RFX-type winged-helix domain-containing protein

Overview
NameRFX-type winged-helix domain-containing protein
Smed IDSMED30018240
Length (bp)1601
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RFX-type winged-helix domain-containing protein (SMED30018240) t-SNE clustered cells

Violin plots show distribution of expression levels for RFX-type winged-helix domain-containing protein (SMED30018240) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RFX-type winged-helix domain-containing protein (SMED30018240) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RFX-type winged-helix domain-containing protein (SMED30018240) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018240

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30018240h1SMcG0015193 SmedASXL_012986SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018240h1SMcG0015193 SmedASXL_012986SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30018240h1SMcG0015193 SmedASXL_009205SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30018240h1SMcG0015193 SmedASXL_009205SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail regionSMED30018240h1SMcG0015193 dd_Smed_v6_12531_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30018240h1SMcG0015193 dd_Smed_v6_15486_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Match: RFX5 (regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:9986])

HSP 1 Score: 112.849 bits (281), Expect = 2.810e-28
Identity = 66/166 (39.76%), Postives = 97/166 (58.43%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE--ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGND 806
            L  T+++    KV+ I+  +   SD +KL + LQ P   S   T D S             ST+  +E   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G++
Sbjct:   34 LRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLP---SGPTTGDKSSE----------PSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSE 184          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Match: RFX5 (regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:9986])

HSP 1 Score: 112.849 bits (281), Expect = 6.873e-28
Identity = 66/169 (39.05%), Postives = 99/169 (58.58%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE--ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTAD 815
            L  T+++    KV+ I+  +   SD +KL + LQ P   S   T D S             ST+  +E   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +
Sbjct:   34 LRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLP---SGPTTGDKSSE----------PSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE 187          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Match: RFX7 (regulatory factor X7 [Source:HGNC Symbol;Acc:HGNC:25777])

HSP 1 Score: 119.783 bits (299), Expect = 1.293e-27
Identity = 66/167 (39.52%), Postives = 93/167 (55.69%), Query Frame = 3
Query:  348 TKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI-----GMVLEGNDTADDYRKRD 833
            +KV  I+ ++   +D EKL + LQ P          S ++ G  +     +S+  +Q  A  W+ + LEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P L ++     G  LEG + +   +  D
Sbjct:   59 SKVDCILQEVEKFTDLEKLYLYLQLP----------SGLSNGEKSDQNAMSSSRAQQMHAFSWIRNTLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYCYSGLRKKAFVHMPTLPNLDFHKTGDGLEGAEPSGQLQNID 215          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Match: RFX5 (regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:9986])

HSP 1 Score: 117.857 bits (294), Expect = 2.276e-27
Identity = 77/251 (30.68%), Postives = 126/251 (50.20%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE--ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+  +   SD +KL + LQ P   S   T D S             ST+  +E   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  +++  P  E     L+++A  +     +  + ++  S+ +  + LL    +  RS HA
Sbjct:   34 LRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLP---SGPTTGDKSSE----------PSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVTPAPRDE-----LVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARSAHA 243          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Match: RFX5 (regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:9986])

HSP 1 Score: 117.857 bits (294), Expect = 2.276e-27
Identity = 77/251 (30.68%), Postives = 126/251 (50.20%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE--ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+  +   SD +KL + LQ P   S   T D S             ST+  +E   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  +++  P  E     L+++A  +     +  + ++  S+ +  + LL    +  RS HA
Sbjct:   34 LRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLP---SGPTTGDKSSE----------PSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVTPAPRDE-----LVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARSAHA 243          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 61.2326 bits (147), Expect = 1.244e-9
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  534 WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            W+  + E  + + L + E+Y+ YK +C  + +  ++ A FGK+++  F N+K RRLG RG S+Y Y G+R
Sbjct:  263 WLFENYEIGEGS-LPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIR 331          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 61.2326 bits (147), Expect = 1.316e-9
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  534 WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            W+  + E  + + L + E+Y+ YK +C  + +  ++ A FGK+++  F N+K RRLG RG S+Y Y G+R
Sbjct:  238 WLFENYEIGEGS-LPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIR 306          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 60.8474 bits (146), Expect = 1.458e-9
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  534 WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            W+  + E  + + L + E+Y+ YK +C  + +  ++ A FGK+++  F N+K RRLG RG S+Y Y G+R
Sbjct:  119 WLFENYEIGEGS-LPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIR 187          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 60.8474 bits (146), Expect = 1.559e-9
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  534 WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            W+  + E  + + L + E+Y+ YK +C  + +  ++ A FGK+++  F N+K RRLG RG S+Y Y G+R
Sbjct:   96 WLFENYEIGEGS-LPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIR 164          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Match: daf-19 (RFX-like transcription factor daf-19 [Source:UniProtKB/Swiss-Prot;Acc:Q09555])

HSP 1 Score: 60.4622 bits (145), Expect = 1.812e-9
Identity = 26/70 (37.14%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  534 WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            W+  + E  + + L + E+Y+ YK +C  + +  ++ A FGK+++  F N+K RRLG RG S+Y Y G+R
Sbjct:   80 WLFENYEIGEGS-LPRCELYDHYKKHCAEHRMDPVNAASFGKLIRSVFHNLKTRRLGTRGNSKYHYYGIR 148          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Match: CG9727 (gene:FBgn0037445 transcript:FBtr0330193)

HSP 1 Score: 112.849 bits (281), Expect = 9.215e-26
Identity = 58/158 (36.71%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  309 VDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI 782
            +  +E +L ++   ++ +I+ ++  L   EKL + L+ P   +D        N      +I  N TI        WV SHLE +    + KQ+VY DY +YC   +IK LSTADFGKVMK+ FP ++ RRLG RG SRYCY+ +R   +   P L  +
Sbjct:  247 LQVIETSLDDNAKLQISQILERVSGLKPIEKLFLYLRLPGECADTDPLRQPQNPLGTRSEI--NHTI-------NWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNSRYCYAAMRKTTKLTPPQLPQL 395          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Match: CG9727 (gene:FBgn0037445 transcript:FBtr0081730)

HSP 1 Score: 112.849 bits (281), Expect = 9.215e-26
Identity = 58/158 (36.71%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  309 VDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI 782
            +  +E +L ++   ++ +I+ ++  L   EKL + L+ P   +D        N      +I  N TI        WV SHLE +    + KQ+VY DY +YC   +IK LSTADFGKVMK+ FP ++ RRLG RG SRYCY+ +R   +   P L  +
Sbjct:  247 LQVIETSLDDNAKLQISQILERVSGLKPIEKLFLYLRLPGECADTDPLRQPQNPLGTRSEI--NHTI-------NWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNSRYCYAAMRKTTKLTPPQLPQL 395          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Match: CG9727 (gene:FBgn0037445 transcript:FBtr0330192)

HSP 1 Score: 112.849 bits (281), Expect = 9.879e-26
Identity = 58/158 (36.71%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  309 VDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI 782
            +  +E +L ++   ++ +I+ ++  L   EKL + L+ P   +D        N      +I  N TI        WV SHLE +    + KQ+VY DY +YC   +IK LSTADFGKVMK+ FP ++ RRLG RG SRYCY+ +R   +   P L  +
Sbjct:  247 LQVIETSLDDNAKLQISQILERVSGLKPIEKLFLYLRLPGECADTDPLRQPQNPLGTRSEI--NHTI-------NWVRSHLEHDAQVSIPKQDVYNDYIAYCERLSIKPLSTADFGKVMKQVFPGVRPRRLGTRGNSRYCYAAMRKTTKLTPPQLPQL 395          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337107)

HSP 1 Score: 57.7658 bits (138), Expect = 2.343e-8
Identity = 29/98 (29.59%), Postives = 51/98 (52.04%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQET--QSPALKDIGMVLEGNDTADD 818
            KW+  + E      L +  +Y  Y  +C  + ++ ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R +  +   S A+ D  M+  G   + D
Sbjct:  373 KWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSLLNSQAMDDKQMLAAGYGPSSD 470          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Match: Rfx (gene:FBgn0020379 transcript:FBtr0337105)

HSP 1 Score: 57.7658 bits (138), Expect = 2.361e-8
Identity = 29/98 (29.59%), Postives = 51/98 (52.04%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQET--QSPALKDIGMVLEGNDTADD 818
            KW+  + E      L +  +Y  Y  +C  + ++ ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R +  +   S A+ D  M+  G   + D
Sbjct:  395 KWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSLLNSQAMDDKQMLAAGYGPSSD 492          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Match: rfx7a (regulatory factor X7a [Source:ZFIN;Acc:ZDB-GENE-100309-3])

HSP 1 Score: 124.02 bits (310), Expect = 2.801e-29
Identity = 66/180 (36.67%), Postives = 103/180 (57.22%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVE 857
            ++ ++ +   +KV  I+  +  L+D EKL + L+ P   S     +   ++          S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC +     LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +   Q P+L ++ +   G D  + +     ++++E E
Sbjct:   34 IKNSICKTVQSKVDCILQDVEKLTDIEKLYLYLKLPSGPSSGNEKNEQSSM---------TSSRTQQMHAFSWIRNHLEEHPETSLPKQEVYDEYKSYCDSLGYHALSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKTFVQMPSLPNLDLHKSG-DGCEVFESTGQLSSAEDE 203          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Match: rfx7b (regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-170623-1])

HSP 1 Score: 118.627 bits (296), Expect = 2.012e-27
Identity = 64/161 (39.75%), Postives = 95/161 (59.01%), Query Frame = 3
Query:  348 TKVKEIISQILNLSDTEKLLIQLQFP---------MTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGN 803
            +KV+ I+  +   +D EKL + L+ P          TE+  G+   ++    N++    +S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++ +   G+
Sbjct:   39 SKVESILQDVEKFTDIEKLYLYLKLPSGPSGGNDKRTENQRGSASPAL-CDQNSM----SSSRTQQMYAFNWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFVHMPSLPNLDLHKSGD 194          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Match: rfx5 (regulatory factor X, 5 [Source:NCBI gene;Acc:101884332])

HSP 1 Score: 115.546 bits (288), Expect = 6.787e-27
Identity = 60/157 (38.22%), Postives = 88/157 (56.05%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGM 788
            L+  ++++   KV +I+  +   SD +KL + LQ P   S       S ++  N  D         Q     W+ SHLEE+  TCL KQ+VYE Y+ +C     + LS A+FGK+++  FPNIKARRLG RGQS+YCYSG+R +     P L ++ +
Sbjct:   26 LKSNISKNVQGKVDKILEDVQRFSDNDKLYLYLQLPSGPSAGEKSGDSNSV--NTAD---------QLHTCNWIRSHLEEHPDTCLPKQDVYETYRKHCDNLQHRPLSAANFGKIIRDIFPNIKARRLGGRGQSKYCYSGIRRKTVLNMPLLPNLDL 171          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Match: rfx4 (regulatory factor X, 4 [Source:NCBI gene;Acc:403016])

HSP 1 Score: 64.3142 bits (155), Expect = 2.213e-10
Identity = 33/125 (26.40%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVP 905
            +W+  + E  +  C+ +  +Y  Y  +C   + + ++ A FGK++++ FP +  RRLG RGQS+Y Y G+  ++ +Q     D+    +G    ++  K++     +  +YS  S L   L + P
Sbjct:   63 QWLEENYEIAEGVCIPRSALYMHYLDFCEKLDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQ---YYDVMYSKKGAAWVNETGKKE--VTKQTVAYSPRSKLGTLLPDFP 182          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Match: rfx4 (regulatory factor X, 4 [Source:NCBI gene;Acc:403016])

HSP 1 Score: 64.3142 bits (155), Expect = 2.213e-10
Identity = 33/125 (26.40%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVP 905
            +W+  + E  +  C+ +  +Y  Y  +C   + + ++ A FGK++++ FP +  RRLG RGQS+Y Y G+  ++ +Q     D+    +G    ++  K++     +  +YS  S L   L + P
Sbjct:   63 QWLEENYEIAEGVCIPRSALYMHYLDFCEKLDSQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQ---YYDVMYSKKGAAWVNETGKKE--VTKQTVAYSPRSKLGTLLPDFP 182          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Match: rfx7 (regulatory factor X7 [Source:NCBI gene;Acc:100038260])

HSP 1 Score: 111.309 bits (277), Expect = 5.539e-25
Identity = 56/127 (44.09%), Postives = 75/127 (59.06%), Query Frame = 3
Query:  501 STIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVL 881
            S+  +Q  A  W+ + LEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++     G D  D       + N++ E  S+   L
Sbjct:  100 SSRAQQTHAFSWIRNTLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYCYSGLRKKAFVHMPSLPNLDFNKSG-DGVDGIEVSTQLQNADEEVVSAACRL 225          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Match: rfx7 (regulatory factor X7 [Source:NCBI gene;Acc:100038260])

HSP 1 Score: 98.2117 bits (243), Expect = 9.123e-21
Identity = 53/129 (41.09%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  501 STIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCY--SGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVL 881
            S+  +Q  A  W+ + LEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+Y +   GLR +     P+L ++     G D  D       + N++ E  S+   L
Sbjct:  101 SSRAQQTHAFSWIRNTLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYPFLEVGLRKKAFVHMPSLPNLDFNKSG-DGVDGIEVSTQLQNADEEVVSAACRL 228          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Match: rfx2 (regulatory factor X2 [Source:NCBI gene;Acc:100144734])

HSP 1 Score: 58.9214 bits (141), Expect = 1.463e-8
Identity = 23/71 (32.39%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +W+L + E  +   L +  +Y  Y  +C  + +  ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R
Sbjct:  206 QWLLDNYETAEGVSLPRSSLYNHYLRHCQDHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIR 276          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Match: rfx2 (regulatory factor X2 [Source:NCBI gene;Acc:100144734])

HSP 1 Score: 58.9214 bits (141), Expect = 1.498e-8
Identity = 23/71 (32.39%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +W+L + E  +   L +  +Y  Y  +C  + +  ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R
Sbjct:  176 QWLLDNYETAEGVSLPRSSLYNHYLRHCQDHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIR 246          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Match: rfx2 (regulatory factor X2 [Source:NCBI gene;Acc:100144734])

HSP 1 Score: 58.9214 bits (141), Expect = 1.597e-8
Identity = 23/71 (32.39%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +W+L + E  +   L +  +Y  Y  +C  + +  ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R
Sbjct:  181 QWLLDNYETAEGVSLPRSSLYNHYLRHCQDHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIR 251          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Match: Rfx5 (regulatory factor X, 5 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1858421])

HSP 1 Score: 120.939 bits (302), Expect = 3.427e-30
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Match: Rfx5 (regulatory factor X, 5 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1858421])

HSP 1 Score: 120.939 bits (302), Expect = 3.427e-30
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Match: Rfx5 (regulatory factor X, 5 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1858421])

HSP 1 Score: 122.479 bits (306), Expect = 5.436e-29
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Match: Rfx5 (regulatory factor X, 5 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1858421])

HSP 1 Score: 122.479 bits (306), Expect = 5.436e-29
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Match: Rfx5 (regulatory factor X, 5 (influences HLA class II expression) [Source:MGI Symbol;Acc:MGI:1858421])

HSP 1 Score: 122.479 bits (306), Expect = 5.436e-29
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JL61|RFX5_MOUSE (DNA-binding protein Rfx5 OS=Mus musculus OX=10090 GN=Rfx5 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 3.802e-28
Identity = 76/252 (30.16%), Postives = 130/252 (51.59%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE---ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+ ++   SD +KL + LQ P          S  ++G  + +     +++  EE   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  ++S  P  E     L+++A  +     +  + ++  S+ Q  ++LL    +  RS HA
Sbjct:   33 LRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLP----------SGPSVGEKSSE----PSLLSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVSPAPRDE-----LVEAACALTCDWAERILKRSFSSIVQVARYLLQQHLISARSAHA 242          
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Match: sp|P48382|RFX5_HUMAN (DNA-binding protein RFX5 OS=Homo sapiens OX=9606 GN=RFX5 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.093e-26
Identity = 77/251 (30.68%), Postives = 126/251 (50.20%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEE--ASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHA 1061
            L  T+++    KV+ I+  +   SD +KL + LQ P   S   T D S             ST+  +E   A +W+ +HLEE+  TCL KQ VY+ Y+ YC +    + LSTA+FGK++++ FP+IKARRLG RGQS+YCYSG+R +     P L   G+ L+G+++ +                     +  +++  P  E     L+++A  +     +  + ++  S+ +  + LL    +  RS HA
Sbjct:   34 LRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLP---SGPTTGDKSSE----------PSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP--GLDLKGSESPE---------------------MGPEVTPAPRDE-----LVEAACALTCDWAERILKRSFSSIVEVARFLLQQHLISARSAHA 243          
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KHR2|RFX7_HUMAN (DNA-binding protein RFX7 OS=Homo sapiens OX=9606 GN=RFX7 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 4.298e-24
Identity = 54/117 (46.15%), Postives = 72/117 (61.54%), Query Frame = 3
Query:  498 NSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI-----GMVLEGNDTADDYRKRD 833
            +S+  +Q  A  W+ + LEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P L ++     G  LEG + +   +  D
Sbjct:    2 SSSRAQQMHAFSWIRNTLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYCYSGLRKKAFVHMPTLPNLDFHKTGDGLEGAEPSGQLQNID 118          
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Match: sp|P48383|SAK1_SCHPO (Protein sak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sak1 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.573e-11
Identity = 32/85 (37.65%), Postives = 49/85 (57.65%), Query Frame = 3
Query:  495 GNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNR 749
             NS    Q     W+    EE +   +Q+ ++Y  Y   C + +IK L++A FGK+++  FP+IK RRLG RG S+Y Y G++ R
Sbjct:   91 ANSEKFRQVFGICWLKRACEEQQDAAVQRNQIYAHYVEICNSLHIKPLNSASFGKLVRLLFPSIKTRRLGMRGHSKYHYCGIKLR 175          
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TNK1|RFX4_MOUSE (Transcription factor RFX4 OS=Mus musculus OX=10090 GN=Rfx4 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.028e-9
Identity = 34/125 (27.20%), Postives = 63/125 (50.40%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVP 905
            +W+  + E  +  C+ +  +Y  Y  +C   + + ++ A FGK++++ FP +  RRLG RGQS+Y Y G+  ++ +Q     D+    +G     +  KR+     +  +YS  S L   L + P
Sbjct:   63 QWLEENYEIAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQ---YYDVMYSKKGAAWVSETGKRE--VTKQTVAYSPRSKLGTLLPDFP 182          
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Match: A0A158R985 (RFX-type winged-helix domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6820 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.254e-43
Identity = 98/285 (34.39%), Postives = 154/285 (54.04%), Query Frame = 3
Query:  309 VDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSM---NIGFNN-------VDILGNSTI---------VEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYR----------KRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCS 1076
            +++LEK +T +  +++  ++ +  +  DTEK+L  L  P+    +G   S++   +IG N        V I G S           VEQ +A  W++SHLEE+ +TCL+K EVYEDY++YC  +N K L+TADFGKVMK+ FPN++ RRLG RGQSRYCY G+R + E Q+P+L D+ + L      +++R          ++ +    EV     T  +   L       ++  IL+D   +I+E+ + V +     SL    +HL+S+  V   S HA  L +
Sbjct:   17 LNSLEKAVTPEARSRIDALVREFASFRDTEKILCALLLPV--EPHGNCASALIEDDIGPNGFEVNSLGVGIFGGSGCSSSLHLSNQVEQSQAYTWIMSHLEEDSSTCLRKDEVYEDYRAYCEKHNQKTLNTADFGKVMKRAFPNVRPRRLGQRGQSRYCYGGMRKKLEVQAPSLPDLTLELSVPPATNNFRSGSSSVSSIDEQRHSQRGEVSPTWPTEEVRTVLG------VTGPILVDVVRIILEYARTV-LGTEFASLLHFAQHLVSDRYVTAHSRHAFALIA 292          
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Match: A0A0R3WI66 (RFX-type winged-helix domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS275 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.532e-43
Identity = 97/284 (34.15%), Postives = 148/284 (52.11%), Query Frame = 3
Query:  309 VDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTF----DSSMNIGFN----NVDILGNSTI---------VEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRK---------RDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIF 1082
            +++LEKT++ +  ++++ ++ +  +  DTEK+L  L  P     +G      D     GF      V I G S           VEQ +A  W++SHLEE+ +TCL+K EVYEDY++YC  +N K L+TADFGKVMK+ FPN++ RRLG RGQSRYCY G+R + E Q+P+L D+ + L       ++R             ++  EV     T  +   L       ++  IL D   +I+E+ + V +     SL    + L+S+  V   S HA  L + F
Sbjct:   17 LNSLEKTVSPEARSRIEALVREFSSFKDTEKILCALLLPAEPHGSGVPALVEDDIGPNGFEVNSLGVGIFGGSGCSSSLHLSNQVEQSQAYTWIMSHLEEDSSTCLRKDEVYEDYRAYCEKHNQKTLNTADFGKVMKRAFPNVRPRRLGQRGQSRYCYGGMRKKLEVQAPSLPDLTLELSAPSATSNFRSGSSSVSSTDEQRLSQHEVSPAWPTEEVRTVLG------VTGPILADVVRIILEYARTV-LGTEFTSLLHFAQRLVSDRYVTAHSRHAFALIAHF 293          
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Match: A0A5K3ERA4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.712e-43
Identity = 99/272 (36.40%), Postives = 148/272 (54.41%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESD-------------NGTFDSSMNIGF---NNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSS-----TSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRL 1070
             EK +T D  +++  ++ +  +  DTEKLL  L  P   S              NG   +S+ +G    +    L  S  VEQ +A  W++SHLEE+ +TCL+K EVYEDY+ YC  +N K L+TADFGKVMK+ FPN+K RRLG RGQSRYCY G+R + E Q P+L D+   L     + ++R   +  +S  +  SS     +S  + ++  V    ++  +L D A V++E+ + V       SL +  +HL++N  V  RS H+  L
Sbjct:   20 FEKAVTPDSRSRIDALLREFSSFKDTEKLLFCLLLPTEPSGICSSSLADDEISANGFEINSLGVGLFSGSGCSSLHLSNQVEQSQAYTWIMSHLEEDASTCLRKDEVYEDYRLYCEKHNQKTLNTADFGKVMKRAFPNVKPRRLGQRGQSRYCYGGMRKKLEVQPPSLPDLTAELSAPTLSTNFRSASSSVSSTDDHRSSLRGEASSWFSEEVRGV--LGVTGPVLADVANVLLEYAQNV-FGTTFTSLTKLAEHLVANRYVSTRSRHSFAL 288          
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Match: A0A0R3TU13 (RFX-type winged-helix domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11216 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.250e-43
Identity = 107/280 (38.21%), Postives = 156/280 (55.71%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTES---------DNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIFHQVDGQKLYPINKYSA 1130
            L+ TL+ +   +V  +++  L+L++ EKL+  L+  MT+S         D+ +   S   G  +V     S  VEQ  A  W+ SHLEE+ TTCL+K EVYEDYK+YC    +K L+TADFGKVMK+ FPN++ RRLG RGQSRYCY G+R +++TQ+P L D+ + L  +  +D YR             S+TS+ + ++      E S   +ID+  ++ E+  Q  +     SL Q   HL+ N  V+  S HAL L S   Q   Q+L  IN  S+
Sbjct:   20 LQNTLSPESQARVDGVLNNFLSLNNDEKLVCLLKI-MTDSAVAGQSSLFDDDSGAESNTAGTFSVSTFQVSNQVEQGYAFTWIKSHLEEDSTTCLRKDEVYEDYKNYCEQQRMKPLNTADFGKVMKRAFPNVRPRRLGQRGQSRYCYGGMRKKRDTQAPLLPDLTLELSNSSNSDPYRSGPP---------STTSIDDQEVRAALGVEGS--TIIDAIRIVTEY-AQTVVGGEFSSLLQLALHLIRNRFVNGHSTHALSLISYNQQ---QQLKRINPTSS 283          
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Match: A0A5K3EPU5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.364e-43
Identity = 99/272 (36.40%), Postives = 148/272 (54.41%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESD-------------NGTFDSSMNIGF---NNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSS-----TSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRL 1070
             EK +T D  +++  ++ +  +  DTEKLL  L  P   S              NG   +S+ +G    +    L  S  VEQ +A  W++SHLEE+ +TCL+K EVYEDY+ YC  +N K L+TADFGKVMK+ FPN+K RRLG RGQSRYCY G+R + E Q P+L D+   L     + ++R   +  +S  +  SS     +S  + ++  V    ++  +L D A V++E+ + V       SL +  +HL++N  V  RS H+  L
Sbjct:   20 FEKAVTPDSRSRIDALLREFSSFKDTEKLLFCLLLPTEPSGICSSSLADDEISANGFEINSLGVGLFSGSGCSSLHLSNQVEQSQAYTWIMSHLEEDASTCLRKDEVYEDYRLYCEKHNQKTLNTADFGKVMKRAFPNVKPRRLGQRGQSRYCYGGMRKKLEVQPPSLPDLTAELSAPTLSTNFRSASSSVSSTDDHRSSLRGEASSWFSEEVRGV--LGVTGPVLADVANVLLEYAQNV-FGTTFTSLTKLAEHLVANRYVSTRSRHSFAL 288          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Match: rfx7b (regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-170623-1])

HSP 1 Score: 119.398 bits (298), Expect = 8.086e-28
Identity = 64/162 (39.51%), Postives = 94/162 (58.02%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGN 803
            ++ ++ +   +KV  I+  +   +D EKL + L+ P   S +G   S  N          +S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++ +   G+
Sbjct:   42 IKNSICKSVQSKVDSILQDVEKFTDIEKLYLYLKLPSGPS-SGNDKSDQNST--------SSSRTQQMYAFNWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFVHMPSLPNLDLHKSGD 194          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Match: rfx7b (regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-170623-1])

HSP 1 Score: 117.857 bits (294), Expect = 3.126e-27
Identity = 65/171 (38.01%), Postives = 97/171 (56.73%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFP---------MTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGN 803
            ++ ++ +   +KV  I+  +   +D EKL + L+ P          TE+  G+  S      N+     +S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++ +   G+
Sbjct:   42 IKNSICKSVQSKVDSILQDVEKFTDIEKLYLYLKLPSGPSSGNDKRTENQRGS-TSPATCDQNST----SSSRTQQMYAFNWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFVHMPSLPNLDLHKSGD 207          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Match: rfx7a (DNA-binding protein RFX7-like [Source:NCBI gene;Acc:103028958])

HSP 1 Score: 117.087 bits (292), Expect = 4.701e-27
Identity = 68/190 (35.79%), Postives = 103/190 (54.21%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNG--TFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVL 881
            ++ ++ +   +KV  I+  +   +D EKL + L+ P   S     T  S ++           S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L  + +   G D  + +    + ++ E E  S++  L
Sbjct:   41 IKNSICKSVQSKVDGILQDVEKFTDIEKLYLYLRLPSGPSSCAEKTEQSCLS-----------SSRSQQMHAFGWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYHALSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFIHMPSLPSLELHKTG-DGCEVFEPIGHCSSGEDEVRSASCGL 218          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Match: rfx5 (regulatory factor X5 [Source:NCBI gene;Acc:103044951])

HSP 1 Score: 115.161 bits (287), Expect = 8.165e-27
Identity = 60/157 (38.22%), Postives = 86/157 (54.78%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGM 788
            L+  +++    KV  I+  +   SD +KL + LQ P   S       S ++  N  D         Q     W+ SHLEE+  TCL KQ+VYE Y+ +C     + LS A+FGK+++  FPNIKARRLG RGQS+YCYSG+R +     P L ++ +
Sbjct:   26 LKSNISKSVQNKVDTILRDVQQFSDNDKLYLYLQLPSGPSAGEKSGDSNSV--NTAD---------QLHTCNWIRSHLEEHADTCLPKQDVYETYRKHCENLQQRPLSAANFGKIIRDIFPNIKARRLGGRGQSKYCYSGIRRKTVLNMPLLPNLDL 171          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Match: rfx5 (regulatory factor X5 [Source:NCBI gene;Acc:103044951])

HSP 1 Score: 110.923 bits (276), Expect = 2.253e-25
Identity = 56/138 (40.58%), Postives = 77/138 (55.80%), Query Frame = 3
Query:  375 ILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGM 788
            +   SD +KL + LQ P   S       S ++  N  D         Q     W+ SHLEE+  TCL KQ+VYE Y+ +C     + LS A+FGK+++  FPNIKARRLG RGQS+YCYSG+R +     P L ++ +
Sbjct:   21 VQQFSDNDKLYLYLQLPSGPSAGEKSGDSNSV--NTAD---------QLHTCNWIRSHLEEHADTCLPKQDVYETYRKHCENLQQRPLSAANFGKIIRDIFPNIKARRLGGRGQSKYCYSGIRRKTVLNMPLLPNLDL 147          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005569.1 (pep scaffold:Pmarinus_7.0:GL484170:9855:13247:-1 gene:ENSPMAG00000005066.1 transcript:ENSPMAT00000005569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 3.409e-26
Identity = 50/99 (50.51%), Postives = 67/99 (67.68%), Query Frame = 3
Query:  513 EQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRY--CYSGLRNRQETQSPALKDIGMVLEGN 803
            +Q +A  W+  HLEE+  T L KQEVY++YK YC     + LS ADFGK+MK  FPN+KARRLG RG S+Y  CYSGLR +   Q+P+L  + +  +G+
Sbjct:   12 DQMQAFSWIRQHLEEHNDTSLPKQEVYDEYKGYCENLGHRFLSAADFGKLMKNVFPNMKARRLGTRGNSKYPCCYSGLRKKALVQTPSLPSLEVGKKGD 110          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Sea Lamprey
Match: rfx2 (regulatory factor X, 2 (influences HLA class II expression) [Source:NCBI gene;Acc:503590])

HSP 1 Score: 53.9138 bits (128), Expect = 6.693e-8
Identity = 22/71 (30.99%), Postives = 40/71 (56.34%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +W++ + E  +   L +  +Y  Y  +C    +  ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R
Sbjct:  187 QWLIDNYETAEGVSLPRCTLYNHYLRHCQEQKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGIR 257          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Yeast
Match: RFX1 (Major transcriptional repressor of DNA-damage-regulated genes; recruits repressors Tup1p and Cyc8p to their promoters; involved in DNA damage and replication checkpoint pathway; similar to a family of mammalian DNA binding RFX1-4 proteins [Source:SGD;Acc:S000004166])

HSP 1 Score: 63.5438 bits (153), Expect = 4.308e-11
Identity = 27/76 (35.53%), Postives = 45/76 (59.21%), Query Frame = 3
Query:  516 QEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            Q  A  W++ + +    + + + +++  Y S C   N+K LS A  GK+++  FP++  RRLG RGQS+Y Y GL+
Sbjct:  282 QVFALLWLMKNCKSQHDSYVPRGKIFAQYASSCSQNNLKPLSQASLGKLIRTVFPDLTTRRLGMRGQSKYHYCGLK 357          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Match: EDO41435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S491])

HSP 1 Score: 103.605 bits (257), Expect = 2.204e-25
Identity = 58/138 (42.03%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  375 ILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEE-NKTTCLQKQEVYEDYKSYCMTYNI-KCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDI 782
            +  LSDTEKLL+ L+ P  ES + T D        N  +  ++T  EQ +A  W+  HLEE + ++ L K EVY++YK+YC + +  + LS  DFGK++K  FP +KARRLG RG S+YCYSG++ ++  + P L  +
Sbjct:    3 VQQLSDTEKLLLYLRLP-GESCSETKDEFEQ----NQGLPISTTRAEQTQAFHWIRCHLEECDNSSTLPKHEVYDEYKAYCESMSASRTLSAPDFGKIIKCVFPRVKARRLGTRGNSKYCYSGIQRKKNVKPPTLPSL 135          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Match: EDO43982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX75])

HSP 1 Score: 61.2326 bits (147), Expect = 4.887e-10
Identity = 28/87 (32.18%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMV 791
            +W+L + E  +   L +  +Y  Y ++C T+ +  ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R +  +   AL D   V
Sbjct:    2 QWLLENYETAEGVSLPRSTLYNHYLTHCQTHKLDPVNAASFGKLIRSVFLGLRTRRLGTRGNSKYHYYGIRIKPSSPLNALTDDAQV 88          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Match: EDO35375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM7])

HSP 1 Score: 58.9214 bits (141), Expect = 2.184e-9
Identity = 23/56 (41.07%), Postives = 36/56 (64.29%), Query Frame = 3
Query:  573 LQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGL 740
            L +  +Y  Y  +C   ++  ++ A FGK+++  FPN+K RRLG RGQS+Y Y G+
Sbjct:   13 LPRSALYSHYLDFCEKNSLSPVNAASFGKIIRHTFPNLKTRRLGTRGQSKYHYYGI 68          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Match: EDO47852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL05])

HSP 1 Score: 55.8398 bits (133), Expect = 2.290e-8
Identity = 22/58 (37.93%), Postives = 33/58 (56.90%), Query Frame = 3
Query:  567 TCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGL 740
             CL +  +Y  Y  +C  + I+    A FGK +++ FP +  RRLG RG S+Y Y G+
Sbjct:   11 VCLPRCILYAHYLDFCRRHKIEAACAATFGKTIRQKFPQLTTRRLGTRGHSKYHYYGI 68          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Match: EDO39490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V5])

HSP 1 Score: 54.6842 bits (130), Expect = 4.277e-8
Identity = 23/64 (35.94%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  552 EENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            E  +  CL +  +Y  Y  +C    +     A FGK++++ FP +  RRLG RGQS+Y Y G++
Sbjct:    6 ELKEGMCLPRCVMYTHYLDFCKKNKLNPAGPATFGKIIRQKFPKLTTRRLGTRGQSKYHYYGIQ 69          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Match: rfx5 (regulatory factor X5 [Source:NCBI gene;Acc:101161817])

HSP 1 Score: 125.561 bits (314), Expect = 4.558e-30
Identity = 66/157 (42.04%), Postives = 89/157 (56.69%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGM 788
            L+  +++D  TKV +I+  +   SD +KL + LQ P     N    SS +  FN  D         Q     W+ SHLEE+  TCL KQ+VYE YK YC     + LS A FGK+++  FPNIKARRLG RGQS+YCYSG+R +     P L ++ +
Sbjct:   36 LKSNISKDVQTKVDQILQDVQRFSDGDKLYLYLQLP--SGPNSGDKSSDSSSFNTAD---------QLHTCNWIRSHLEEHSDTCLPKQDVYEAYKRYCKNLRHRPLSAAIFGKIIRDIFPNIKARRLGGRGQSKYCYSGIRRKTVLNMPLLPNLDL 181          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Match: rfx7b (DNA-binding protein RFX7 [Source:NCBI gene;Acc:101161970])

HSP 1 Score: 120.939 bits (302), Expect = 2.504e-28
Identity = 63/163 (38.65%), Postives = 96/163 (58.90%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMT-ESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGN 803
            ++ ++ +   +KV  I+  +   +D EKL + L+ P    S N   + +   G  +   + +S+  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++ +   G+
Sbjct:   38 IKNSICKSVQSKVDGILQDVEKFTDIEKLYLYLKLPSGPSSGNDKREGTSTPGLCDQSSM-SSSRTQQMYAFNWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYNPLSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFVHMPSLPNLDLQKSGD 199          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Match: rfx7b (DNA-binding protein RFX7 [Source:NCBI gene;Acc:101161970])

HSP 1 Score: 116.316 bits (290), Expect = 9.547e-27
Identity = 63/162 (38.89%), Postives = 94/162 (58.02%), Query Frame = 3
Query:  318 LEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGN 803
            ++ ++ +   +KV  I+  +   +D EKL + L+ P       +  SS N   +   +  + T  +Q  A  W+ +HLEE+  T L KQEVY++YKSYC       LS ADFGK+MK  FPN+KARRLG RG+S+YCYSGLR +     P+L ++ +   G+
Sbjct:   38 IKNSICKSVQSKVDGILQDVEKFTDIEKLYLYLKLP-------SGPSSGNDKSDQSSMSSSRT--QQMYAFNWIRNHLEEHPETSLPKQEVYDEYKSYCDNLGYNPLSAADFGKIMKNVFPNMKARRLGMRGKSKYCYSGLRKKAFVHMPSLPNLDLQKSGD 190          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Match: rfx4 (regulatory factor X4 [Source:NCBI gene;Acc:101165053])

HSP 1 Score: 59.6918 bits (143), Expect = 5.842e-9
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  492 LGNSTIVEQEE-----ASK---------WVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVP 905
            LGN +  E EE     ASK         W+  + E  +  C+ +  +Y  Y  +   ++ + ++ A FGK++++ FP +  RRLG RGQS+Y Y G+  +   +S    D+    +G    ++  K++     +  +YS  S L   L   P
Sbjct:   36 LGNLSTDEHEEKENNRASKPHSTPATLEWLEENYEIAEGVCIPRSALYMHYLDFSEKHDTQPVNAASFGKIIRQQFPALTTRRLGTRGQSKYHYYGIAVK---ESSPYYDVMYSKKGAAWVNETGKKE--VTKQTVAYSPRSKLGTLLPEFP 182          
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Match: rfx1a (MHC class II regulatory factor RFX1 [Source:NCBI gene;Acc:101166798])

HSP 1 Score: 58.151 bits (139), Expect = 1.554e-8
Identity = 29/88 (32.95%), Postives = 47/88 (53.41%), Query Frame = 3
Query:  504 TIVEQEEAS--------KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +I E EE S        +W+L + E  +   L +  +Y  Y  +C    ++ ++ A FGK+++  F  ++ RRLG RG S+Y Y GLR
Sbjct:  347 SITEGEETSVPSADKKVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGLR 434          
BLAST of RFX-type winged-helix domain-containing protein vs. Planmine SMEST
Match: SMESG000021065.1 (SMESG000021065.1)

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 478/479 (99.79%), Postives = 479/479 (100.00%), Query Frame = 3
Query:   72 MNNIHSYQDKIDLPDSGGLRLVENYSGSTSSAYDEVSPHMHNSTPGSSESIYEKHNQXXXXXXXXXXXXXXXXXXXXXTVDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIFHQVDGQKLYPINKYSADSIKKEETLVSPCSVTPQRSSTSSPQNQKRRDMFSSPVPNKMVYCDLPKSQSDNSPINTSQTINNPRSNYTYNQPYYHLHPNMLTMPHPMPLNPMRSDLSPASSLSNGTQHKSFVHSTPVKNLTNV 1508
            MNNIHSYQDKIDLPDSGGLRLVENYSGSTSSAYDEVSPHMHNSTPGSSESIYEKHNQSNVSSKKSKNSNLSNEDNLNLTVDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIFHQVDGQKLYPINKYSADSIKKEETLVSPCSVTPQRSSTSSPQNQKRRDMFSSPVPNKMVYCDLPKSQSDNSPINTSQTINNPRSNYTYNQPYYHLHPNMLTMPHPMPLNPMRSDLSPASSLSNGTQHKSFVHSTPVKNLTN+
Sbjct:    1 MNNIHSYQDKIDLPDSGGLRLVENYSGSTSSAYDEVSPHMHNSTPGSSESIYEKHNQSNVSSKKSKNSNLSNEDNLNLTVDALEKTLTEDKSTKVKEIISQILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQEEASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDYRKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQVAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIFHQVDGQKLYPINKYSADSIKKEETLVSPCSVTPQRSSTSSPQNQKRRDMFSSPVPNKMVYCDLPKSQSDNSPINTSQTINNPRSNYTYNQPYYHLHPNMLTMPHPMPLNPMRSDLSPASSLSNGTQHKSFVHSTPVKNLTNL 479          
BLAST of RFX-type winged-helix domain-containing protein vs. Planmine SMEST
Match: SMESG000058756.1 (SMESG000058756.1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.498e-12
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 3
Query:  540 LSHLEEN----KTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIG 785
            +S L+EN    +   L ++ +YE+Y+S+C ++    +STA FGK++++ FP I  RRLG RG S+Y Y GL  ++ +      +IG
Sbjct:   18 ISWLKENYCFVEGVSLSRKTLYENYQSFCRSHVYSQISTATFGKIIRQQFPQITTRRLGTRGNSKYHYHGLAVKKSSVYFNFNNIG 103          
BLAST of RFX-type winged-helix domain-containing protein vs. Planmine SMEST
Match: SMESG000017202.1 (SMESG000017202.1)

HSP 1 Score: 55.8398 bits (133), Expect = 8.140e-8
Identity = 22/71 (30.99%), Postives = 39/71 (54.93%), Query Frame = 3
Query:  531 KWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKKNFPNIKARRLGARGQSRYCYSGLR 743
            +W+  + E      L +  +Y  Y  +C    ++ ++ A FGK+++  F  ++ RRLG RG S+Y Y G+R
Sbjct:  195 QWLYDNYETADGVSLPRSTLYNHYLQHCQQEKLEPMNQASFGKLIRSVFFGLRTRRLGTRGNSKYHYYGIR 265          
The following BLAST results are available for this feature:
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RFX52.810e-2839.76regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX56.873e-2839.05regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX71.293e-2739.52regulatory factor X7 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX52.276e-2730.68regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:... [more]
RFX52.276e-2730.68regulatory factor X5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-191.244e-937.14RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.316e-937.14RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.458e-937.14RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.559e-937.14RFX-like transcription factor daf-19 [Source:UniP... [more]
daf-191.812e-937.14RFX-like transcription factor daf-19 [Source:UniP... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG97279.215e-2636.71gene:FBgn0037445 transcript:FBtr0330193[more]
CG97279.215e-2636.71gene:FBgn0037445 transcript:FBtr0081730[more]
CG97279.879e-2636.71gene:FBgn0037445 transcript:FBtr0330192[more]
Rfx2.343e-829.59gene:FBgn0020379 transcript:FBtr0337107[more]
Rfx2.361e-829.59gene:FBgn0020379 transcript:FBtr0337105[more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx7a2.801e-2936.67regulatory factor X7a [Source:ZFIN;Acc:ZDB-GENE-10... [more]
rfx7b2.012e-2739.75regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-17... [more]
rfx56.787e-2738.22regulatory factor X, 5 [Source:NCBI gene;Acc:10188... [more]
rfx42.213e-1026.40regulatory factor X, 4 [Source:NCBI gene;Acc:40301... [more]
rfx42.213e-1026.40regulatory factor X, 4 [Source:NCBI gene;Acc:40301... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx75.539e-2544.09regulatory factor X7 [Source:NCBI gene;Acc:1000382... [more]
rfx79.123e-2141.09regulatory factor X7 [Source:NCBI gene;Acc:1000382... [more]
rfx21.463e-832.39regulatory factor X2 [Source:NCBI gene;Acc:1001447... [more]
rfx21.498e-832.39regulatory factor X2 [Source:NCBI gene;Acc:1001447... [more]
rfx21.597e-832.39regulatory factor X2 [Source:NCBI gene;Acc:1001447... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rfx53.427e-3030.16regulatory factor X, 5 (influences HLA class II ex... [more]
Rfx53.427e-3030.16regulatory factor X, 5 (influences HLA class II ex... [more]
Rfx55.436e-2930.16regulatory factor X, 5 (influences HLA class II ex... [more]
Rfx55.436e-2930.16regulatory factor X, 5 (influences HLA class II ex... [more]
Rfx55.436e-2930.16regulatory factor X, 5 (influences HLA class II ex... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JL61|RFX5_MOUSE3.802e-2830.16DNA-binding protein Rfx5 OS=Mus musculus OX=10090 ... [more]
sp|P48382|RFX5_HUMAN1.093e-2630.68DNA-binding protein RFX5 OS=Homo sapiens OX=9606 G... [more]
sp|Q2KHR2|RFX7_HUMAN4.298e-2446.15DNA-binding protein RFX7 OS=Homo sapiens OX=9606 G... [more]
sp|P48383|SAK1_SCHPO1.573e-1137.65Protein sak1 OS=Schizosaccharomyces pombe (strain ... [more]
sp|Q7TNK1|RFX4_MOUSE1.028e-927.20Transcription factor RFX4 OS=Mus musculus OX=10090... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158R9852.254e-4334.39RFX-type winged-helix domain-containing protein OS... [more]
A0A0R3WI662.532e-4334.15RFX-type winged-helix domain-containing protein OS... [more]
A0A5K3ERA42.712e-4336.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TU133.250e-4338.21RFX-type winged-helix domain-containing protein OS... [more]
A0A5K3EPU55.364e-4336.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx7b8.086e-2839.51regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-17... [more]
rfx7b3.126e-2738.01regulatory factor X7b [Source:ZFIN;Acc:ZDB-GENE-17... [more]
rfx7a4.701e-2735.79DNA-binding protein RFX7-like [Source:NCBI gene;Ac... [more]
rfx58.165e-2738.22regulatory factor X5 [Source:NCBI gene;Acc:1030449... [more]
rfx52.253e-2540.58regulatory factor X5 [Source:NCBI gene;Acc:1030449... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005569.13.409e-2650.51pep scaffold:Pmarinus_7.0:GL484170:9855:13247:-1 g... [more]
rfx26.693e-830.99regulatory factor X, 2 (influences HLA class II ex... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RFX14.308e-1135.53Major transcriptional repressor of DNA-damage-regu... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414352.204e-2542.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439824.887e-1032.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353752.184e-941.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478522.290e-837.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394904.277e-835.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rfx54.558e-3042.04regulatory factor X5 [Source:NCBI gene;Acc:1011618... [more]
rfx7b2.504e-2838.65DNA-binding protein RFX7 [Source:NCBI gene;Acc:101... [more]
rfx7b9.547e-2738.89DNA-binding protein RFX7 [Source:NCBI gene;Acc:101... [more]
rfx45.842e-926.97regulatory factor X4 [Source:NCBI gene;Acc:1011650... [more]
rfx1a1.554e-832.95MHC class II regulatory factor RFX1 [Source:NCBI g... [more]
back to top
BLAST of RFX-type winged-helix domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000021065.10.000e+099.79SMESG000021065.1[more]
SMESG000058756.16.498e-1237.21SMESG000058756.1[more]
SMESG000017202.18.140e-830.99SMESG000017202.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018240 ID=SMED30018240|Name=RFX-type winged-helix domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1601bp
TATAAGTGAACTCAAATTGGTCTTGAATTTTAACCTTTATTCTTTAAATT
ATTTTCTTGAGAATAGGTTTCATGAATAATATACACAGTTATCAAGACAA
GATTGATTTGCCTGATAGTGGAGGTCTTAGGCTTGTAGAAAATTATAGTG
GGAGTACAAGTTCAGCGTATGACGAAGTTAGTCCACATATGCACAATAGT
ACTCCAGGTAGTAGTGAGAGCATCTATGAAAAACACAATCAATCTAATGT
TTCATCTAAAAAATCAAAAAATTCCAACTTATCAAATGAAGACAATTTAA
ATTTAACTGTTGATGCGTTGGAAAAAACATTAACAGAAGATAAATCCACC
AAAGTTAAAGAAATTATATCACAAATTCTGAATTTATCCGACACTGAGAA
ATTATTGATACAACTCCAATTTCCAATGACAGAATCCGACAATGGAACTT
TTGATTCATCGATGAATATTGGTTTTAACAATGTTGATATACTTGGAAAT
AGCACGATAGTTGAACAAGAGGAAGCATCGAAATGGGTTTTATCACACTT
AGAAGAAAATAAAACTACTTGTTTACAAAAACAAGAAGTATATGAAGATT
ACAAATCATACTGTATGACGTATAACATCAAATGTTTGAGTACAGCCGAT
TTTGGAAAGGTAATGAAGAAGAATTTTCCAAACATCAAAGCCCGTCGGTT
AGGAGCAAGAGGACAATCGAGGTATTGTTATTCTGGATTAAGAAATCGAC
AAGAAACCCAATCACCGGCATTGAAAGATATCGGTATGGTGCTCGAAGGC
AATGACACTGCCGATGATTATCGAAAACGAGACAATGTTGCAAACAGTGA
AGTCGAATCTTATTCATCCACATCAGTGTTGAATAATGATTTATCGAATG
TTCCAGAATACGAGCTCAGTCCGAATATTTTAATCGATTCTGCACTTGTT
ATCATTGAATTCATTAAACAAGTTGCAATGAATAAAAACATAATGAGTCT
GAAGCAAGCCGTTAAACATTTATTGTCCAATAGTCAAGTCGATATGCGTT
CACCACATGCTTTGAGACTGTGCTCGATTTTCCACCAAGTTGACGGCCAA
AAGCTCTATCCAATAAATAAATATTCAGCGGATTCCATTAAAAAAGAAGA
GACCCTTGTTAGTCCATGTAGCGTAACACCTCAAAGATCATCTACATCTA
GTCCTCAGAACCAAAAACGCCGTGATATGTTTAGTTCGCCGGTACCAAAT
AAAATGGTATATTGTGATTTACCAAAATCCCAGTCAGATAATTCTCCTAT
TAACACATCTCAAACCATTAATAATCCCAGATCTAATTACACATATAATC
AGCCCTATTATCATTTGCATCCTAACATGTTAACGATGCCACATCCAATG
CCTTTGAATCCAATGAGATCTGACTTATCCCCTGCGTCCAGTCTCAGTAA
TGGAACTCAACATAAGTCTTTTGTTCATTCAACACCAGTGAAAAACTTAA
CTAATGTAAGTTTCCTTATTTTATTTGTAATAATTTTTATACAATTGACA
ATATTTTAATCAGTATTATAATGGAAGCTTATACAAAATAAGTAGCATAA
T
back to top

protein sequence of SMED30018240-orf-1

>SMED30018240-orf-1 ID=SMED30018240-orf-1|Name=SMED30018240-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MNNIHSYQDKIDLPDSGGLRLVENYSGSTSSAYDEVSPHMHNSTPGSSES
IYEKHNQSNVSSKKSKNSNLSNEDNLNLTVDALEKTLTEDKSTKVKEIIS
QILNLSDTEKLLIQLQFPMTESDNGTFDSSMNIGFNNVDILGNSTIVEQE
EASKWVLSHLEENKTTCLQKQEVYEDYKSYCMTYNIKCLSTADFGKVMKK
NFPNIKARRLGARGQSRYCYSGLRNRQETQSPALKDIGMVLEGNDTADDY
RKRDNVANSEVESYSSTSVLNNDLSNVPEYELSPNILIDSALVIIEFIKQ
VAMNKNIMSLKQAVKHLLSNSQVDMRSPHALRLCSIFHQVDGQKLYPINK
YSADSIKKEETLVSPCSVTPQRSSTSSPQNQKRRDMFSSPVPNKMVYCDL
PKSQSDNSPINTSQTINNPRSNYTYNQPYYHLHPNMLTMPHPMPLNPMRS
DLSPASSLSNGTQHKSFVHSTPVKNLTNVSFLILFVIIFIQLTIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR039779RFX-like
IPR036390WH_DNA-bd_sf
IPR011991WHTH_DNA-bd_dom
IPR003150DNA-bd_RFX
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 152..226
e-value: 3.6E-26
score: 93.5
IPR003150DNA-binding RFX-type winged-helix domainPFAMPF02257RFX_DNA_bindingcoord: 152..226
e-value: 1.0E-26
score: 93.3
IPR003150DNA-binding RFX-type winged-helix domainPROSITEPS51526RFX_DBDcoord: 152..227
score: 19.655
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 362..387
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 362..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..73
NoneNo IPR availablePANTHERPTHR12619:SF21coord: 57..335
IPR039779RFX-like DNA-binding proteinPANTHERPTHR12619RFX TRANSCRIPTION FACTOR FAMILYcoord: 57..335
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 154..225