----ESVSEDCKSLIAMILQPNPFNRPSIQGILNHKWMLSK-QQSKSYN 259          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Match: ENSAMXT00000008518.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:14507502:14520436:1 gene:ENSAMXG00000008289.2 transcript:ENSAMXT00000008518.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.090e-27
Identity = 82/270 (30.37%), Postives = 139/270 (51.48%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L ++  G FG+VF   D ++ K VV  K+ID++++        +EI + S      + KY         + + M YL GG+   ++ +   L E ++  I  +IL  +  LH  K IH DIK  N++   + +VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E      LK+F+  CL  +P+ RPTA++L++ +LI  Y + T
Sbjct:   21 FTKLEKIGKGSFGEVFKGIDNRTQK-VVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGS-ALDLLEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLF----LIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKKT 278          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Match: pak6b (serine/threonine-protein kinase PAK 6-like [Source:NCBI gene;Acc:103030407])

HSP 1 Score: 119.783 bits (299), Expect = 1.255e-27
Identity = 79/256 (30.86%), Postives = 135/256 (52.73%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILF-----DKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
             EN  ++  G  G V I  +K SGKQV +K ++D++    RE+L   ++       K +++  +    E+ + + M YL GG LT+ + + + L E ++  +   +L  ++ LH   +IH DIK ++I+   +  +KL DFG    I    SKD+ +++  S  GT  +MAPE+  + P   ++D+WS G+++VEMV G+ P+    P   + RL        +   +IS  LK F+   LT DP  R +A  L++
Sbjct:  396 LENFVKIGEGSTGVVCIAREKHSGKQVAVK-MMDLRKQQRRELLFNEVVIMRDYRHKNVVEMYKSALVEEELWVIMEYLQGGALTNIVSETR-LTEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSILLTLDGRIKLSDFGFCAQI----SKDIPKRK--SLVGTPYWMAPEVISKTPYGTEVDVWSLGIMVVEMVDGEPPYFSDTPVAAMKRLRDEPAPSVRNSSKISPVLKDFLDSMLTRDPLQRSSASDLLK 643          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Match: pak7 (p21 (RAC1) activated kinase 5 [Source:NCBI gene;Acc:103023523])

HSP 1 Score: 119.783 bits (299), Expect = 1.636e-27
Identity = 78/262 (29.77%), Postives = 139/262 (53.05%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
             +N  ++  G  G V I  +K SGKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EMV G+ P+    P Q + R+   L    K   ++S+ L+ F+   L  +P+ R TAQ+L++   +
Sbjct:  515 LDNFLKIGEGSTGIVCIATEKHSGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNLPPRLKESHKVSSVLRAFLDLMLVREPSQRATAQELLQHPFL 766          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Match: pak7 (p21 (RAC1) activated kinase 5 [Source:NCBI gene;Acc:103023523])

HSP 1 Score: 119.783 bits (299), Expect = 1.685e-27
Identity = 78/262 (29.77%), Postives = 139/262 (53.05%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
             +N  ++  G  G V I  +K SGKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++  S  GT  +MAPE+    P   ++DIWS G++++EMV G+ P+    P Q + R+   L    K   ++S+ L+ F+   L  +P+ R TAQ+L++   +
Sbjct:  530 LDNFLKIGEGSTGIVCIATEKHSGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRK--SLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNLPPRLKESHKVSSVLRAFLDLMLVREPSQRATAQELLQHPFL 781          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Match: pak7 (p21 (RAC1) activated kinase 5 [Source:NCBI gene;Acc:103023523])

HSP 1 Score: 119.013 bits (297), Expect = 2.990e-27
Identity = 77/262 (29.39%), Postives = 138/262 (52.67%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
             +N  ++  G  G V I  +K SGKQV +KK+ D++    RE+L   ++  ++   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  +S LH   +IH DIK ++I+  ++  +KL DFG    +    SK++ +++     GT  +MAPE+    P   ++DIWS G++++EMV G+ P+    P Q + R+   L    K   ++S+ L+ F+   L  +P+ R TAQ+L++   +
Sbjct:  514 LDNFLKIGEGSTGIVCIATEKHSGKQVAVKKM-DLRKQQRRELLFNEVVIMRDY--HHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQV----SKEVPKRKSLV--GTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNLPPRLKESHKVSSVLRAFLDLMLVREPSQRATAQELLQHPFL 765          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 117.472 bits (293), Expect = 1.409e-27
Identity = 76/264 (28.79%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLT-------MPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINN 2096
             EN  ++  G  G V +  D++SG+QV +KK+  ++    RE+L   ++  +E   + E + D  N +L        M +L GG LT  +   + + E ++  +   +L  ++ LH   +IH DIK ++I+   +  +KL DFG    +    SK+++R++  S  GT  +MAPE+    P   ++D+WS G++++EMV G+ P+    P Q + R+   +  + K + + S  L+ F+   L  DP +R TA +L++   + N
Sbjct:  419 LENFIKIGEGSTGVVCLAVDRRSGRQVAVKKM-HLRKQQRRELLFNEVVIMREY--HHENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQV----SKEVTRRK--SLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQN 672          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 110.538 bits (275), Expect = 1.665e-25
Identity = 76/266 (28.57%), Postives = 138/266 (51.88%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKL------IDVK---DSLHREILIGSILFDKELIKYSEVIRD--EKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMM-----EISNDLKQFISWCLTVDPNVRPTAQQLIESQLIN 2093
            L  G FG+V++C D  +G+++ +K++      ++     ++L  EI +   L  + +++Y   +RD  +K + + M Y+PGG++   ++    L EN   + + QIL  +S LH + I+H DIK  NI+ D+  NVKL DFG +K +    S+  + +   S  GT  +M+PE+   +    K DIWS G  +VEM+T + P+      + +  + K+      P +     E + DL + I     V+  +RP+A+ L+    ++
Sbjct:  365 LGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMR---SVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEF---EAMAAIFKIATQPTDPRLPLHASEHARDLLRRI----FVEAKLRPSAEDLLRHPFVH 620          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 104.76 bits (260), Expect = 3.594e-24
Identity = 79/272 (29.04%), Postives = 134/272 (49.26%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIK--PENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F     +  G FG+VF   D ++ K+VV  K+ID++++        +EI + S      +  Y         + + M YL GG+    I+    L E+++  I  +IL  +  LH  + IH DIK    N++   + +VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E   S   K+F+  CL  DP  RPTA++L++ + I    + T
Sbjct:   26 FTKQERIGKGSFGEVFKGIDNRT-KEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKP-GPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLF----LIPKNNPPTLEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKT 285          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.449 bits (254), Expect = 4.777e-24
Identity = 70/268 (26.12%), Postives = 132/268 (49.25%), Query Frame = 3
Query: 1317 MADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDV-------KDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTS--NIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPM-MEISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
            M  +  ++++  G FGK  + + K  G   V+K+ I++       +D   +E+ + + +    ++ Y E   +  N+++ M Y  GG L    N Q+     E++++    Q+   +  +H  KI+H DIK +NI       V+L DFG+A+ +    + +L+R    +  GT  Y++PE+ +  P + K D+W+ G V+ EM T +  F       ++L   K+++  F P+    S++L+  +S  L  DP  RP    L+   L+
Sbjct:    1 MERYTMVSQIGEGSFGKAMLVKSKADGHLYVIKE-INISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNS--TTELAR----TCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVL---KIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLSRPLL 258          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 100.138 bits (248), Expect = 1.464e-23
Identity = 73/273 (26.74%), Postives = 124/273 (45.42%), Query Frame = 3
Query: 1338 NELANGGFGKVFICEDKKSGKQVVMKKLIDVKDS-----------------LHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKA---SSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMM--EISNDLKQFISWCLTVDPNVRPTAQQLIESQLI 2090
            N L  G FG VF+    + GK + +K+L +++D+                 L  E+ + + L    +++Y     +     + M ++PGGT+   ++    LGE+       Q+   ++ LH   ++H D+K  N V      VKLIDFG A+ +    +  LS        S  GT  +MAPE+      + + D+WS G  + EM  G+ PF  M P   LL +G  ++    P +    S + ++F+  C   D   RP++Q+L+    I
Sbjct:   19 NRLGKGAFGTVFLGLTNQ-GKLIAVKEL-ELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRV----ALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIG--IRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHPFI 283          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 114.39 bits (285), Expect = 8.918e-27
Identity = 66/226 (29.20%), Postives = 123/226 (54.42%), Query Frame = 3
Query: 1401 QVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            Q + +K++D   +L  E+ +   L  + ++ Y    ++  N+++ + Y+PGG+++S +       E+ +   + QIL  ++ LHK  IIH DIK  NI+ D +  VK+ DFG++K +     K   + ++AS  G++ +M+PE+ K+   + K DIWS G V++EM TG+ PF      Q + ++G     E       +++ K F+     +D   RP+A +L++
Sbjct:  491 QNIHRKMVD---ALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKK---QNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWA--TSEGKNFLRKAFELDYQYRPSALELLQ 708          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 110.923 bits (276), Expect = 4.172e-26
Identity = 84/289 (29.07%), Postives = 138/289 (47.75%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDS-------LHREILIGSILFDKELIKYSEVIRDEKN--IHLTMPYLPGGTLTSNIQQLKCLG----ENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNV------MGPGQIL---LRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYN 2123
            +   L  L  G  G V  C   K+GK+V   K I+  ++       + RE+          +++Y  +  DE++  I++ M Y+ G +L +  + L   G    E  + +I+  +L  +S LH+ K+IH DIKP+NI+ + +  +KL DFG+        S +       +  GT  YMAPE  +  P SV  D+WS G+ ++E+  G+ PF        + P ++L   L     LK E +  +  S   + FI +CL  D   RP+ +Q+++   I    QM KK N
Sbjct:  213 EITTLGILGEGAGGSVAKCR-LKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGV--------SGEAVNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHPWIVG--QMKKKVN 490          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 112.079 bits (279), Expect = 4.541e-26
Identity = 75/266 (28.20%), Postives = 133/266 (50.00%), Query Frame = 3
Query: 1305 LMSKMADFENLNELANGGFGKVFICEDKKS---GKQVVMKKLID---VKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPE--LTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
            + ++  D+   + L  GGF + F  +D        + V K  I     +  L  EI I   +    ++++ +   D+ N+++ +   P G+L   +++ K L E EV   + QI   I  +H  ++IH D+K  NI FD+  N+K+ DFGLA  + +        +RK +  GT NY+APE  + K   +S ++DIWS G+++  ++ G+ PF       I  R+ K   + F     IS++ K  I   L++DP  RP+  ++++
Sbjct:   75 IKTRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLAN------ESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERI-KCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMD 333          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 106.686 bits (265), Expect = 9.933e-25
Identity = 85/291 (29.21%), Postives = 138/291 (47.42%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDS-------LHREILIGSILFDKELIKYSEVIRDEKN--IHLTMPYLPGGTLTSNIQQLKCLG----ENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNV------MGPGQIL---LRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 2132
             E L  L  G  G V  C+  K+G ++   K+I+  ++       + RE+        + +++Y  +  D++N  I++ M Y+ G +L +  + L   G    E  + +I+  +L  +S LH+ K+IH DIKP+NI+ +    VKL DFG+        S +       +  GT  YMAPE  +  P SV  D+WS G+ ++E+  G+ P +       + P ++L   L     LK E +  +  S   K FI +CL  D   RP+ +Q+I    I    QM K  N  K
Sbjct:  221 IETLGILGEGAGGSVSKCK-LKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGV--------SGEAVNSLATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWIKG--QMKKNVNMEK 500          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 107.842 bits (268), Expect = 1.029e-24
Identity = 81/285 (28.42%), Postives = 130/285 (45.61%), Query Frame = 3
Query: 1272 DPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDK----------ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSK--------DLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQL 2072
            DP    +T   +   + DF+   +L +G +  V +   + SGK+  +K L   K+ L R+  +  +  +K           + K     +DE +++  + Y P G     I++   L E      + QI+  +  LH   IIH DIKPENI+ D    VKL DFG AK + +  S         DL  K K S  GT  Y++PEL  ++    + DIW+FG ++ +M+ G+ PF         L   K++K ++         +K  +   L  DPN R T +Q+
Sbjct:  107 DPATGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVL--SKEYLIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSK-SFVGTAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANE---YLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLTIKQI 385          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 129.798 bits (325), Expect = 1.012e-33
Identity = 84/260 (32.31%), Postives = 138/260 (53.08%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKL--IDVKDSLHREI--LIGSILF-----DKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINN 2096
            L  G FG+V++C D  +G+++ +K++    +  S   E+  L G I F     ++ +++Y  +  D+ +I++ M YLPGG++  +I+Q   L E+   + S QIL  I  LH ++I+H DIK  NI+ D   NVKL DFG +K +   RSK   R    S  GT  +MAPE+   +    K D+WS G  +VEM+T + P+    P   L ++         P  ++S D  +F+   L ++   RP+A +L+    + N
Sbjct:   10 LGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFR----SVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELP-SDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 121.709 bits (304), Expect = 1.340e-30
Identity = 81/265 (30.57%), Postives = 138/265 (52.08%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKEL-------IKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINN 2096
            +  N  ++  G  G V +  DK++G+QV +KK+ D+K    RE+L   ++  ++        +  S ++ DE  + + M +L GGTLT  +     L E +V  +   +L  ++ LH   +IH DIK ++I+  +   VKL DFG    +    ++D+ R++  S  GT  +MAPE+    P   ++DIWS G++++EMV G+ P+    P Q + +L  L     +  ++IS  L+ F+   L  DP  R TA +L+    I N
Sbjct:   28 NLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKM-DLKKQQRRELLFNEVVIMRDYPHPNIVEMYGSHLVGDE--LWVVMEFLEGGTLTDIVTHTN-LSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQV----TEDMPRRK--SLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIRN 282          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 112.849 bits (281), Expect = 7.625e-28
Identity = 70/259 (27.03%), Postives = 132/259 (50.97%), Query Frame = 3
Query: 1323 DFENLNELANGGFGKVFICEDKKSGKQVVMKKL----IDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVF---DNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME-ISNDLKQFISWCLTVDPNVRPTAQQLI 2075
            +++ L  +  G F KVF C ++K+G +   K+L    ++ K+ + +EI +   L  + ++     IR+ + + L M Y+ GG+L   + Q     E +   ++ Q+L  +  LH  +I+H DIKP+N++     N   +KL DFGLA+ + +    D+     + +P    ++APE   E+P    +DIW+ G++   ++ G  PF      Q+LL + +       P  + +SND +  +   + VDP  R +A++ +
Sbjct:    4 NYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQALPN--DTDVISCGASGAP---MFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLLSILRGQYTMPSPFWDNVSNDARDLVHKLIVVDPEARISAKEAL 257          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 111.309 bits (277), Expect = 7.386e-27
Identity = 71/267 (26.59%), Postives = 125/267 (46.82%), Query Frame = 3
Query: 1287 PMTFFELMSK----MADFENLNELANGGFGKVFICEDKKSGKQVVMKKLI-------DVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVR 2054
            P    E M +    ++DF+    L  G FG V++  +KKS   V +K L        +V+  L REI I S L    +++      D+  ++L + Y P G L   +   +   E    +   Q+   ++  H  K+IH DIKPEN++ + + ++K+ DFG + +    R   L         GT++Y+ PE+ +   +  K+D+WS G++  E + G+ PF   G  +   R+ ++   + +    +S   +  IS  L  +PN R
Sbjct:   31 PFKLLENMKQGKWNLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLC--------GTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRV---DLRFPSHVSPGARDLISKLLQHNPNNR 286          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 110.923 bits (276), Expect = 1.562e-26
Identity = 83/278 (29.86%), Postives = 134/278 (48.20%), Query Frame = 3
Query: 1344 LANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL---------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSR-----KRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME-ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 2132
            +  G F KV       +G++V +K +ID K +L          RE  I  ++    +I   EV+  E   +L      GG L   I   K LGE EV +   QI++ +  LH+  IIH D+K EN++ D E N+++IDFGL+  +   +  DLS      K +  SP    Y APE+        K+D+WS G+ M  M+TG+LP+    P  I+    K+++ E   + + +S   +  +   LT DP+ R +  + I      N++ + K Y  ++
Sbjct:   31 IGEGSFAKVKQGFHVLTGEKVAVK-IIDKKQALEDRYVSKNMRREARILQMVRHPHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLLDEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPA---YAAPEILGHQLYGTKVDVWSIGVNMYAMLTGKLPYTAE-PFNIVTLYNKMVRGEMNAVPDRLSPSCRDLLMRFLTFDPDERISLDEAI------NHVWLKKGYEDDE 297          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Match: pak6a (p21 (RAC1) activated kinase 6 [Source:NCBI gene;Acc:101175447])

HSP 1 Score: 121.324 bits (303), Expect = 3.986e-28
Identity = 78/256 (30.47%), Postives = 136/256 (53.12%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILF-----DKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIE 2078
             EN  ++  G  G V I  +K +G+QV +K ++D++    RE+L   ++       K +++  +    E+ + + M YL GG LT+ + + + L E ++  +   +L  ++ LH   +IH DIK ++I+   +  VKL DFG    I    SKD+ +++  S  GT  +MAPE+  + P   ++D+WS G+++VEMV G+ P+    P   + RL        + + ++S  LK F+   LT DP  R +A  L+E
Sbjct:  421 LENFVKIGEGSTGVVCIATEKHTGRQVAVK-MMDLRRQQRRELLFNEVVIMRDYQHKNVVEMFKSALVEEELWVIMEYLQGGALTNIVSETR-LSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLTLDGRVKLSDFGFCAQI----SKDIPKRK--SLVGTPYWMAPEVISKSPYGTEVDVWSMGIMVVEMVDGEPPYFSETPVAAMKRLRDEQAPTVRNISQVSPVLKHFLDRMLTRDPLERASATDLLE 668          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Match: stk24b (serine/threonine kinase 24 [Source:NCBI gene;Acc:101160144])

HSP 1 Score: 118.242 bits (295), Expect = 5.655e-28
Identity = 83/270 (30.74%), Postives = 139/270 (51.48%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEIS--NDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L  +  G FG+VF   D ++ K VV  K+ID++++        +EI + S      + KY      +  + + M YL GG+   ++ +   L E ++  I  +IL  +  LH  K IH DIK  N++   +  VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E S    LK+F+  CL  +P+ RPTA++L++ +LI  Y + T
Sbjct:   24 FTKLERIGKGSFGEVFKGIDNRTQK-VVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSAL-DLMEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLF----LIPKNNPPTLEGSYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRYAKKT 281          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Match: ENSORLT00000022068.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 117.472 bits (293), Expect = 7.104e-28
Identity = 82/270 (30.37%), Postives = 139/270 (51.48%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L+ +  G FG+VF   D ++ ++VV  K+ID++++        +EI + S      + KY         + + M YL GG+   ++ +   L E ++  I  +IL  +  LH  K IH DIK  N++   +  VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E   S  LK+FI  CL  DP+ RPTA++L++ + I  + + T
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRT-QKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSAL-DLLEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLF----LIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKRT 279          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Match: ENSORLT00000022064.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 117.472 bits (293), Expect = 9.496e-28
Identity = 82/270 (30.37%), Postives = 139/270 (51.48%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L+ +  G FG+VF   D ++ ++VV  K+ID++++        +EI + S      + KY         + + M YL GG+   ++ +   L E ++  I  +IL  +  LH  K IH DIK  N++   +  VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E   S  LK+FI  CL  DP+ RPTA++L++ + I  + + T
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRT-QKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSAL-DLLEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLF----LIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKRT 279          
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Match: ENSORLT00000022066.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 117.472 bits (293), Expect = 9.496e-28
Identity = 82/270 (30.37%), Postives = 139/270 (51.48%), Query Frame = 3
Query: 1326 FENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSL------HREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMME--ISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMT 2111
            F  L+ +  G FG+VF   D ++ ++VV  K+ID++++        +EI + S      + KY         + + M YL GG+   ++ +   L E ++  I  +IL  +  LH  K IH DIK  N++   +  VKL DFG+A  + D      ++ ++ +  GT  +MAPE+ K+     K DIWS G+  +E+  G+ P + + P ++L     L+     P +E   S  LK+FI  CL  DP+ RPTA++L++ + I  + + T
Sbjct:   22 FTKLDRIGKGSFGEVFKGIDNRT-QKVVAIKIIDLEEAEDEIEDIQQEITVLSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSAL-DLLEPGPLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD------TQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLF----LIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHAKRT 279          
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 567/575 (98.61%), Postives = 571/575 (99.30%), Query Frame = 3
Query:  408 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKXXXXXXXXXXXXXXXDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITRSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 2132
            MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFS+QFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLIT+SDGDMDELFVKFDPSMIIVRIKSEEYEMDVEL PKTILEATKAVANKFR DRQDLY I+HWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDK SGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEV+RISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK
Sbjct:    1 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 575          
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 559/567 (98.59%), Postives = 563/567 (99.29%), Query Frame = 3
Query:  432 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKXXXXXXXXXXXXXXXDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITRSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 2132
            MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFS+QFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLIT+SDGDMDELFVKFDPSMIIVRIKSEEYEMDVEL PKTILEATKAVANKFR DRQDLY I+HWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDK SGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEV+RISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK
Sbjct:    1 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKISGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVIRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNSNK 567          
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 297/303 (98.02%), Postives = 300/303 (99.01%), Query Frame = 3
Query:  408 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKXXXXXXXXXXXXXXXDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITRSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSK 1316
            MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFS+QFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLIT+SDGDMDELFVKFDPSMIIVRIKSEEYEMDVEL PKTILEATKAVANKFR DRQDLY I+HWIPDKPNDGDPYFQPMTFFELMSK
Sbjct:    1 MWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSK 303          
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Match: SMESG000024843.1 (SMESG000024843.1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 289/295 (97.97%), Postives = 292/295 (98.98%), Query Frame = 3
Query:  432 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKXXXXXXXXXXXXXXXDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITRSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSK 1316
            MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFS+QFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLIT+SDGDMDELFVKFDPSMIIVRIKSEEYEMDVEL PKTILEATKAVANKFR DRQDLY I+HWIPDKPNDGDPYFQPMTFFELMSK
Sbjct:    1 MQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARVKIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSVQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITQSDGDMDELFVKFDPSMIIVRIKSEEYEMDVELNPKTILEATKAVANKFRIDRQDLYSINHWIPDKPNDGDPYFQPMTFFELMSK 295          
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Match: SMESG000024565.1 (SMESG000024565.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 324/717 (45.19%), Postives = 457/717 (63.74%), Query Frame = 3
Query:   27 MKIFVINGXXXXXXXXXXXXXYSQVRDIKYRFDEIVGGSEKWTKDHYKLIQENIILDDDDFINRYKLREGDEICIAGIETYLRSDDVIIELFLAGCLPEFKWLIVRKNVPIATIRLIIERFQSYIIHMWDCKGNEMQNNQSVTDIDAFGYYRLIVNCGQEADDNLTFDECCNQHDRCKIILYY--YSENWWEFEKFSEIARVKXXXXXXXXXXXXXXXDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIWDICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQNDPKNTKKSFNDILVDALDCLV------RHLMNPCEDWKHA-----------AKRWLNSFFLITRSDGDMDELFVKF-DPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQDLYPISHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFICEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDK-ELIKYSEVIRDEKNIHLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCDIKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAPELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYEFKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTK 2114
            MKIFVI  ENPE K+EI++EEYS VR+I+ + D+I  G  KW K   KL+ +NII+DD+  I  YKL EGDEI    IE YL SDDVI+E+FL+G +PE  +LIV++N  I+ I+ +IER Q  II++ D  GN+M  +Q+VT+  +  YYRLIV  G++     TF++C  Q+ + +II YY         +E   E    ++I Q+ +I+ I+ SND  + RL ENLS FP AF+K + +F  DI+ RIWDIC++Y +L      S     NDEW  + LFF  ALL+ + +Y +  +N  +   K+FN I+VDAL   V      R + + CE   ++             +W++ F   +R   + DE+F ++ + +   ++  +   E      P+TI+EA +A+A K      DLY I     DKP DG+PY + +  F LM  M +F+ L E A G FGKVFIC+DK S +++V+KK  +++ SLHR+I IG  L +  +L +YS +++D  +I L MPYL GG+LTS IQQ KC+ ENE ++IS+QILTQI ELH+ +I+H DIKP+NI+ D   N KLIDFGL+K + +   + L  K KA +PGT+NYMAPE+ +E P S KIDIWSFGMV+VEMVTG  PF+   P ++++ L K+++YEFKP + IS +  QFI WCLTVDPN RP+AQQLIESQ I +YL + K
Sbjct:    1 MKIFVIRVENPEIKIEIKLEEYSLVRNIRNKLDKIFPGRVKWNKHFIKLVHKNIIMDDEKSIGWYKLCEGDEILCVRIENYLCSDDVILEVFLSGFVPEVIYLIVQRNYSISKIKSMIERIQCEIINICDFTGNKMTGSQTVTETSSCAYYRLIVKYGRKETCISTFEDCLKQYHKFRIIHYYDFILRLRHLYECLFETRINEVIKQMNEIKAIMLSNDPFEIRLKENLSEFPSAFIKCHSIFCDDISSRIWDICDDYWQL------SRNVIENDEWIVIGLFFRMALLIVLHQYLEHERNHCEIATKTFNSIVVDALGYSVTLLIKIRQMESFCETAGYSFDLIGELMEDICVKWMDPFLSTSRYYSEFDEVFNRYYNKTFASLKFGNGSVEFHFHSDPQTIIEAKEAMAQKCGVKVNDLYAIYQRNEDKPTDGEPYDETILDFVLMINMENFDFLKEFATGAFGKVFICQDKISSQELVLKKSTEMEFSLHRDIFIGYRLKNSSKLFQYSRIVKDMDSIQLAMPYLSGGSLTSKIQQQKCIHENEKIKISYQILTQIHELHRLQIVHRDIKPDNIILDGAGNAKLIDFGLSKSMENVTIEILLEKLKAYAPGTVNYMAPEILREIPYSYKIDIWSFGMVLVEMVTGNPPFHKKAPPRVVIELKKMVEYEFKPNLLISIEFNQFIKWCLTVDPNERPSAQQLIESQFIIDYLNINK 711          
The following BLAST results are available for this feature:
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HUNK2.789e-2731.44hormonally up-regulated Neu-associated kinase [Sou... [more]
PAK57.651e-2730.20p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;... [more]
PAK57.651e-2730.20p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;... [more]
PAK57.651e-2730.20p21 (RAC1) activated kinase 5 [Source:HGNC Symbol;... [more]
PAK11.069e-2628.34p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsy-15.701e-2530.90Mitogen-activated protein kinase kinase kinase nsy... [more]
air-26.747e-2527.61Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
pak-27.120e-2529.01Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-27.610e-2529.01Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
cmk-12.406e-2427.01Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbt5.398e-2730.23gene:FBgn0025743 transcript:FBtr0074285[more]
Pak7.769e-2627.34gene:FBgn0267698 transcript:FBtr0334539[more]
Pak7.769e-2627.34gene:FBgn0267698 transcript:FBtr0081714[more]
Pak7.769e-2627.34gene:FBgn0267698 transcript:FBtr0081716[more]
Pak7.769e-2627.34gene:FBgn0267698 transcript:FBtr0081715[more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk24a6.728e-3031.48serine/threonine kinase 24a (STE20 homolog, yeast)... [more]
pak6a1.081e-2831.27p21 protein (Cdc42/Rac)-activated kinase 6a [Sourc... [more]
pak6a1.730e-2831.27p21 protein (Cdc42/Rac)-activated kinase 6a [Sourc... [more]
si:ch211-197l9.52.225e-2832.17si:ch211-197l9.5 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
map3k193.475e-2830.19mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bri3bp1.260e-2629.76BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-9... [more]
bri3bp1.426e-2629.76BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-9... [more]
bri3bp1.437e-2629.76BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-9... [more]
bri3bp1.485e-2629.76BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-9... [more]
bri3bp1.536e-2629.76BRI3 binding protein [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak74.105e-2729.18p21 (RAC1) activated kinase 7 [Source:MGI Symbol;A... [more]
Pak74.105e-2729.18p21 (RAC1) activated kinase 7 [Source:MGI Symbol;A... [more]
Gm49229.926e-2729.35predicted gene 4922 [Source:MGI Symbol;Acc:MGI:364... [more]
Gm49229.926e-2729.35predicted gene 4922 [Source:MGI Symbol;Acc:MGI:364... [more]
Hunk1.515e-2631.06hormonally upregulated Neu-associated kinase [Sour... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10056|SHK2_SCHPO3.874e-2827.81Serine/threonine-protein kinase shk2 OS=Schizosacc... [more]
sp|O22932|CIPKB_ARATH1.290e-2731.10CBL-interacting serine/threonine-protein kinase 11... [more]
sp|Q10407|MKH1_SCHPO2.621e-2726.67MAP kinase kinase kinase mkh1 OS=Schizosaccharomyc... [more]
sp|Q9CAD5|YODA_ARATH6.665e-2731.23Mitogen-activated protein kinase kinase kinase YOD... [more]
sp|Q9FZ36|M3K2_ARATH9.486e-2727.10Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0BZI14.200e-3334.85Protein kinase domain-containing protein OS=Parame... [more]
T1EDA51.760e-3131.80Protein kinase domain-containing protein OS=Helobd... [more]
A0BFM23.847e-3132.62Protein kinase domain-containing protein OS=Parame... [more]
A0A0C3Q3Q38.100e-3131.80Protein kinase domain-containing protein OS=Tulasn... [more]
A0BWA11.476e-3032.71Protein kinase domain-containing protein OS=Parame... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000008518.21.090e-2730.37pep primary_assembly:Astyanax_mexicanus-2.0:19:145... [more]
pak6b1.255e-2730.86serine/threonine-protein kinase PAK 6-like [Source... [more]
pak71.636e-2729.77p21 (RAC1) activated kinase 5 [Source:NCBI gene;Ac... [more]
pak71.685e-2729.77p21 (RAC1) activated kinase 5 [Source:NCBI gene;Ac... [more]
pak72.990e-2729.39p21 (RAC1) activated kinase 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak41.409e-2728.79p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
map3k21.665e-2528.57mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a3.594e-2429.04serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000007414.14.777e-2426.12pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
map3k191.464e-2326.74mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE118.918e-2729.20Signal transducing MEK kinase; involved in pheromo... [more]
MKK24.172e-2629.07MAPKK involved in the protein kinase C signaling p... [more]
CDC54.541e-2628.20Polo-like kinase; controls targeting and activatio... [more]
MKK19.933e-2529.21MAPKK involved in the protein kinase C signaling p... [more]
PKH11.029e-2428.42Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.012e-3332.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.340e-3030.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412427.625e-2827.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354377.386e-2726.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.562e-2629.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak6a3.986e-2830.47p21 (RAC1) activated kinase 6 [Source:NCBI gene;Ac... [more]
stk24b5.655e-2830.74serine/threonine kinase 24 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000022068.27.104e-2830.37serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022064.29.496e-2830.37serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
ENSORLT00000022066.29.496e-2830.37serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
back to top
BLAST of serine/threonine-protein kinase MARK2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024843.10.000e+098.61SMESG000024843.1[more]
SMESG000024843.10.000e+098.59SMESG000024843.1[more]
SMESG000024843.10.000e+098.02SMESG000024843.1[more]
SMESG000024843.10.000e+097.97SMESG000024843.1[more]
SMESG000024565.10.000e+045.19SMESG000024565.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018245 ID=SMED30018245|Name=serine/threonine-protein kinase MARK2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2185bp
TCTATATAAATCTTATATGGTAACGAATGAAGATTTTTGTAATAAATGGC
GAGAATCCCGAGGAGAAAGTTGAGATAGAGATCGAAGAATATTCACAAGT
GCGAGATATAAAATATAGATTTGATGAAATAGTTGGCGGAAGTGAAAAAT
GGACGAAAGATCATTACAAATTAATTCAGGAAAATATAATTTTGGACGAT
GATGATTTCATCAATAGGTATAAATTGCGTGAGGGGGATGAGATTTGCAT
TGCGGGTATTGAAACCTATCTCAGAAGTGATGACGTCATAATTGAGCTGT
TTCTGGCGGGATGTTTACCTGAATTTAAATGGTTGATAGTGCGCAAGAAT
GTGCCAATAGCGACAATTAGATTAATAATTGAAAGGTTTCAATCTTACAT
AATTCACATGTGGGATTGCAAGGGAAACGAAATGCAAAATAATCAATCAG
TCACGGATATCGATGCGTTTGGATATTATCGATTGATTGTGAACTGTGGT
CAGGAGGCGGATGATAATTTAACATTTGATGAGTGCTGCAATCAACATGA
CAGATGCAAAATTATTTTGTATTATTATTCAGAAAATTGGTGGGAATTTG
AAAAGTTTTCAGAAATAGCAAGAGTAAAAATCATTAACCAAATCAAAAAA
ATCAGGCAAATTATCTCATCAAATGACACAATTGATCCCAGATTGAATGA
AAATTTATCACATTTTCCGAAAGCATTTGTAAAGCAAAATTATTTATTCG
GTCATGACATTACAAAACGCATTTGGGATATTTGTAATGAGTACAGAAAA
TTGATGAAAAGTTATCCATTTTCCTTGCAGTTTTGCCTTAATGACGAATG
GCATGCGATGAAGCTATTTTTCCTGACCGCACTATTAGTTACAATGCGAA
AATATTCGGATGCCGTGCAAAATGATCCGAAAAATACTAAAAAATCATTT
AATGACATTCTAGTTGATGCTTTGGACTGTTTGGTAAGACATTTGATGAA
TCCTTGCGAAGATTGGAAACATGCGGCAAAACGGTGGCTGAATTCATTCT
TCTTGATAACTCGGTCTGACGGTGATATGGACGAATTATTTGTTAAATTT
GATCCTTCAATGATCATTGTGAGGATCAAGAGTGAAGAATATGAAATGGA
TGTTGAATTGAAGCCCAAAACAATTCTGGAAGCTACAAAAGCTGTTGCCA
ACAAGTTCAGAAGAGATAGACAAGATCTGTACCCAATCAGTCACTGGATT
CCTGACAAACCGAATGACGGAGACCCTTATTTTCAGCCAATGACATTTTT
TGAATTGATGTCAAAAATGGCGGATTTTGAAAATTTGAACGAATTGGCCA
ATGGAGGATTCGGGAAAGTTTTTATTTGTGAAGATAAAAAATCTGGAAAG
CAAGTTGTAATGAAAAAATTAATTGATGTCAAAGACAGTCTTCACAGAGA
AATTTTAATTGGATCAATTCTTTTCGACAAAGAACTAATCAAATATTCAG
AAGTAATCAGAGATGAGAAAAATATCCATTTGACCATGCCATACCTGCCG
GGAGGCACCCTCACCTCGAACATTCAGCAACTAAAATGTCTCGGAGAAAA
TGAAGTCGTCAGAATTTCCCATCAAATCCTCACGCAAATAAGCGAATTGC
ACAAATCAAAAATTATTCATTGTGACATCAAACCGGAAAATATCGTTTTC
GACAATGAACGTAACGTGAAATTAATCGATTTTGGATTGGCCAAGTACAT
AGGAGATTTTAGGAGTAAAGATTTATCAAGGAAACGAAAAGCTTCCTCTC
CTGGAACAATCAATTACATGGCGCCAGAATTAACCAAGGAAGATCCAAAT
TCAGTCAAAATCGATATTTGGTCATTTGGCATGGTGATGGTCGAGATGGT
GACAGGGCAACTGCCATTTAATGTGATGGGACCCGGGCAGATTTTACTGA
GACTTGGAAAATTGCTAAAATATGAATTTAAACCAATGATGGAAATATCC
AATGACCTCAAGCAATTTATCAGCTGGTGCTTGACGGTGGACCCTAATGT
GAGACCAACGGCACAACAATTGATTGAATCTCAACTGATCAATAATTATT
TGCAAATGACAAAAAAATATAACAGTAATAAATAATTTTCATTTGTAATA
TTGAGTTATTTGTGTAATAAATCAATCAAATCGTG
back to top

protein sequence of SMED30018245-orf-1

>SMED30018245-orf-1 ID=SMED30018245-orf-1|Name=SMED30018245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=703bp
MKIFVINGENPEEKVEIEIEEYSQVRDIKYRFDEIVGGSEKWTKDHYKLI
QENIILDDDDFINRYKLREGDEICIAGIETYLRSDDVIIELFLAGCLPEF
KWLIVRKNVPIATIRLIIERFQSYIIHMWDCKGNEMQNNQSVTDIDAFGY
YRLIVNCGQEADDNLTFDECCNQHDRCKIILYYYSENWWEFEKFSEIARV
KIINQIKKIRQIISSNDTIDPRLNENLSHFPKAFVKQNYLFGHDITKRIW
DICNEYRKLMKSYPFSLQFCLNDEWHAMKLFFLTALLVTMRKYSDAVQND
PKNTKKSFNDILVDALDCLVRHLMNPCEDWKHAAKRWLNSFFLITRSDGD
MDELFVKFDPSMIIVRIKSEEYEMDVELKPKTILEATKAVANKFRRDRQD
LYPISHWIPDKPNDGDPYFQPMTFFELMSKMADFENLNELANGGFGKVFI
CEDKKSGKQVVMKKLIDVKDSLHREILIGSILFDKELIKYSEVIRDEKNI
HLTMPYLPGGTLTSNIQQLKCLGENEVVRISHQILTQISELHKSKIIHCD
IKPENIVFDNERNVKLIDFGLAKYIGDFRSKDLSRKRKASSPGTINYMAP
ELTKEDPNSVKIDIWSFGMVMVEMVTGQLPFNVMGPGQILLRLGKLLKYE
FKPMMEISNDLKQFISWCLTVDPNVRPTAQQLIESQLINNYLQMTKKYNS
NK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR000626Ubiquitin-like_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006915apoptotic process
GO:0007010cytoskeleton organization
GO:0007612learning
GO:0007613memory
GO:0007626locomotory behavior
GO:0016049cell growth
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:2001237negative regulation of extrinsic apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005739mitochondrion