Guanine nucleotide binding protein subunit

Overview
NameGuanine nucleotide binding protein subunit
Smed IDSMED30018242
Length (bp)1396
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide binding protein subunit (SMED30018242) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide binding protein subunit (SMED30018242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide binding protein subunit (SMED30018242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide binding protein subunit (SMED30018242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018242SMESG000068013.1 SmedASXL_005709SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018242SMESG000068013.1 dd_Smed_v4_10481_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018242SMESG000068013.1 dd_Smed_v6_10481_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNB5 (G protein subunit beta 5 [Source:HGNC Symbol;Acc:HGNC:4401])

HSP 1 Score: 464.537 bits (1194), Expect = 1.405e-162
Identity = 214/351 (60.97%), Postives = 272/351 (77.49%), Query Frame = 1
Query:   82 MSVEAPINND--GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            M+ E    N+    L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:    1 MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 71.2478 bits (173), Expect = 7.322e-13
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNB5 (G protein subunit beta 5 [Source:HGNC Symbol;Acc:HGNC:4401])

HSP 1 Score: 465.307 bits (1196), Expect = 2.875e-162
Identity = 221/379 (58.31%), Postives = 282/379 (74.41%), Query Frame = 1
Query:    4 LLP*FK--HNLNYCFIVFSNNLFNKSFLMSVEAPINND--GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L P FK    L+YC           + +M+ E    N+    L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   23 LRPVFKKSQQLSYCSTC--------AEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393          

HSP 2 Score: 70.8626 bits (172), Expect = 1.313e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 394          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNB2 (G protein subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:4398])

HSP 1 Score: 370.933 bits (951), Expect = 5.408e-126
Identity = 171/335 (51.04%), Postives = 233/335 (69.55%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ L+ ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ    F GHSGDVMSL L+P   GR F+SG+CD  + +WD+R   C Q + GHESD+N+V F+P+G AF TGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD--GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNB2 (G protein subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:4398])

HSP 1 Score: 370.933 bits (951), Expect = 5.408e-126
Identity = 171/335 (51.04%), Postives = 233/335 (69.55%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ L+ ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ    F GHSGDVMSL L+P   GR F+SG+CD  + +WD+R   C Q + GHESD+N+V F+P+G AF TGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD--GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Match: GNB2 (G protein subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:4398])

HSP 1 Score: 370.933 bits (951), Expect = 5.408e-126
Identity = 171/335 (51.04%), Postives = 233/335 (69.55%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ L+ ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ    F GHSGDVMSL L+P   GR F+SG+CD  + +WD+R   C Q + GHESD+N+V F+P+G AF TGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD--GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpb-2 (Guanine nucleotide-binding protein subunit beta-2 [Source:UniProtKB/Swiss-Prot;Acc:Q20636])

HSP 1 Score: 456.833 bits (1174), Expect = 1.113e-159
Identity = 205/335 (61.19%), Postives = 270/335 (80.60%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L+ EA+ L+KKL ++R++L D  +   +++L+ + +L +K RR+LKGH G+VL + WS DKRH+VS+SQDGK+IVWDGFT  KE  L+M TTWVMACA+SP+   +ACGGLDNKC++ PL  ++D + KKR VATHTSY+SCC F  S+  +LT SGDSTC +WDVESGQ+IQ+FHGH+GDV ++D+   ++G  FIS   D+   VWD+R+GQCVQ +EGHE+D+N+VRF+P+GDAFATGSDDATCRLFDLRAD ++CVY+K+S+LF  N VDFSLSGR+LFAGY DY + +WD LK  R ++L GHENRISCL+TSPDGTAVC+ SWD T+R+
Sbjct:   33 LANEAEELRKKLDQERHKLNDIPIQQAAERLDVMGALGVKQRRILKGHVGKVLCMDWSLDKRHIVSSSQDGKVIVWDGFTTNKEHALTMPTTWVMACAFSPSSQMIACGGLDNKCSVVPLSFEDDIIQKKRQVATHTSYMSCCTFLRSDNLILTGSGDSTCAIWDVESGQLIQNFHGHTGDVFAIDVPKCDTGNTFISAGADKHSLVWDIRSGQCVQSFEGHEADINTVRFHPNGDAFATGSDDATCRLFDLRADRQVCVYEKESILFPVNGVDFSLSGRILFAGYGDYRVGVWDSLKCARHSVLYGHENRISCLRTSPDGTAVCSASWDCTIRI 367          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpb-1 (Guanine nucleotide-binding protein subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:P17343])

HSP 1 Score: 389.423 bits (999), Expect = 1.210e-133
Identity = 178/335 (53.13%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ E R    D  LAT++  LEP+  + ++ RR L+GH  ++ ++ W+ D R+LVS SQDGKLIVWD +T  K   + + ++WVM CAY+P+G+ VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD TC LWD+E+GQ   +F GH+GDVMSL LSP    R FISG+CD    +WD+R G C Q + GHESD+N+V F+PSG+AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLLFAGY+D+  N+WD ++  R  +L GH+NR+SCL  + DG AVCTGSWDS L++
Sbjct:    7 LRQEAEQLKSQIREARKSANDTTLATVASNLEPIGRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDF--RTFISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQERAGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpb-1 (Guanine nucleotide-binding protein subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:P17343])

HSP 1 Score: 389.423 bits (999), Expect = 1.210e-133
Identity = 178/335 (53.13%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ E R    D  LAT++  LEP+  + ++ RR L+GH  ++ ++ W+ D R+LVS SQDGKLIVWD +T  K   + + ++WVM CAY+P+G+ VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD TC LWD+E+GQ   +F GH+GDVMSL LSP    R FISG+CD    +WD+R G C Q + GHESD+N+V F+PSG+AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLLFAGY+D+  N+WD ++  R  +L GH+NR+SCL  + DG AVCTGSWDS L++
Sbjct:    7 LRQEAEQLKSQIREARKSANDTTLATVASNLEPIGRIQMRTRRTLRGHLAKIYAMHWASDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDF--RTFISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQERAGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: gpb-1 (Guanine nucleotide-binding protein subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:P17343])

HSP 1 Score: 196.052 bits (497), Expect = 6.180e-61
Identity = 89/153 (58.17%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  664 MSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            MSL LSP    R FISG+CD    +WD+R G C Q + GHESD+N+V F+PSG+AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLLFAGY+D+  N+WD ++  R  +L GH+NR+SCL  + DG AVCTGSWDS L++
Sbjct:    1 MSLSLSPDF--RTFISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQERAGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKI 151          

HSP 2 Score: 46.595 bits (109), Expect = 5.052e-6
Identity = 34/123 (27.64%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  505 KRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSL-DLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFD 870
            K+    H S ++   F  S     T S D+TC L+D+ + Q + + + H   +  +  ++ S+SGR+  +G  D   NVWD    +   V  GH++ V+ +     G A  TGS D+  ++++
Sbjct:   32 KQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQEL-AMYSHDNIICGITSVAFSKSGRLLFAGYDDFNCNVWDSMRQERAGVLAGHDNRVSCLGVTEDGMAVCTGSWDSFLKIWN 153          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Match: prp-4 (Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:Q93339])

HSP 1 Score: 103.99 bits (258), Expect = 8.780e-24
Identity = 76/287 (26.48%), Postives = 129/287 (44.95%), Query Frame = 1
Query:  289 SYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGA---------HVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            S D  H+V+    G + VW      +E    +  +    CA    GA         +V     D    ++ L + E P+ +   +  H   +S   F+ + + L TA  DST  ++D+ + + +    GHS  V  +   P   G V ++G  D    VWDMRTG+C+   +GH  +++SV + P+G    TGS D + +++DLR       Y   +       V    +G+ L +   D  + +W       +  L GH+ RI C+  SPDG  +C+ ++D T ++
Sbjct:  213 SADSEHIVTAGWSGSVAVWKREQCAQEIKF-IGHSSQAGCARFHPGAFTQNDYSSLNVVSCSYDGTVLLWSL-SQESPIGE---LEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSKSVADVAFHPD--GSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRN--TYTMPAHTSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKL 490          

HSP 2 Score: 73.559 bits (179), Expect = 7.795e-14
Identity = 52/205 (25.37%), Postives = 86/205 (41.95%), Query Frame = 1
Query:  526 TSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSE------SGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            T  ++ C+F+     ++TA    +  +W  E       F GHS         P        S    +S S D  V +W +     +   E H   V+ V F+P+G   AT   D+T R++DL    E+   +  S       V F   G +   G +D    +WD+     +  L+GH   I  ++  P+G  + TGS D++++V
Sbjct:  204 TRPVAFCEFSADSEHIVTAGWSGSVAVWKREQCAQEIKFIGHSSQAGCARFHPGAFTQNDYSSLNVVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQEGHSK--SVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKV 406          

HSP 3 Score: 50.0618 bits (118), Expect = 2.274e-6
Identity = 45/232 (19.40%), Postives = 89/232 (38.36%), Query Frame = 1
Query:  292 YDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPS----------------------------------------ESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            Y   ++VS S DG +++W     +    L      V   A+ P G H+A    D+   +Y L T ++ + ++     H+  ++   F+      LT   D    +WD+ +G+ I    GH+ ++ S++  P+                                         +G+  +S S D  + +W     Q ++  +GH++ +  V   P G    + + D T +L+
Sbjct:  264 YSSLNVVSCSYDGTVLLWSLSQESPIGELEQHPQRVSKVAFHPNGHHLATACFDSTWRMYDLTTKKELLYQE----GHSKSVADVAFHPDGSVALTGGHDCYGRVWDMRTGRCIMFLDGHTKEIHSVEWMPNGYEMITGSSDNSMKVWDLRMRRNTYTMPAHTSVVTRVRADAAGQYLVSASFDCTLKMWSTTGWQPLRQLQGHDTRILCVDISPDGQWMCSSAFDRTFKLW 491          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Gbeta5 (gene:FBgn0030011 transcript:FBtr0071189)

HSP 1 Score: 478.019 bits (1229), Expect = 3.296e-168
Identity = 208/335 (62.09%), Postives = 275/335 (82.09%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK KL E+R +L D +L+ ++++LE +  +NIK R++LKGHQ +VL   WS DKRH++S+SQDG+LI+WD FT  KE  ++M TTW+MACAY+P+G  VACGGLDNK T+YP+ +DE+   KKR V THTSY+SCC +  S+ Q+LT SGDSTC LWDVESGQ++QSFHGHSGDVM++DL+P+E+G  F+SGSCDR   +WDMR+G  VQ +EGH+SDVNSV+F+P GDA ATGSDD++CRL+D+RAD E+ V+ K+S++FG N+VDFS+SGRLLFAGYNDY +N+WD LKS RV +L GHEN++SC++ SPDGTA+ TGSWD T+RV
Sbjct:   22 LVREAENLKTKLEEERQKLNDVNLSNIAERLEQIAYVNIKPRKVLKGHQAKVLCTDWSPDKRHIISSSQDGRLIIWDAFTTNKEHAVTMPTTWIMACAYAPSGNFVACGGLDNKVTVYPITSDEEMAAKKRTVGTHTSYMSCCIYPNSDQQILTGSGDSTCALWDVESGQLLQSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRSGHVVQSFEGHQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRADREVAVFAKESIIFGVNSVDFSVSGRLLFAGYNDYTVNLWDTLKSERVCLLYGHENKVSCVQVSPDGTALSTGSWDYTIRV 356          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0331597)

HSP 1 Score: 365.155 bits (936), Expect = 5.174e-124
Identity = 170/341 (49.85%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  100 INNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +N    L +EA++LK  + + R    D  L   +  LEP+  + ++ RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD  T  K   + + ++WVM CAY+P+G++VACGGLDN C+IY L T E  V   R +  H  YLSCC+F L + Q++T+SGD +C LWD+E+G  + SF GH+GDVM+L L+P    + F+SG+CD    +WD+R G C Q + GHESD+N+V F+P+G AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD +K+ R  IL GH+NR+SCL  + +G AV TGSWDS LRV
Sbjct:    1 MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRF-LDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQ--CKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRV 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074110)

HSP 1 Score: 365.155 bits (936), Expect = 5.174e-124
Identity = 170/341 (49.85%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  100 INNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +N    L +EA++LK  + + R    D  L   +  LEP+  + ++ RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD  T  K   + + ++WVM CAY+P+G++VACGGLDN C+IY L T E  V   R +  H  YLSCC+F L + Q++T+SGD +C LWD+E+G  + SF GH+GDVM+L L+P    + F+SG+CD    +WD+R G C Q + GHESD+N+V F+P+G AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD +K+ R  IL GH+NR+SCL  + +G AV TGSWDS LRV
Sbjct:    1 MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRF-LDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQ--CKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRV 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074108)

HSP 1 Score: 365.155 bits (936), Expect = 5.174e-124
Identity = 170/341 (49.85%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  100 INNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +N    L +EA++LK  + + R    D  L   +  LEP+  + ++ RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD  T  K   + + ++WVM CAY+P+G++VACGGLDN C+IY L T E  V   R +  H  YLSCC+F L + Q++T+SGD +C LWD+E+G  + SF GH+GDVM+L L+P    + F+SG+CD    +WD+R G C Q + GHESD+N+V F+P+G AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD +K+ R  IL GH+NR+SCL  + +G AV TGSWDS LRV
Sbjct:    1 MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRF-LDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQ--CKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRV 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074107)

HSP 1 Score: 365.155 bits (936), Expect = 5.174e-124
Identity = 170/341 (49.85%), Postives = 235/341 (68.91%), Query Frame = 1
Query:  100 INNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +N    L +EA++LK  + + R    D  L   +  LEP+  + ++ RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD  T  K   + + ++WVM CAY+P+G++VACGGLDN C+IY L T E  V   R +  H  YLSCC+F L + Q++T+SGD +C LWD+E+G  + SF GH+GDVM+L L+P    + F+SG+CD    +WD+R G C Q + GHESD+N+V F+P+G AFATGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD +K+ R  IL GH+NR+SCL  + +G AV TGSWDS LRV
Sbjct:    1 MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRF-LDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQ--CKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRV 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gnb5a (guanine nucleotide binding protein (G protein), beta 5a [Source:NCBI gene;Acc:562813])

HSP 1 Score: 462.996 bits (1190), Expect = 4.143e-162
Identity = 213/344 (61.92%), Postives = 270/344 (78.49%), Query Frame = 1
Query:   97 PINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            P ++   L  E+DTLK KL E+R +L D +L  +++K+E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  VACGGLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ Q+LT+SGD TC LWDVESGQM+QSFHGH+ DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQCVQ +E H+SD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLF GYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLR+
Sbjct:   10 PGDSLATLKSESDTLKSKLEEERAKLHDVELHQVAEKIEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSACCFTNSDMQILTSSGDGTCALWDVESGQMLQSFHGHAADVLCLDLAPSETGNTFVSGGCDKKACVWDMRTGQCVQSFESHDSDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFGGYNDYTINVWDVLKGARVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRI 353          

HSP 2 Score: 70.4774 bits (171), Expect = 7.709e-13
Identity = 52/190 (27.37%), Postives = 91/190 (47.89%), Query Frame = 1
Query:  304 HLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
             ++++S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + T +      +   +H S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+   G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  169 QILTSSGDGTCALWDVESGQMLQSFHGHAADVLCLDLAPSETGNTFVSGGCDKKACVWDMRTGQ----CVQSFESHDSDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFGGYNDYTINVWDVLKGARVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRIW 354          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gnb5b (guanine nucleotide binding protein (G protein), beta 5b [Source:NCBI gene;Acc:393719])

HSP 1 Score: 460.299 bits (1183), Expect = 1.551e-160
Identity = 210/337 (62.31%), Postives = 270/337 (80.12%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  E+++LK KL E+R +L D +L  +++K+E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD +T  KE  ++M  TWVMACAY+P+G  VACGGLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ Q+LT+SGD TC LWDVESGQ++QSFHGHS DV+SLDL+PSE+G  F+SG CD+  NVWDMR+GQ VQ +E H+SD+NSV++YPSGDAFA+GSDDATCRL+DLRAD E+ +Y KDS++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RVAIL GHENR+S ++ SPDGTA C+GSWD+TLR+
Sbjct:   57 LKAESESLKAKLEEERAKLHDVELHQVAEKMEALGQFVMKTRRTLKGHGNKVLCMDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLASKKKSVAMHTNYLSSCSFTKSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADVLSLDLAPSETGSTFVSGGCDKKANVWDMRSGQNVQSFETHDSDINSVKYYPSGDAFASGSDDATCRLYDLRADREVAIYSKDSIIFGASSVDFSLSGRLLFAGYNDYNINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRI 393          

HSP 2 Score: 75.485 bits (184), Expect = 2.393e-14
Identity = 55/211 (26.07%), Postives = 103/211 (48.82%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + S +++     ++++S DG   +WD  +    + F    A    +  A S TG+    GG D K  ++ + + ++     +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V++VR  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSSCSFTKSDMQILTSSGDGTCALWDVESGQLLQSFHGHSADVLSLDLAPSETGSTFVSGGCDKKANVWDMRSGQNV----QSFETHDSDINSVKYYPSGDAFASGSDDATCRLYDLRADREVAIYSKDSIIFGASSVDFSLSGRLLFAGYNDYNINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLRIW 394          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gnb1b (guanine nucleotide binding protein (G protein), beta polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2855])

HSP 1 Score: 380.178 bits (975), Expect = 7.569e-130
Identity = 172/335 (51.34%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ VY  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gnb1b (guanine nucleotide binding protein (G protein), beta polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2855])

HSP 1 Score: 380.178 bits (975), Expect = 7.569e-130
Identity = 172/335 (51.34%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ VY  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Match: gnb1b (guanine nucleotide binding protein (G protein), beta polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2855])

HSP 1 Score: 380.178 bits (975), Expect = 7.569e-130
Identity = 172/335 (51.34%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ VY  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: taf13 (TATA-box binding protein associated factor 13 [Source:Xenbase;Acc:XB-GENE-5785406])

HSP 1 Score: 449.129 bits (1154), Expect = 6.197e-156
Identity = 212/352 (60.23%), Postives = 273/352 (77.56%), Query Frame = 1
Query:   79 LMSVEAPINND--GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +M+ E    N+    L  EA++LK+KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQC+Q +E HESD+NSVR+YPSGDAFA+GSDDA+CRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLR+
Sbjct:   42 MMATEGLQENETLASLKNEAESLKEKLEEERAKLHDVELHQVAERVESLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRTGQCIQSFETHESDINSVRYYPSGDAFASGSDDASCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRI 393          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: taf13 (TATA-box binding protein associated factor 13 [Source:Xenbase;Acc:XB-GENE-5785406])

HSP 1 Score: 440.654 bits (1132), Expect = 1.323e-153
Identity = 199/314 (63.38%), Postives = 250/314 (79.62%), Query Frame = 1
Query:  187 LATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQC+Q +E HESD+NSVR+YPSGDAFA+GSDDA+CRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:    7 LHQVAERVESLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRTGQCIQSFETHESDINSVRYYPSGDAFASGSDDASCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 320          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: taf13 (TATA-box binding protein associated factor 13 [Source:Xenbase;Acc:XB-GENE-5785406])

HSP 1 Score: 440.654 bits (1132), Expect = 1.753e-153
Identity = 199/314 (63.38%), Postives = 250/314 (79.62%), Query Frame = 1
Query:  187 LATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQC+Q +E HESD+NSVR+YPSGDAFA+GSDDA+CRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:    6 LHQVAERVESLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRTGQCIQSFETHESDINSVRYYPSGDAFASGSDDASCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 319          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: taf13 (TATA-box binding protein associated factor 13 [Source:Xenbase;Acc:XB-GENE-5785406])

HSP 1 Score: 439.884 bits (1130), Expect = 2.983e-153
Identity = 198/311 (63.67%), Postives = 249/311 (80.06%), Query Frame = 1
Query:  196 LSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQC+Q +E HESD+NSVR+YPSGDAFA+GSDDA+CRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   12 VAERVESLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRTGQCIQSFETHESDINSVRYYPSGDAFASGSDDASCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 322          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Match: taf13 (TATA-box binding protein associated factor 13 [Source:Xenbase;Acc:XB-GENE-5785406])

HSP 1 Score: 440.269 bits (1131), Expect = 4.283e-153
Identity = 201/322 (62.42%), Postives = 254/322 (78.88%), Query Frame = 1
Query:  163 RNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            R R++   L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMRTGQC+Q +E HESD+NSVR+YPSGDAFA+GSDDA+CRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   22 RKRVR---LHQVAERVESLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRTGQCIQSFETHESDINSVRYYPSGDAFASGSDDASCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 340          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:MGI Symbol;Acc:MGI:101848])

HSP 1 Score: 466.848 bits (1200), Expect = 4.992e-163
Identity = 224/381 (58.79%), Postives = 282/381 (74.02%), Query Frame = 1
Query:    4 LLP*FK--HNLNYCF----IVFSNNLFNKSFLMSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L P FK    LNYC     I+ ++ L     L S          L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESDVNSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   23 LRPVFKKSQQLNYCSTCAEIMATDGLHENETLAS----------LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393          

HSP 2 Score: 70.8626 bits (172), Expect = 9.015e-13
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 394          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:MGI Symbol;Acc:MGI:101848])

HSP 1 Score: 466.848 bits (1200), Expect = 4.992e-163
Identity = 224/381 (58.79%), Postives = 282/381 (74.02%), Query Frame = 1
Query:    4 LLP*FK--HNLNYCF----IVFSNNLFNKSFLMSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L P FK    LNYC     I+ ++ L     L S          L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESDVNSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   23 LRPVFKKSQQLNYCSTCAEIMATDGLHENETLAS----------LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393          

HSP 2 Score: 70.8626 bits (172), Expect = 9.015e-13
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 394          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:MGI Symbol;Acc:MGI:101848])

HSP 1 Score: 464.151 bits (1193), Expect = 1.213e-162
Identity = 212/337 (62.91%), Postives = 267/337 (79.23%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESDVNSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   15 LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 70.8626 bits (172), Expect = 5.920e-13
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnb2 (guanine nucleotide binding protein (G protein), beta 2 [Source:MGI Symbol;Acc:MGI:95784])

HSP 1 Score: 370.933 bits (951), Expect = 3.713e-126
Identity = 171/335 (51.04%), Postives = 233/335 (69.55%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ L+ ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ    F GHSGDVMSL L+P   GR F+SG+CD  + +WD+R   C Q + GHESD+N+V F+P+G AF TGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD--GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Match: Gnb2 (guanine nucleotide binding protein (G protein), beta 2 [Source:MGI Symbol;Acc:MGI:95784])

HSP 1 Score: 370.933 bits (951), Expect = 3.713e-126
Identity = 171/335 (51.04%), Postives = 233/335 (69.55%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ L+ ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ    F GHSGDVMSL L+P   GR F+SG+CD  + +WD+R   C Q + GHESD+N+V F+P+G AF TGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPD--GRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|Q5RDY7|GNB5_PONAB (Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii OX=9601 GN=GNB5 PE=2 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 3.107e-162
Identity = 214/351 (60.97%), Postives = 273/351 (77.78%), Query Frame = 1
Query:   82 MSVEAPINND--GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            M+ E    N+    L  EA++LK KL E+R +L+D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:    1 MATEGLHENETLASLKSEAESLKGKLEEERAKLRDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 71.2478 bits (173), Expect = 3.548e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|P62881|GNB5_MOUSE (Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus OX=10090 GN=Gnb5 PE=1 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 3.492e-162
Identity = 224/381 (58.79%), Postives = 282/381 (74.02%), Query Frame = 1
Query:    4 LLP*FK--HNLNYCF----IVFSNNLFNKSFLMSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L P FK    LNYC     I+ ++ L     L S          L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESDVNSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   23 LRPVFKKSQQLNYCSTCAEIMATDGLHENETLAS----------LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393          

HSP 2 Score: 70.8626 bits (172), Expect = 6.306e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 394          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|P62882|GNB5_RAT (Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus OX=10116 GN=Gnb5 PE=2 SV=1)

HSP 1 Score: 464.151 bits (1193), Expect = 8.484e-162
Identity = 212/337 (62.91%), Postives = 267/337 (79.23%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESDVNSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   15 LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 70.8626 bits (172), Expect = 4.141e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDVNSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|Q80ZD0|GNB5_TAMST (Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus OX=45474 GN=GNB5 PE=2 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 1.372e-161
Identity = 211/337 (62.61%), Postives = 267/337 (79.23%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   15 LKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 71.2478 bits (173), Expect = 3.422e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Match: sp|O14775|GNB5_HUMAN (Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens OX=9606 GN=GNB5 PE=1 SV=2)

HSP 1 Score: 465.307 bits (1196), Expect = 1.381e-161
Identity = 221/379 (58.31%), Postives = 282/379 (74.41%), Query Frame = 1
Query:    4 LLP*FK--HNLNYCFIVFSNNLFNKSFLMSVEAPINND--GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITD--EDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L P FK    L+YC           + +M+ E    N+    L  EA++LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D  E+   KK+ VA HT+YLS C F  S+ Q+LTASGD TC LWDVESGQ++QSFHGH  DV+ LDL+PSE+G  F+SG CD+   VWDMR+GQCVQ +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK +RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:   23 LRPVFKKSQQLSYCSTC--------AEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 393          

HSP 2 Score: 70.8626 bits (172), Expect = 6.306e-12
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     +++ S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+  +G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  188 KKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCV----QAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 394          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A0X3PK53 (Guanine nucleotide-binding protein subunit beta-5 OS=Schistocephalus solidus OX=70667 GN=GBB5 PE=4 SV=1)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 250/340 (73.53%), Postives = 302/340 (88.82%), Query Frame = 1
Query:  103 NNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            N+DG L  E D+LK+KL EDR+++ DG++  +SQ  E VP+ N+KVRR+LKGHQG+VL LAWS DKRH+VS+SQDGKL+VWD F++TKEF +SM TTWVMAC++SP+ A VACGGLDNKCT+YPL  DEDPV +K+LVATH+SYLSCC FN+S++QLLT SGDS+C+LWDVESGQMIQSFHGH+GDVM +D SPSE GRVF+SGS DRC NVWDMR+GQCVQV++GH+SDVN+VRF+PSGDAFAT SDDAT RLFDLR D E+CVYKKDSV+FGCNAVDFSLSGRL+F GYND+++N+WDVLK  RV+IL GHENR+SCL+TSPDG A+CTGSWD+TLRV
Sbjct:    4 NSDGRLQHEVDSLKRKLEEDRSKMSDGEITCMSQHFEAVPAFNVKVRRILKGHQGKVLGLAWSLDKRHVVSSSQDGKLLVWDAFSSTKEFCISMPTTWVMACSFSPSNAVVACGGLDNKCTVYPLTPDEDPVTRKKLVATHSSYLSCCLFNMSDHQLLTGSGDSSCILWDVESGQMIQSFHGHAGDVMCIDNSPSECGRVFVSGSSDRCANVWDMRSGQCVQVFQGHDSDVNAVRFFPSGDAFATASDDATIRLFDLRTDRELCVYKKDSVIFGCNAVDFSLSGRLIFGGYNDHVLNVWDVLKGKRVSILYGHENRVSCLRTSPDGNAICTGSWDTTLRV 343          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A183VS13 (WD_REPEATS_REGION domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3269 PE=4 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 254/339 (74.93%), Postives = 299/339 (88.20%), Query Frame = 1
Query:  109 DGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRVL 1125
            D  L +E D+LK+KL ++RN+L D DL T SQ L+ VPSLNI++RR+LKGHQG+VLSLAWS DKRH+VS+SQDGK++VWDGFT +KE+ +SM TTWVM+CAYSP+G  VACGGLDNKCT+YPL +DEDP+LKK+LVATHTSYLS C FN+S++QLLT SGDSTCVLWDVE  Q+IQSF+GHS DV+S+ LSPSE GR F+SGSCDRC NVWDMRTGQCVQV++GHESDVNSVRF+PSGDAFATGSDDAT RLFDLRAD E+CVY+KDSV+F CNAVDFSLSGRLLF GY+D+ MNIWDVLK  R++IL  HENRIS L+ SPDGTA+CTGSWD+TLR L
Sbjct:   12 DAQLIQEVDSLKRKLEDERNKLADEDLVTASQHLDAVPSLNIRIRRVLKGHQGKVLSLAWSLDKRHIVSSSQDGKILVWDGFTTSKEYSISMPTTWVMSCAYSPSGNFVACGGLDNKCTVYPLTSDEDPILKKKLVATHTSYLSSCLFNISDHQLLTGSGDSTCVLWDVEYAQIIQSFYGHSADVLSIALSPSEFGRTFVSGSCDRCANVWDMRTGQCVQVFQGHESDVNSVRFFPSGDAFATGSDDATIRLFDLRADREVCVYRKDSVIFACNAVDFSLSGRLLFGGYSDHAMNIWDVLKGQRISILYCHENRISSLRVSPDGTAICTGSWDTTLRPL 350          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A2H1CCN1 (Guanine nucleotide binding protein subunit OS=Fasciola hepatica OX=6192 GN=D915_004962 PE=4 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 309/345 (89.57%), Query Frame = 1
Query:   88 VEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +E+P  +D  L +EAD+L++KL ++RNRL DG+L   SQ L+P+P++NI+VRR+LKGHQG+VL LAW+ DKRH+VS+SQDGK++VWDGFT+TKE  +SM TTWVM+CAYSP+G  VACGGLDNKCT++PLI DEDPV +K+LVATHTSYL+CCQFN S++QLLT SGDSTCVLWD+ES Q+IQSFHGHSGDV+SL  SPSESGRVFISG CDRC NVWDMRTGQCVQV++GH+SDVNSVRFYPSGDAFATGSDDAT RLFDLRAD E+CVYKKDSV+FGCNA+DFSLSGRLLF GY+D+ +N+WDVLK  RV IL GHENRIS L+TSPDGTA+CTGSWD+T+R+
Sbjct:    1 MESP-QDDSQLIQEADSLRRKLEDERNRLNDGNLVVASQNLDPIPTVNIRVRRVLKGHQGKVLCLAWATDKRHIVSSSQDGKILVWDGFTSTKEHSVSMPTTWVMSCAYSPSGGFVACGGLDNKCTVFPLIADEDPVRRKKLVATHTSYLACCQFNFSDHQLLTGSGDSTCVLWDIESAQIIQSFHGHSGDVLSLSSSPSESGRVFISGGCDRCANVWDMRTGQCVQVFQGHDSDVNSVRFYPSGDAFATGSDDATIRLFDLRADREVCVYKKDSVIFGCNAIDFSLSGRLLFGGYSDHAINVWDVLKGQRVNILYGHENRISSLRTSPDGTAICTGSWDATVRI 344          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A504YV10 (Guanine nucleotide binding protein subunit OS=Fasciola gigantica OX=46835 GN=FGIG_02066 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 309/345 (89.57%), Query Frame = 1
Query:   88 VEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +E+P  +D  L +EAD+L++KL ++RNRL DG+L   SQ L+P+P++NI+VRR+LKGHQG+VL LAW+ DKRH+VS+SQDGK++VWDGFT+TKE  +SM TTWVM+CAYSP+G  VACGGLDNKCT++PLI DEDPV +K+LVATHTSYL+CCQFN S++QLLT SGDSTCVLWD+ES Q+IQSFHGHSGDV+SL  SPSESGRVFISG CDRC NVWDMRTGQCVQV++GH+SDVNSVRFYPSGDAFATGSDDAT RLFDLRAD E+CVYKKDSV+FGCNA+DFSLSGRLLF GY+D+ +N+WDVLK  RV IL GHENRIS L+TSPDGTA+CTGSWD+T+R+
Sbjct:    1 MESP-QDDSQLIQEADSLRRKLEDERNRLNDGNLVIASQNLDPIPTVNIRVRRVLKGHQGKVLCLAWATDKRHIVSSSQDGKILVWDGFTSTKEHSVSMPTTWVMSCAYSPSGGFVACGGLDNKCTVFPLIADEDPVRRKKLVATHTSYLACCQFNFSDHQLLTGSGDSTCVLWDIESAQIIQSFHGHSGDVLSLSSSPSESGRVFISGGCDRCANVWDMRTGQCVQVFQGHDSDVNSVRFYPSGDAFATGSDDATIRLFDLRADREVCVYKKDSVIFGCNAIDFSLSGRLLFGGYSDHAINVWDVLKGQRVNILYGHENRISSLRTSPDGTAICTGSWDATVRI 344          
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Match: A0A3P7BU50 (WD_REPEATS_REGION domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10923 PE=4 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 252/349 (72.21%), Postives = 302/349 (86.53%), Query Frame = 1
Query:   82 MSVE--APINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            M+VE    + ++  L KEAD LK+KL E++ RL DG++  +S+  + +PS+NIKVRR+LKGHQG+VLSLAWS DKRH+VS+SQDGKL VWD FT+TKE+ +SM TTWVMAC +SP+ + VACGGLDNKCTIYPL+++EDP LKK+LVATH+SYLSCC FNLS++QLLT SGDS+C+LWDVES QMIQSFHGHSGDVM +D SPSE GR+FISGSCDRC NVWDMR+GQC QV++GHESD+NSVRF+PSGDAFAT SDDAT RLFDLR D E+CVYKKDSV+FGCNAVDFSLSGRLLF GYND+ +NIWD LK  R++IL GHENR+S L+T PDG A+CTGSWDSTLR+
Sbjct:    1 MAVEILMEVQSEPQLLKEADNLKRKLEEEKARLNDGEITFMSEHFDSIPSVNIKVRRVLKGHQGKVLSLAWSLDKRHVVSSSQDGKLFVWDAFTSTKEYCISMPTTWVMACTFSPSNSFVACGGLDNKCTIYPLLSEEDPTLKKKLVATHSSYLSCCLFNLSDHQLLTGSGDSSCILWDVESAQMIQSFHGHSGDVMCIDGSPSECGRIFISGSCDRCANVWDMRSGQCAQVFQGHESDINSVRFFPSGDAFATASDDATIRLFDLRTDRELCVYKKDSVIFGCNAVDFSLSGRLLFGGYNDHSLNIWDALKGKRISILYGHENRVSSLRTCPDGNAICTGSWDSTLRI 349          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gnb5a (guanine nucleotide-binding protein subunit beta-5a [Source:NCBI gene;Acc:103032917])

HSP 1 Score: 466.848 bits (1200), Expect = 1.027e-163
Identity = 211/344 (61.34%), Postives = 269/344 (78.20%), Query Frame = 1
Query:   97 PINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            P      L  E++ LK KL E+R +L D +L  +++K+EP+    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  VACGGLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ Q+LT+SGD TC LWDVESGQ++QSFHGH+ DV+ LDL+PSE+G  F+SG CD+  NVWDMR+GQC+Q +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFS+SGRLLF GYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA C+GSWD TLRV
Sbjct:    8 PSETIAKLKSESEALKTKLEEERAKLHDVELHQVAEKVEPLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSACSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHAADVLCLDLAPSETGNTFVSGGCDKKANVWDMRSGQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSISGRLLFGGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRV 351          

HSP 2 Score: 71.2478 bits (173), Expect = 3.637e-13
Identity = 53/211 (25.12%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  241 RRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNT--KEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            ++ +  H   + + +++     ++++S DG   +WD  +    + F    A    +  A S TG     GG D K  ++ + + +      +   TH S ++  ++  S     + S D+TC L+D+ + + +  +   S    +  +  S SGR+   G  D  +NVWD+  G  V +  GHE+ V+++R  P G AF +GS D T R++
Sbjct:  146 KKSVAMHTNYLSACSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHAADVLCLDLAPSETGNTFVSGGCDKKANVWDMRSGQCI----QSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSISGRLLFGGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVW 352          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gnb5b (guanine nucleotide binding protein (G protein), beta 5b [Source:NCBI gene;Acc:393719])

HSP 1 Score: 457.988 bits (1177), Expect = 3.871e-160
Identity = 209/336 (62.20%), Postives = 268/336 (79.76%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLR 1119
            L  E++ LK KL E+R++L D +L  +++K+E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD +T  KE  ++M  TWVMACAY+P+G  +ACGGLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ QLLT+SGD TC LWDVESGQ++QSFHGHS DV+SL+L+PSE+G  F+SG CD+  NVWDMR+GQ +Q +E HESD+N VR+YPSGDAFATGSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RVAIL GHENR+S ++ SPDGTA C+GSWD+TLR
Sbjct:   15 LRAESENLKAKLEEERSKLHDVELHQVAEKVEALGQFVMKTRRTLKGHGNKVLCMDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLSLDKNENLSAKKKSVAMHTNYLSSCSFTNSDMQLLTSSGDGTCALWDVESGQLLQSFHGHSADVLSLNLAPSETGNTFVSGGCDKKANVWDMRSGQNIQSFETHESDINCVRYYPSGDAFATGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVAILFGHENRVSTVRVSPDGTAFCSGSWDNTLR 350          

HSP 2 Score: 53.1434 bits (126), Expect = 3.402e-7
Identity = 47/212 (22.17%), Postives = 89/212 (41.98%), Query Frame = 1
Query:  505 KRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEG------HESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            +R +  H + + C  +   + +++++S D   ++WD  +     +       VM+   +PS  G     G  D   +V+ +   +   +         H + ++S  F  S     T S D TC L+D+ +   +  +   S       +  S +G    +G  D   N+WD+     +     HE+ I+C++  P G A  TGS D+T R+
Sbjct:   56 RRTLKGHGNKVLCMDWCRDKRRIVSSSQDGKVIVWDAYTTNKEHAVTMPCTWVMACAYAPS--GCAIACGGLDNKCSVYPLSLDKNENLSAKKKSVAMHTNYLSSCSFTNSDMQLLTSSGDGTCALWDVESGQLLQSFHGHSADVLSLNLAPSETGNTFVSGGCDKKANVWDMRSGQNIQSFETHESDINCVRYYPSGDAFATGSDDATCRL 265          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gnb1a (G protein subunit beta 1 [Source:NCBI gene;Acc:103044197])

HSP 1 Score: 378.637 bits (971), Expect = 3.282e-129
Identity = 171/335 (51.04%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F + + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ VY  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF-VDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gnb2 (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 [Source:NCBI gene;Acc:103031762])

HSP 1 Score: 377.867 bits (969), Expect = 5.907e-129
Identity = 176/335 (52.54%), Postives = 234/335 (69.85%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L  ++  L+PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G  VACGGLDN C+IY L T E  V   R +  HT YLSCC+F + + Q++T+SGD+ C LWDVE+GQ I  F GHSGDVMSL LSP    R F+SG+CD  + +WD+R   C Q + GHESD+N+V F+PSG AFATGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  NIWD +K +R  +L GH+NR+SCL  S DG AVCTGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-IDDNQIITSSGDTACALWDVETGQQITLFSGHSGDVMSLSLSPDS--RTFVSGACDASIKLWDIRDSMCRQTFTGHESDINAVCFFPSGSAFATGSDDATCRLFDLRADQELGLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVSDDGMAVCTGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Match: gnb1b (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1-like [Source:NCBI gene;Acc:103023031])

HSP 1 Score: 377.867 bits (969), Expect = 6.658e-129
Identity = 171/335 (51.04%), Postives = 239/335 (71.34%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F + + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ VY  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRF-VDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RTFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDSLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 300.827 bits (769), Expect = 8.440e-101
Identity = 137/249 (55.02%), Postives = 186/249 (74.70%), Query Frame = 1
Query:  376 LSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            + + ++WVM C+Y+P+G +VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + +++T+SGD+TC LWD+E+GQ   +F GHSGDVMSL L+P   GR F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD +K+ R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    5 IPLRSSWVMTCSYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-LDDNRIVTSSGDTTCALWDIETGQQTTAFVGHSGDVMSLALAPD--GRAFVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELVLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNVWDAMKAERAGVLAGHDNRVSCLGVTEDGMAVATGSWDSFLKI 250          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009560.1 (pep scaffold:Pmarinus_7.0:GL479618:22463:45788:1 gene:ENSPMAG00000008637.1 transcript:ENSPMAT00000009560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.81 bits (608), Expect = 8.542e-77
Identity = 109/229 (47.60%), Postives = 154/229 (67.25%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSV 804
            L +EAD LK ++ + R   KD  L  ++  L+ V  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G++VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD+TC LWD+E+ Q   +F GH+GDVMSL L+P    R F+SG+CD    +WD+R G C Q + GHESD+N+V
Sbjct:    7 LRQEADQLKNQIRDARKACKDATLLQVTSNLDSVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRF-LDDNQIITSSGDTTCALWDIETAQQTTTFTGHTGDVMSLSLAPDS--RTFVSGACDASAKLWDVRDGMCRQTFTGHESDINAV 232          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 184.111 bits (466), Expect = 2.920e-56
Identity = 85/167 (50.90%), Postives = 120/167 (71.86%), Query Frame = 1
Query:  307 LVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTS-YLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSV 804
            LVS SQDGKLIVWD +TN K   + + ++WVM CAY+P+G  VACGGLDN C++Y L + E  +   R +  H   YLSCC+F L + ++LT+SGD+ C LWD+E+G++  +F GH+GDVMSL +SP   GR+F+SG+CD    +WD+R  +C Q + GHESD+N++
Sbjct:   32 LVSASQDGKLIVWDTYTNNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSVYSLKSREGNIKVTRELPGHNGRYLSCCRF-LDDTKILTSSGDTLCCLWDIETGRLSSTFMGHTGDVMSLSMSP--DGRMFVSGACDSSAKLWDVREVKCRQTFTGHESDINAI 195          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: GNB5 (G protein subunit beta 5 [Source:HGNC Symbol;Acc:HGNC:4401])

HSP 1 Score: 165.236 bits (417), Expect = 7.443e-49
Identity = 85/172 (49.42%), Postives = 115/172 (66.86%), Query Frame = 1
Query:   79 LMSVEAPINNDG--DLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACG--GLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLL 576
            LM+ E    N+    L  EA+ LK KL E+R +L D +L  +++++E +    +K RR LKGH  +VL + W  DKR LVS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  +ACG  GLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ Q+L
Sbjct:   42 LMASEGLQENETIDGLQGEAENLKMKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRLVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAIACGDRGLDNKCSVYPLSMDKNENLAAKKKSVAMHTNYLSACCFTNSDMQVL 213          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009090.1 (pep scaffold:Pmarinus_7.0:GL482486:1956:2971:1 gene:ENSPMAG00000008228.1 transcript:ENSPMAT00000009090.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 4.628e-40
Identity = 62/105 (59.05%), Postives = 79/105 (75.24%), Query Frame = 1
Query:  808 FYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            F+P+G AF TGSDDATCRLFD+RAD E+CVY  D V+ G  ++ FS SGRL+ AGY+D+  NIWD +K  +  +L GH+NR+SCL  + DG AV TGSWDS L+V
Sbjct:    1 FFPNGQAFVTGSDDATCRLFDIRADQELCVYANDGVVCGVTSIAFSRSGRLVLAGYDDFNCNIWDGMKQEKAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKV 105          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: STE4 (G protein beta subunit; forms a dimer with Ste18p to activate mating signaling pathway, forms heterotrimer with Gpa1p and Ste18p to dampen signaling; pheromone-induced phosphorylation plays critical role in chemotropism; may recruit Rho1p to polarized growth site during mating; contains WD40 repeats [Source:SGD;Acc:S000005738])

HSP 1 Score: 221.476 bits (563), Expect = 7.078e-68
Identity = 129/412 (31.31%), Postives = 218/412 (52.91%), Query Frame = 1
Query:   43 IVFSNNLFNKSF-------LMSVEAPINNDGDLSK-EADTLKKKLVEDRNRLKDGDLATLSQKLEPVPS--LNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKK--RLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSE-----SGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVY-------------------------------KKDSVLF----GCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            I +SNN+  +         + +VE  I N  + ++ E+  L  ++ + +++++D  L  ++ K+  +    +N+K   +LKGH  ++    WS D + ++S SQDG +++WD  +  K+  + + + WV++CA SP+   VA  GL+N CTIY  ++ E+ V +    +   HT Y+S  +F  + + +LTASGD TC LWD+   + ++ +  H GDV++L + P E     S   F S   D    +WD R+   VQ +  ++SD+N++RF+  G +   GSD+    ++DLR+D  I  +                               K  S  +    G  ++DFS SGRL+++ Y D    +WDVLK   V  L GH  R++ +++SPDG AVCTGSWDST+++
Sbjct:    9 ITYSNNVTQQYIQPQSLQDISAVEDEIQNKIEAARQESKQLHAQINKAKHKIQDASLFQMANKVTSLTKNKINLKPNIVLKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIY-RVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAI-PEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFRGYEERTPTPTYMAANMEYNTAQSPQTLKSTSSSYLDNQGVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRSSPDGLAVCTGSWDSTMKI 417          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 105.531 bits (262), Expect = 1.059e-24
Identity = 68/234 (29.06%), Postives = 113/234 (48.29%), Query Frame = 1
Query:  244 RLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCT------IYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGH-ESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFG 924
            + L GH G V S ++S D ++L+S S+D  + +W   T+T           V   ++SP G + A    D          IYPL          R+ A H + + C  F+ +   + T S D TC +WDV +G  ++ F GH+  V+S+ + P   GR   +GS D  +NVWD+ TG+ ++   GH ++ + S+ +   G+   +G  D T R++DL+  +     + D    G
Sbjct:  519 KTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPL----------RIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCP--DGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIG 740          

HSP 2 Score: 101.679 bits (252), Expect = 2.317e-23
Identity = 66/218 (30.28%), Postives = 107/218 (49.08%), Query Frame = 1
Query:  484 DEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLS----GRLLFAGYNDYIMNIWDVLKSNRVAILNGH-ENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            DEDP  K   +  H+  +    F+     LL+ S D T  LW +++   + S+ GH+  V  +  SP   G  F + S D+   +W       ++++ GH +DV+ V F+P+G    TGS D TCR++D+     + ++       G  A   S++    GR L  G  D I+N+WD+    R+  + GH +N I  L  S +G  + +G  D T+RV
Sbjct:  513 DEDPTCK--TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPL--GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF------LGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRV 720          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 95.5153 bits (236), Expect = 2.144e-21
Identity = 79/321 (24.61%), Postives = 135/321 (42.06%), Query Frame = 1
Query:  250 LKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTN----------------------------TKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDL-RADSEICVYKKDSVLFGCNAVDFSLSGRLLFAG-YNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
              GH+  V+   +S+D+  + + S+DG + VW+ FT                             TK+         V    + P    +A G    +  +Y L    D  L ++L        +       E+    +S     ++++ +S   I    GH     SL  SP   G   ++ S D  + VWD+ +G C+  +E H S V +V+F   G    + S D T R +DL R  +       + + F C AVD   SG ++ AG  +++ +++W V     +  L+GHE  +SCL  S + + + + SWD T+R+
Sbjct:  187 FNGHRDYVMGAFFSHDQEKIYTVSKDGAVFVWE-FTKRPSDDDDNESEDDDKQEEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDL---PDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPD--GSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVD--PSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRI 499          

HSP 2 Score: 63.929 bits (154), Expect = 2.681e-11
Identity = 55/218 (25.23%), Postives = 95/218 (43.58%), Query Frame = 1
Query:  253 KGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCV-LWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDM--RTGQC--VQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEI 891
            +GH     SLA+S D   +V+ S+DGK+ VWD  +          T+ V A  ++  G  +    LD     + LI   +    +    T     +C   + S   +   S D+  + +W V++GQ++ +  GH G V  L  S   S  V  S S D+ + +W +  R+ Q   ++VY    SDV ++   P G   A  +      +F++    ++
Sbjct:  342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRN---FRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENS--VLASASWDKTIRIWSIFGRSQQVEPIEVY----SDVLALSMRPDGKEVAVSTLKGQISIFNIEDAKQV 550          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: ASC1 (G-protein beta subunit and guanine dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; required to prevent frameshifting at ribosomes stalled at repeated CGA codons; regulates P-body formation induced by replication stress; represses Gcn4p in the absence of amino acid starvation [Source:SGD;Acc:S000004722])

HSP 1 Score: 84.3445 bits (207), Expect = 1.368e-18
Identity = 82/294 (27.89%), Postives = 119/294 (40.48%), Query Frame = 1
Query:  238 VRRLLKGHQGRVLSLAWSYDKRHLV-STSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTL 1116
            +R  L+GH G V SLA S  + +L+ S S+D  LI W    + ++FG+                                      PV   R    H+  +  C         L+AS D T  LWDV +G+  Q F GH  DVMS+D+    S  + ISGS D+ + VW ++ GQC+    GH   V+ VR  P+  A     DD                   DSV              ++ AG ND ++  W++ +    A   GH + I+ L  SPDGT + +   D  +
Sbjct:    9 LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGV--------------------------------------PV---RSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS--MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKA-----DD-------------------DSV-------------TIISAG-NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEI 220          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Match: PFS2 (Integral subunit of the pre-mRNA CPF complex; the cleavage and polyadenylation factor (CPF) complex plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex [Source:SGD;Acc:S000005261])

HSP 1 Score: 84.7297 bits (208), Expect = 3.977e-18
Identity = 74/290 (25.52%), Postives = 131/290 (45.17%), Query Frame = 1
Query:  271 VLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPS-GDAFATGSDDATCRLFDLRADSE--ICVY-KKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILN---GHENRISCLKTSPDGTAVCTGSWDSTLR 1119
            + ++ W+ + R LV  +  G+  +W+  + T E  +    + V    YS     +  G  D    I+      +  + K + A HT  +    F+ ++ + +T S D+   +W+  +G+  +   GH  DV S D  P E G +  S S D  V +WD R+G C+      +  V   RF P+ G+     S D +CR+FD+R   +  +CV  + D +    + ++ S+      A Y D  +  +D+L++    IL     H+  I+ L  +P G    T + D T+R
Sbjct:   96 IPAIQWTPEGRRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIW----QPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHP-EMG-LIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETDYMTLEWHPINESM---FTLACY-DGSLKHFDLLQNLNEPILTIPYAHDKCITSLSYNPVGHIFATAAKDRTIR 375          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO37631 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF63])

HSP 1 Score: 455.292 bits (1170), Expect = 1.073e-159
Identity = 206/346 (59.54%), Postives = 266/346 (76.88%), Query Frame = 1
Query:   85 SVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            S   P+ +   L+KEA+ LK ++ E++N+  D +L  +S+KLE +   ++KVRR+LKGHQG+VLS+ WS D RHLVS+SQDGK+IVWD FT  KE  +SM TTWVM+CAYSPTG  VACGGLDNKC+++ L  ++D   +K  VA HTSY+SCC F  S++Q+LT SGDSTC LWDVES QMIQSFHGH+ DVMS+DLSP E G +FISG CDR   +WD+RTG+ V  +  H +D+N V+F+PSGD+F T  DD  CRLFDLRAD ++  Y KD ++FG  ++DFS+SGRLLFAGY+DY +N+WD LK  R+A+  GH+NRISCLK SPDGT +CTGSWD+TLR+
Sbjct:    6 SESPPVEDISSLAKEAEQLKLRIAEEKNKYHDQELKDVSRKLESLQGCHMKVRRILKGHQGKVLSMDWSGDCRHLVSSSQDGKVIVWDAFTTNKEHAISMPTTWVMSCAYSPTGNLVACGGLDNKCSVFKLSYEDDHNARKHTVAMHTSYMSCCVFANSDHQILTGSGDSTCSLWDVESSQMIQSFHGHTADVMSVDLSPIEGGHIFISGGCDRAALIWDIRTGRIVNSFASHSADINGVKFFPSGDSFGTACDDGKCRLFDLRADHQLAEYHKDHLIFGVASLDFSVSGRLLFAGYHDYTINVWDTLKVERLAVYYGHDNRISCLKVSPDGTGICTGSWDNTLRI 351          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO40844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z1])

HSP 1 Score: 367.466 bits (942), Expect = 2.190e-125
Identity = 169/335 (50.45%), Postives = 235/335 (70.15%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +E++ LK ++ + R    D  LA +S  ++ V  + ++ RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD +T  K   + + ++WVM CAY+P+G+ VACGGLDN C+IY L T E  V   R +  HT YLSCC+F + + Q++T+SGD TC LWD+E+ Q I ++ GH+GDVMSL L+P+   + F+SG+CD    +WD+R G CVQ + GHESD+N+V F+PSG AF TGSDDATCRLFD+RAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD LK  R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQESEALKCQIRDARKIAADTTLAQVSANIDQVGRIQMRTRRTLRGHLAKIYAMHWGSDSRNLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-IDDCQIITSSGDMTCALWDIETAQTISTYSGHTGDVMSLSLNPNN--QSFVSGACDASAKLWDIRGGTCVQTFTGHESDINAVAFFPSGFAFGTGSDDATCRLFDIRADQELMMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGERAGVLAGHDNRVSCLGVTEDGMAVSTGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 127.102 bits (318), Expect = 2.881e-32
Identity = 80/296 (27.03%), Postives = 141/296 (47.64%), Query Frame = 1
Query:  238 VRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIY-PLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            + R  KGH+  V S+ ++ + + LV+ S D  L++W    + + +        +++  +SP+G  +A    D    ++ P +  E  V K      HT+ +    F+     LLTAS D +  +W V   + + S + H   V     SP   GR+ +SGS D+ + +WD  +  CV  +      VNSV F+PSG   A G  D+T +++D+R +  +  Y+  +     N+V F  SG  L +  +D  + I D+++      L+GH+   + +  S +G    +GS D  + V
Sbjct:   10 LERHFKGHRDTVTSVDFNPNMKQLVTGSMDSSLMIWHFKPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTVFK-----AHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPD--GRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHT--GAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMV 296          

HSP 2 Score: 89.3521 bits (220), Expect = 2.636e-19
Identity = 64/264 (24.24%), Postives = 115/264 (43.56%), Query Frame = 1
Query:  397 VMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRVLFFISSHYFPS---HNLPAVSI 1179
            V +  ++P    +  G +D+   I+       P ++      H   +   +F+ S + + +AS D T  LW          F  H+  V S+D S    G+  ++ S D+ + VW +   + +     H + V   +F P G    +GSDD T +L+D    S+ CV+         N+V+F  SG  + AG  D  + +WD+  +  +     H   ++ +   P G  + + S D+TL++L  +    F +   H  PA S+
Sbjct:   21 VTSVDFNPNMKQLVTGSMDSSLMIWHF----KPHMRAYRFVGHKDAILSVKFSPSGHLIASASRDKTVRLWVPSVKGESTVFKAHTATVRSVDFS--GDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWD--RTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSV 276          

HSP 3 Score: 64.6994 bits (156), Expect = 2.519e-11
Identity = 48/166 (28.92%), Postives = 75/166 (45.18%), Query Frame = 1
Query:  250 LKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRL--VATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVW 741
            L  H   V    +S D R +VS S D  + +WD  +            +V +  + P+G  +A GG D+   ++      D  + K L     HT  ++   F+ S   L++AS D+T  + D+  G++  + HGH G   S+  S   +G  F SGS D  V VW
Sbjct:  140 LNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVW------DIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFS--RNGEYFASGSSDEQVMVW 297          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO49767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR6])

HSP 1 Score: 111.694 bits (278), Expect = 8.356e-28
Identity = 78/295 (26.44%), Postives = 137/295 (46.44%), Query Frame = 1
Query:  244 RLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFA-TGSDDATCRLFDLRADSEI-CVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            R + G    +L +A + D + +++   DG + VWD  T  +   L   T  V   A SP    +  G  D+   I+    D D +     +  H +++S         +++++S D T  +WDVE+   + S  GH G V  + ++    GR  +S S DR + +W++ T   V    GH   V  V   P  D FA +GS+D   +++DL +  E+  +    S +F   AV  +  G  + +  +D  + +W +     +A L+GH   +  +  SPDG  + +GS D+T ++
Sbjct:    7 RTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLALSPHADFLVSGAFDHTVKIW----DMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKIWDVETCAFVNSLDGHDGHVRGIAIT--SDGRRLVSASQDRTLRIWNLETFAHVSTLRGHSETVYCVCCSPD-DKFAISGSEDTMVKIWDLESAKEVRSLVGHTSDIF---AVAVTPDGSKVISSGDDTQVKVWSLESGEELASLHGHSESVRIVTVSPDGLTIVSGSEDATFKI 291          

HSP 2 Score: 47.7506 bits (112), Expect = 4.094e-6
Identity = 29/123 (23.58%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  754 GQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            G  ++  +G    +  +   P      TG  D + R++D     E+      + L    A   S     L +G  D+ + IWD+   + V  L GH+N +S +  +PD   + + S+D T+++
Sbjct:    3 GPLLRTIDGRSRTILGIAVTPDTKKIITGGADGSIRVWDYETGKELNKLLDHTKLVYTLA--LSPHADFLVSGAFDHTVKIWDMDTLSLVHTLKGHKNWVSGVLVTPDSKRIISSSYDKTVKI 123          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Match: EDO34865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN68])

HSP 1 Score: 113.62 bits (283), Expect = 1.170e-27
Identity = 81/296 (27.36%), Postives = 139/296 (46.96%), Query Frame = 1
Query:  244 RLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYS-PTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYK--KDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            ++L+ H   + ++A++      ++ S D    VWD  +  +   L      V A A++ P G  +A G  D  C ++   T +           H++ + C  FN     + T S D+T  LWDV++G  I +  GHS +++S   +   +G   ++GS D  V+VWD R+G+ V    GH  ++++ +F        TGS D TC+++D      I   +   D VL     V F  +G+L+     D    +++ L  + ++ L GHE  IS +  +  GT + T S D T R+
Sbjct:   86 KILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGK----CYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFN--STGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVL----DVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARL 371          

HSP 2 Score: 111.309 bits (277), Expect = 8.124e-27
Identity = 76/292 (26.03%), Postives = 138/292 (47.26%), Query Frame = 1
Query:  250 LKGHQGRVLSLAWSYDKRHLVST-SQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L+GH+  V ++A++      ++T S D    +W+  T          +  ++  A++P    +A G +D    ++ + T  +       ++ H++ +  C FN +  QLLT S D T  +WD  SG+ + +  GH G++ +   +   S    ++GS D+   +WD  TG+C+    GH+ +V  V F  +G   AT S D T R+++  A +  C+ K +      + + F+  G  L    +D    +WD      + +L GH + I     + DG  + TGS D+T R+
Sbjct:  130 LEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEI----STLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCS--FIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYN--ALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRL 413          

HSP 3 Score: 107.842 bits (268), Expect = 1.156e-25
Identity = 64/215 (29.77%), Postives = 104/215 (48.37%), Query Frame = 1
Query:  481 TDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSV-LFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            TD+      +++  H   L+   FN S    +T S D TC +WD  SG+   +  GH   V ++  + +  G    +GS D+   +W+  TG+C   Y GH +++  + F P     ATGS D T +L+D++  +EI      S  +  C    F+ +G  L  G  D+ +++WD     RV  L GH   IS  + + D + + TGS D T ++
Sbjct:   77 TDDRHFYLFKILRAHILPLTNVAFNKSGTSFITGSYDRTCKVWDTASGEETLTLEGHKNVVYAIAFN-NPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCA---FNSTGTQLLTGSFDHTVSVWDTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKI 287          

HSP 4 Score: 94.7449 bits (234), Expect = 3.465e-21
Identity = 63/245 (25.71%), Postives = 106/245 (43.27%), Query Frame = 1
Query:  253 KGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDL----------SPSESGRVF------------------------------ISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            +GH   ++ LA++     + + S D    +WD  T  +   LS  +  +++CA++ TG  +  G  D+  +++    D     +   +  H   +S  QFN     ++T S D TC +WD  +G+ I +  GH  +V+ +            S   +GRV+                              ++ S D+   +WD  TG+C+QV EGH  ++ S  F   GD   TGS D TCRL+
Sbjct:  174 RGHSAEIVCLAFNPQSTVIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVW----DTRSGRRVHTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHHCLSKLEGHEGEISKITFNAQGTRLLTASSDKTARLWDPNTGKCLQVLEGHTDEIFSCAFNYDGDIIITGSKDNTCRLW 414          

HSP 5 Score: 92.8189 bits (229), Expect = 1.449e-20
Identity = 63/251 (25.10%), Postives = 111/251 (44.22%), Query Frame = 1
Query:  409 AYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEY--QLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFG----CNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRVLFFISSH 1143
            A++ +G     G  D  C ++   + E+ +     +  H + +    FN + Y  ++ T S D TC LW+ E+G+   ++ GHS +++ L  +P  +  V  +GS D    +WD++TG  +    GH +++ S  F  +G    TGS D T  ++D R+   +        L G     +   F+     +  G  D    IWD      +  L GH++ +  +     G  + T S D T RV   ++ H
Sbjct:   99 AFNKSGTSFITGSYDRTCKVWDTASGEETLT----LEGHKNVVYAIAFN-NPYGDKIATGSFDKTCKLWNAETGKCYHTYRGHSAEIVCLAFNPQST--VIATGSMDTTAKLWDVQTGAEISTLSGHSAEIISCAFNSTGTQLLTGSFDHTVSVWDTRSGRRV------HTLIGHRGEISNAQFNFDCSFIVTGSMDKTCKIWDAGTGKCIGTLRGHDDEVLDVAFDYTGQLIATASADGTGRVYNALTHH 336          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: gnb5a (G protein subunit beta 5 [Source:NCBI gene;Acc:101162678])

HSP 1 Score: 467.233 bits (1201), Expect = 1.075e-163
Identity = 215/355 (60.56%), Postives = 275/355 (77.46%), Query Frame = 1
Query:   79 LMSVEAPINND-GDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRVLFFI 1134
            + + E P+N     L  E++TLK KL E+R +L D +L  +++K+E +    +K RR LKGH  +VL + W  DKR +VS+SQDGK+IVWD FT  KE  ++M  TWVMACAY+P+G  VACGGLDNKC++YPL  D++  L  KK+ VA HT+YLS C F  S+ Q+LT+SGD TC LWDVESGQ++QSFHGH+ DV+ LDL+PSE+G  F+SG CD+  NVWDMR+GQC+Q +E HESD+NSVR+YPSGDAFA+GSDDATCRL+DLRAD E+ +Y K+S++FG ++VDFSLSGRLLF GYNDY +N+WDVLK  RV+IL GHENR+S L+ SPDGTA CTGSWD TLRV   +
Sbjct:    9 MATQEVPLNETLAHLKTESETLKLKLEEERAKLHDVELHQVAEKVEGLGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDAFTTNKEHAVTMPCTWVMACAYAPSGCAVACGGLDNKCSVYPLSLDKNENLAAKKKSVAMHTNYLSACSFTNSDMQILTSSGDGTCALWDVESGQLLQSFHGHAADVLCLDLAPSETGNTFVSGGCDKKANVWDMRSGQCIQSFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGVSSVDFSLSGRLLFGGYNDYTINVWDVLKGTRVSILFGHENRVSTLRVSPDGTAFCTGSWDHTLRVWILM 363          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: gnb5b (guanine nucleotide-binding protein subunit beta-5b [Source:NCBI gene;Acc:101156727])

HSP 1 Score: 461.84 bits (1187), Expect = 3.606e-161
Identity = 214/337 (63.50%), Postives = 272/337 (80.71%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVL--KKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L KE+D+LKKKL E+R +L D +L  +++K+E + SL+IK RR+LKGH  +VL + W  DKR LVS+SQDGK IVWD FT  KE G+++  TWVMACAY+P+G  VACGGLDNKC++ PL  D++  L  KK+ VA HT+Y+S C F  S+ QLLT+SGD TC LWDVESGQ++QSFHGH+ DV+SLDL+PSE+G  F+SG CD   NVWDMR+GQ +Q +E HESD+N VR+YPSGDAFA+ SDDATCR +DLRAD E+ VY+KDSV+FG ++VDFSLSGRLLFAGYNDY +N+WDVLK  RV+IL GHENR+S ++ SPDGTA+C+ SWD+TLR+
Sbjct:   57 LKKESDSLKKKLEEERGKLNDVELHQVAEKVEVLSSLSIKTRRVLKGHGNKVLCVDWCKDKRRLVSSSQDGKAIVWDAFTLNKEHGVTLPCTWVMACAYAPSGCAVACGGLDNKCSVVPLSLDKNENLAAKKKSVAMHTNYVSGCTFTNSDMQLLTSSGDGTCALWDVESGQLLQSFHGHTADVLSLDLAPSETGNTFVSGGCDMKANVWDMRSGQNIQSFESHESDINCVRYYPSGDAFASASDDATCRFYDLRADREVAVYQKDSVIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGTRVSILFGHENRVSRVRVSPDGTALCSASWDNTLRI 393          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: GNB1 (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1-like [Source:NCBI gene;Acc:101168199])

HSP 1 Score: 378.252 bits (970), Expect = 4.011e-129
Identity = 170/335 (50.75%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD+TC LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ ++P+G+AFATGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDS--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICYFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 377.867 bits (969), Expect = 5.152e-129
Identity = 170/335 (50.75%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD++C LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 377.867 bits (969), Expect = 5.152e-129
Identity = 170/335 (50.75%), Postives = 240/335 (71.64%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +EA+ LK ++ + R    D  L+ ++  ++PV  + ++ RR L+GH  ++ ++ W  D R LVS SQDGKLI+WD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +A HT YLSCC+F L + Q++T+SGD++C LWD+E+GQ   +F GH+GDVMSL L+P    R+F+SG+CD    +WD+R G C Q + GHESD+N++ F+P+G+AFATGSDDATCRLFDLRAD E+ +Y  D+++ G  +V FS SGRLL AGY+D+  N+WD LK++R  +L GH+NR+SCL  + DG AV TGSWDS L++
Sbjct:    7 LRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF-LDDNQIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAPDT--RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000068013.1 (SMESG000068013.1)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 346/347 (99.71%), Postives = 347/347 (100.00%), Query Frame = 1
Query:   82 MSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            MSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLR+
Sbjct:    1 MSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRI 347          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000018712.1 (SMESG000018712.1)

HSP 1 Score: 382.489 bits (981), Expect = 6.288e-131
Identity = 174/335 (51.94%), Postives = 238/335 (71.04%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            L +E++ LK ++ E R    D  LA  +  +E V  + ++ RR L+GH  ++ ++ WS D R+LVS SQDGKLIVWDG++  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +  HT YLSCC+F + + Q++T+SGD TC LWD+E+GQ + +F GH+GDVMSL L+P    R F+SG+CD    +WD+R GQC Q + GHESD+N++ F+P+G AFATGSDDATCRLFD+RAD EI ++  D+++ G  +V FS SGRLL  GY+D+  N+WD LK +R  +L GH+NR+SCL  S DG AVCTGSWDS LR+
Sbjct:    7 LRQESEQLKNQIREARKAAADTTLAQATSSIEAVGRIQMRTRRTLRGHLAKIYAMHWSSDSRNLVSASQDGKLIVWDGYSTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF-IDDNQIVTSSGDVTCGLWDIETGQQVATFTGHTGDVMSLSLAPDM--RTFVSGACDASAKLWDLRDGQCKQTFPGHESDINAITFFPNGQAFATGSDDATCRLFDIRADQEIGMFSHDNIICGITSVAFSKSGRLLLGGYDDFNCNVWDTLKQDRAGVLAGHDNRVSCLGVSEDGMAVCTGSWDSFLRI 338          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000038555.1 (SMESG000038555.1)

HSP 1 Score: 375.941 bits (964), Expect = 2.267e-128
Identity = 175/335 (52.24%), Postives = 234/335 (69.85%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            + +E + LK ++ E R    D  LA  S  ++ V  + +K RR L+GH  ++ ++ W  D R+LVS SQDGKLIVWD +T  K   + + ++WVM CAY+P+G +VACGGLDN C+IY L T E  V   R +  HT YLSCC+F L + Q++T+SGD TC LWD+E+GQ + +F GH+GDVMSL L+P    R F+SG+CD    +WD+R G+C Q + GHESD+N+V F+P+G  FATGSDDATCRLFD+R+D EI +Y  DS++ G  +V FS SGRLL  GY+D+  N+WD LK +R  +L GH+NR+SCL  S DG AVCTGSWDS LRV
Sbjct:    7 IRQECEQLKNQIREARKAAADTSLAQASSDIDSVGRIQMKTRRTLRGHLAKIYAMHWGTDSRNLVSASQDGKLIVWDVYTTNKVHAIPLRSSWVMTCAYAPSGGYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRF-LDDSQIVTSSGDVTCGLWDIETGQQLAAFTGHTGDVMSLSLAPDH--RTFVSGACDASAKLWDLRDGKCKQTFPGHESDINAVTFFPNGFGFATGSDDATCRLFDIRSDQEIGMYSNDSIICGITSVAFSKSGRLLLGGYDDFNCNVWDTLKQDRAGVLAGHDNRVSCLGVSEDGMAVCTGSWDSFLRV 338          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000024012.1 (SMESG000024012.1)

HSP 1 Score: 337.035 bits (863), Expect = 4.820e-113
Identity = 156/338 (46.15%), Postives = 230/338 (68.05%), Query Frame = 1
Query:  118 LSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLK-KRLVATHTSYLSCCQF--NLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRV 1122
            + +E + LK ++ E R  + D  L  +++    +  L I++R  L+GH  ++ +L W+ D R++VS SQDGKLI+WD +T  K   + + ++WVM CA + +G +VACGGLDN CT+Y L   E    K  R +  H  YLSCC+F  N  E  ++T+SGD+TC LWD+E+ Q  + F  H+GDVMS+D++     ++FISG+CD  V +WD+R+G CVQ + GHESD+N+V ++P+     T SDDATCRLFD+RAD E+ +Y  DS++ G  ++ FSLSGR+LFAGY+D+   +WD LK +R+ +L  H+NR+SCL  S +G A+CTGSWDSTL++
Sbjct:    8 IRQEIEDLKARIREQRAAVSDSTLEEITKGQLGINKLLIRLRYTLRGHLSKIYALHWAGDSRNVVSASQDGKLIIWDSYTTNKIHAIPLRSSWVMTCALADSGDYVACGGLDNTCTVYNLRLRESGHPKVSRELPGHNGYLSCCRFLGNDEEGYIITSSGDTTCGLWDIEAAQCTRLFESHTGDVMSVDVT--RDNKLFISGACDASVKMWDIRSGNCVQTFTGHESDINAVTYFPNEQLIGTASDDATCRLFDIRADQELALYSLDSIICGITSIQFSLSGRMLFAGYDDFNCQVWDTLKQDRIGVLASHDNRVSCLGVSKNGEALCTGSWDSTLKI 343          
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Match: SMESG000003718.1 (SMESG000003718.1)

HSP 1 Score: 268.47 bits (685), Expect = 4.642e-86
Identity = 140/357 (39.22%), Postives = 216/357 (60.50%), Query Frame = 1
Query:   52 SNNLFNKSFLMSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLNIKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLSMATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRL-VATHTSYLSCCQFNLSEYQLLTASGDSTCVLWDVESG-QMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGD-AFATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYNDYIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDST 1113
            S+N  N    +SVE     +  L+ E + +K++L   R  ++D D   +++ ++ +  +  KVR+ L GH  ++  + W+ D + LVS SQDGKL +WD  T  K   + +   WV+ C  SP    V  GGLDN  +++  I + D ++K  + +  H  Y+S C+F +++  ++++SGD  C+LWD+ SG + +  F GH  DV ++ LS S S  +F+S S D+   +WD+R+ +CVQ++EGH  DVN V F+P  +  F T SDD TCRL+D RAD  I VY  D +  G  +V  S SGRLL AGY+DY  ++WDVL+  RV I++ H+ R+SC+  SP+G  + TGSWDS+
Sbjct:    4 SSNHVNAEEEISVE-----EKKLTLEIEKIKEQLDIARQAMQDTDYFKMTEHVKELGRIKFKVRKQLHGHLSKITGICWAQDSQLLVSASQDGKLFIWDTHTANKIHMIPLEIPWVIGCGISPNMKLVCSGGLDNVISVFN-IANIDSLMKPSIELKDHKGYISNCKF-INDSSIISSSGDKNCILWDISSGGKAVAQFVGHQNDVTAIALSSSRSD-MFVSVSSDKSCRIWDIRSQRCVQIFEGHTEDVNGVEFFPKDNYGFVTSSDDGTCRLWDSRADQSIAVYTDDYITCGSTSVSLSKSGRLLIAGYDDYNCHVWDVLREERVGIMSAHDGRVSCVSVSPNGVGIATGSWDSS 352          

HSP 2 Score: 60.4622 bits (145), Expect = 8.977e-10
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 1
Query:  550 FNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLSPSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAFATGSDDATCRLF 867
            F    Y  +T+S D TC LWD  + Q I  +        S  +S S+SGR+ I+G  D   +VWD+   + V +   H+  V+ V   P+G   ATGS D++C ++
Sbjct:  251 FPKDNYGFVTSSDDGTCRLWDSRADQSIAVYTDDYITCGSTSVSLSKSGRLLIAGYDDYNCHVWDVLREERVGIMSAHDGRVSCVSVSPNGVGIATGSWDSSCLIW 356          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNB51.405e-16260.97G protein subunit beta 5 [Source:HGNC Symbol;Acc:H... [more]
GNB52.875e-16258.31G protein subunit beta 5 [Source:HGNC Symbol;Acc:H... [more]
GNB25.408e-12651.04G protein subunit beta 2 [Source:HGNC Symbol;Acc:H... [more]
GNB25.408e-12651.04G protein subunit beta 2 [Source:HGNC Symbol;Acc:H... [more]
GNB25.408e-12651.04G protein subunit beta 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpb-21.113e-15961.19Guanine nucleotide-binding protein subunit beta-2 ... [more]
gpb-11.210e-13353.13Guanine nucleotide-binding protein subunit beta-1 ... [more]
gpb-11.210e-13353.13Guanine nucleotide-binding protein subunit beta-1 ... [more]
gpb-16.180e-6158.17Guanine nucleotide-binding protein subunit beta-1 ... [more]
prp-48.780e-2426.48Yeast PRP (Splicing factor) related [Source:UniPr... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gbeta53.296e-16862.09gene:FBgn0030011 transcript:FBtr0071189[more]
Gbeta13F5.174e-12449.85gene:FBgn0001105 transcript:FBtr0331597[more]
Gbeta13F5.174e-12449.85gene:FBgn0001105 transcript:FBtr0074110[more]
Gbeta13F5.174e-12449.85gene:FBgn0001105 transcript:FBtr0074108[more]
Gbeta13F5.174e-12449.85gene:FBgn0001105 transcript:FBtr0074107[more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnb5a4.143e-16261.92guanine nucleotide binding protein (G protein), be... [more]
gnb5b1.551e-16062.31guanine nucleotide binding protein (G protein), be... [more]
gnb1b7.569e-13051.34guanine nucleotide binding protein (G protein), be... [more]
gnb1b7.569e-13051.34guanine nucleotide binding protein (G protein), be... [more]
gnb1b7.569e-13051.34guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf136.197e-15660.23TATA-box binding protein associated factor 13 [Sou... [more]
taf131.323e-15363.38TATA-box binding protein associated factor 13 [Sou... [more]
taf131.753e-15363.38TATA-box binding protein associated factor 13 [Sou... [more]
taf132.983e-15363.67TATA-box binding protein associated factor 13 [Sou... [more]
taf134.283e-15362.42TATA-box binding protein associated factor 13 [Sou... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnb54.992e-16358.79guanine nucleotide binding protein (G protein), be... [more]
Gnb54.992e-16358.79guanine nucleotide binding protein (G protein), be... [more]
Gnb51.213e-16262.91guanine nucleotide binding protein (G protein), be... [more]
Gnb23.713e-12651.04guanine nucleotide binding protein (G protein), be... [more]
Gnb23.713e-12651.04guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RDY7|GNB5_PONAB3.107e-16260.97Guanine nucleotide-binding protein subunit beta-5 ... [more]
sp|P62881|GNB5_MOUSE3.492e-16258.79Guanine nucleotide-binding protein subunit beta-5 ... [more]
sp|P62882|GNB5_RAT8.484e-16262.91Guanine nucleotide-binding protein subunit beta-5 ... [more]
sp|Q80ZD0|GNB5_TAMST1.372e-16162.61Guanine nucleotide-binding protein subunit beta-5 ... [more]
sp|O14775|GNB5_HUMAN1.381e-16158.31Guanine nucleotide-binding protein subunit beta-5 ... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PK530.000e+073.53Guanine nucleotide-binding protein subunit beta-5 ... [more]
A0A183VS130.000e+074.93WD_REPEATS_REGION domain-containing protein OS=Tri... [more]
A0A2H1CCN10.000e+074.78Guanine nucleotide binding protein subunit OS=Fasc... [more]
A0A504YV100.000e+074.78Guanine nucleotide binding protein subunit OS=Fasc... [more]
A0A3P7BU500.000e+072.21WD_REPEATS_REGION domain-containing protein OS=Hym... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnb5a1.027e-16361.34guanine nucleotide-binding protein subunit beta-5a... [more]
gnb5b3.871e-16062.20guanine nucleotide binding protein (G protein), be... [more]
gnb1a3.282e-12951.04G protein subunit beta 1 [Source:NCBI gene;Acc:103... [more]
gnb25.907e-12952.54guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
gnb1b6.658e-12951.04guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNB38.440e-10155.02G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000009560.18.542e-7747.60pep scaffold:Pmarinus_7.0:GL479618:22463:45788:1 g... [more]
GNB32.920e-5650.90G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
GNB57.443e-4949.42G protein subunit beta 5 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000009090.14.628e-4059.05pep scaffold:Pmarinus_7.0:GL482486:1956:2971:1 gen... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE47.078e-6831.31G protein beta subunit; forms a dimer with Ste18p ... [more]
TAF51.059e-2429.06Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
PWP22.144e-2124.61Conserved 90S pre-ribosomal component; essential f... [more]
ASC11.368e-1827.89G-protein beta subunit and guanine dissociation in... [more]
PFS23.977e-1825.52Integral subunit of the pre-mRNA CPF complex; the ... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO376311.073e-15959.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408442.190e-12550.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453462.881e-3227.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497678.356e-2826.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348651.170e-2727.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnb5a1.075e-16360.56G protein subunit beta 5 [Source:NCBI gene;Acc:101... [more]
gnb5b3.606e-16163.50guanine nucleotide-binding protein subunit beta-5b... [more]
GNB14.011e-12950.75guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
ol-gb15.152e-12950.75guanine nucleotide-binding protein beta subunit [S... [more]
ol-gb15.152e-12950.75guanine nucleotide-binding protein beta subunit [S... [more]
back to top
BLAST of Guanine nucleotide binding protein subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068013.10.000e+099.71SMESG000068013.1[more]
SMESG000018712.16.288e-13151.94SMESG000018712.1[more]
SMESG000038555.12.267e-12852.24SMESG000038555.1[more]
SMESG000024012.14.820e-11346.15SMESG000024012.1[more]
SMESG000003718.14.642e-8639.22SMESG000003718.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018242 ID=SMED30018242|Name=Guanine nucleotide binding protein subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1396bp
TATTTGTTACCATAATTTAAACATAATTTAAATTATTGTTTTATAGTGTT
TAGTAATAATTTATTCAATAAATCATTTTTAATGTCTGTTGAAGCTCCTA
TAAATAATGATGGGGATTTATCTAAGGAAGCAGATACATTAAAAAAGAAA
TTAGTTGAAGATCGTAATCGTTTAAAAGATGGAGACTTGGCAACTCTTAG
TCAAAAACTTGAACCTGTTCCTAGTTTAAATATCAAAGTTCGGCGTTTAT
TAAAAGGTCATCAGGGTAGAGTATTGAGTTTAGCTTGGTCCTATGATAAA
AGACATTTAGTCAGCACTTCTCAGGATGGAAAACTTATAGTTTGGGATGG
TTTTACAAATACTAAGGAATTTGGTTTATCAATGGCAACAACTTGGGTTA
TGGCGTGTGCATATAGTCCAACCGGTGCCCATGTTGCTTGCGGAGGCCTG
GACAACAAATGCACCATTTATCCTTTAATCACTGACGAAGACCCAGTTCT
CAAGAAGCGATTGGTTGCAACGCATACCTCTTATTTATCCTGTTGTCAAT
TCAATTTGAGTGAATATCAGCTTTTGACAGCTAGTGGCGACAGCACCTGT
GTTTTGTGGGACGTAGAATCCGGGCAGATGATTCAGAGTTTCCATGGTCA
TTCAGGTGATGTTATGAGTCTCGATTTGTCGCCATCAGAATCCGGGAGAG
TATTTATTTCTGGGAGTTGCGATCGATGCGTAAATGTGTGGGACATGCGA
ACGGGTCAATGCGTCCAGGTTTATGAGGGTCACGAGTCAGATGTGAACAG
TGTTAGATTCTACCCCAGTGGAGATGCCTTTGCCACCGGTTCCGATGATG
CTACCTGTCGGTTGTTTGATTTGAGGGCCGATAGTGAAATTTGCGTTTAC
AAAAAGGACAGCGTTCTATTTGGTTGCAATGCAGTTGATTTTTCCCTCAG
CGGTCGATTATTGTTTGCCGGATATAATGACTATATAATGAATATTTGGG
ACGTTCTCAAGAGTAATCGTGTTGCAATATTGAATGGTCATGAAAACCGA
ATATCGTGTTTGAAAACAAGTCCTGATGGTACTGCGGTATGTACTGGAAG
TTGGGATTCGACATTAAGGGTATTGTTTTTTATTTCTTCTCACTATTTTC
CCTCGCATAACCTTCCTGCAGTTAGTATATTCCCAGCAGTGAGACACTAT
GATTTTTAGAGGCCGTCTATAAATGATGTTACGCAATTTTGGCTGATTTT
TTACCCCTCCCCCCCTCGTCACAAAACGCCATTACCCCTTTTCAAATTAG
ACGTCACAAATCTTTGGTCCCCTTAAAAAGCCGTATCTCATATTTGAAAA
TAAACATGTTTCAAATTACTTTATTGACATTTTAGTGTGATGCTGC
back to top

protein sequence of SMED30018242-orf-1

>SMED30018242-orf-1 ID=SMED30018242-orf-1|Name=SMED30018242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=376bp
MSVEAPINNDGDLSKEADTLKKKLVEDRNRLKDGDLATLSQKLEPVPSLN
IKVRRLLKGHQGRVLSLAWSYDKRHLVSTSQDGKLIVWDGFTNTKEFGLS
MATTWVMACAYSPTGAHVACGGLDNKCTIYPLITDEDPVLKKRLVATHTS
YLSCCQFNLSEYQLLTASGDSTCVLWDVESGQMIQSFHGHSGDVMSLDLS
PSESGRVFISGSCDRCVNVWDMRTGQCVQVYEGHESDVNSVRFYPSGDAF
ATGSDDATCRLFDLRADSEICVYKKDSVLFGCNAVDFSLSGRLLFAGYND
YIMNIWDVLKSNRVAILNGHENRISCLKTSPDGTAVCTGSWDSTLRVLFF
ISSHYFPSHNLPAVSIFPAVRHYDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016346Guanine_nucleotide-bd_bsu
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001632Gprotein_B
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001632G-protein, beta subunitPRINTSPR00319GPROTEINBcoord: 57..73
score: 39.93
coord: 113..130
score: 66.67
coord: 95..110
score: 39.39
coord: 76..90
score: 75.35
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 76..90
score: 39.14
coord: 164..178
score: 38.37
coord: 208..222
score: 35.56
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 266..307
e-value: 1.9
score: 15.2
coord: 92..131
e-value: 0.91
score: 17.3
coord: 180..221
e-value: 1.8E-8
score: 44.1
coord: 224..263
e-value: 2.9E-10
score: 50.1
coord: 50..89
e-value: 8.7E-9
score: 45.2
coord: 310..349
e-value: 6.3E-5
score: 32.4
coord: 141..177
e-value: 8.8E-4
score: 28.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 314..347
e-value: 6.0E-6
score: 26.9
coord: 181..221
e-value: 1.4E-4
score: 22.6
coord: 225..263
e-value: 1.7E-8
score: 35.0
coord: 55..89
e-value: 3.5E-5
score: 24.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 231..272
score: 13.182
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 57..89
score: 13.884
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 317..347
score: 10.341
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 187..230
score: 14.686
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 145..186
score: 11.778
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 7..348
e-value: 1.3E-127
score: 427.3
NoneNo IPR availablePIRSFPIRSF002394GNBP_Bcoord: 2..350
e-value: 1.2E-142
score: 472.5
NoneNo IPR availablePANTHERPTHR19850:SF36GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-5coord: 12..347
NoneNo IPR availableCDDcd00200WD40coord: 54..347
e-value: 5.24468E-82
score: 250.33
IPR016346Guanine nucleotide-binding protein, beta subunitPANTHERPTHR19850GUANINE NUCLEOTIDE-BINDING PROTEIN BETA G PROTEIN BETAcoord: 12..347
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 76..90
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 294..308
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 164..178
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 57..358
score: 51.491
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 28..347