ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30018238
Length (bp)1550
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30018238) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30018238) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30018238) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30018238) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018238

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018238SMESG000002648.1 SmedASXL_014918SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018238SMESG000002648.1 dd_Smed_v6_15097_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30018238SMESG000080440.1 SMESG000046169.1 SMESG000042603.1 SMESG000002648.1 Contig38365newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018238SMESG000080440.1 SMESG000046169.1 SMESG000042603.1 SMESG000002648.1 Contig38365uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: GLS (glutaminase [Source:HGNC Symbol;Acc:HGNC:4331])

HSP 1 Score: 441.039 bits (1133), Expect = 5.913e-149
Identity = 205/401 (51.12%), Postives = 282/401 (70.32%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I     ++ +     A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++ GDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  145 YTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 544          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: GLS (glutaminase [Source:HGNC Symbol;Acc:HGNC:4331])

HSP 1 Score: 440.654 bits (1132), Expect = 7.250e-148
Identity = 203/384 (52.86%), Postives = 277/384 (72.14%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++ GDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  162 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 544          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: GLS2 (glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570])

HSP 1 Score: 425.246 bits (1092), Expect = 8.225e-143
Identity = 200/401 (49.88%), Postives = 274/401 (68.33%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM---HLLVEESSDL-IMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I      + +     A+  +G+  +D R+R+CM   H +V+ESS   +++RD F   + +    ++ +       IP+F+ FT H+  I+        G VA YIPQL++ +P  WG+SLCTVDGQR+++G T + FCLQS  KP+ YA++++ +G+  +HK+VG EPSG  +N L+LN E  PHNPM+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R   FC +LV  FNFH++D+L     K+DPR+
Sbjct:   78 YTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSN-IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRR 477          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: GLS2 (glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570])

HSP 1 Score: 278.485 bits (711), Expect = 3.134e-89
Identity = 127/212 (59.91%), Postives = 160/212 (75.47%), Query Frame = 3
Query:  681 MINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            M+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R   FC +LV  FNFH++D+L     K+DPR+
Sbjct:    1 MVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRR 212          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: GLS2 (glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570])

HSP 1 Score: 278.485 bits (711), Expect = 3.134e-89
Identity = 127/212 (59.91%), Postives = 160/212 (75.47%), Query Frame = 3
Query:  681 MINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            M+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R   FC +LV  FNFH++D+L     K+DPR+
Sbjct:    1 MVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRR 212          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: glna-1 (GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7])

HSP 1 Score: 431.795 bits (1109), Expect = 2.598e-143
Identity = 206/401 (51.37%), Postives = 286/401 (71.32%), Query Frame = 3
Query:  174 KAIVNSGIPFTDFRIRECMHLLV------EESSDLIMNRDKFLSLLDNKEFA---IINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFP-------KSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLL--DHHNKIDPRKSL 1322
            K + + GI   D R+++    +       E+S    M+++KF  ++    F    +I++ L   L IP++  FT  I+ I+  C  ++ G VA+YIPQL+R SPH WG+S+CT+DGQR+++GD+  NFCLQS SK  NYA+  +EIGS+ LH+YVG+EPSG  FN + L++ N PHNP+IN+GAI++ S+IK   ++ +RFD++ +Q++K+ G   +GF+NA F+SE+ +ADRNYAL+YYM+EY CFP       K+  L+E LDLYFQLCSLE NC++ +V+AAT ANGG+CP T +K L S   RD LSLM+SCGMYDYSG+FAF+ GLP KSGVSG  ++VIPNVMGI L+SPPLDK GNS R + FC +L+ KFNFH++DSLL  D   KIDPR+ +
Sbjct:  100 KVLRSFGIWENDPRLKQMFDRMKKHDEENEDSRQWAMSQEKFKEII----FPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKAKGLREELDLYFQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDPRRKI 496          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: glna-1 (GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7])

HSP 1 Score: 431.795 bits (1109), Expect = 3.659e-143
Identity = 201/372 (54.03%), Postives = 275/372 (73.92%), Query Frame = 3
Query:  243 EESSDLIMNRDKFLSLLDNKEFA---IINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFP-------KSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLL--DHHNKIDPRKSL 1322
            E+S    M+++KF  ++    F    +I++ L   L IP++  FT  I+ I+  C  ++ G VA+YIPQL+R SPH WG+S+CT+DGQR+++GD+  NFCLQS SK  NYA+  +EIGS+ LH+YVG+EPSG  FN + L++ N PHNP+IN+GAI++ S+IK   ++ +RFD++ +Q++K+ G   +GF+NA F+SE+ +ADRNYAL+YYM+EY CFP       K+  L+E LDLYFQLCSLE NC++ +V+AAT ANGG+CP T +K L S   RD LSLM+SCGMYDYSG+FAF+ GLP KSGVSG  ++VIPNVMGI L+SPPLDK GNS R + FC +L+ KFNFH++DSLL  D   KIDPR+ +
Sbjct:  129 EDSRQWAMSQEKFKEII----FPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKAKGLREELDLYFQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDPRRKI 496          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: glna-1 (GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7])

HSP 1 Score: 431.024 bits (1107), Expect = 4.211e-143
Identity = 206/399 (51.63%), Postives = 285/399 (71.43%), Query Frame = 3
Query:  174 KAIVNSGIPFTDFRIRECMHLLV------EESSDLIMNRDKFLSLLDNKEFA---IINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSN-----LQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLL--DHHNKIDPRKSL 1322
            K + + GI   D R+++    +       E+S    M+++KF  ++    F    +I++ L   L IP++  FT  I+ I+  C  ++ G VA+YIPQL+R SPH WG+S+CT+DGQR+++GD+  NFCLQS SK  NYA+  +EIGS+ LH+YVG+EPSG  FN + L++ N PHNP+IN+GAI++ S+IK   ++ +RFD++ +Q++K+ G   +GF+NA F+SE+ +ADRNYAL+YYM+EY CFP  S      L+E LDLYFQLCSLE NC++ +V+AAT ANGG+CP T +K L S   RD LSLM+SCGMYDYSG+FAF+ GLP KSGVSG  ++VIPNVMGI L+SPPLDK GNS R + FC +L+ KFNFH++DSLL  D   KIDPR+ +
Sbjct:  100 KVLRSFGIWENDPRLKQMFDRMKKHDEENEDSRQWAMSQEKFKEII----FPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKGLREELDLYFQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDPRRKI 494          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: glna-1 (GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7])

HSP 1 Score: 431.024 bits (1107), Expect = 4.211e-143
Identity = 206/399 (51.63%), Postives = 285/399 (71.43%), Query Frame = 3
Query:  174 KAIVNSGIPFTDFRIRECMHLLV------EESSDLIMNRDKFLSLLDNKEFA---IINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSN-----LQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLL--DHHNKIDPRKSL 1322
            K + + GI   D R+++    +       E+S    M+++KF  ++    F    +I++ L   L IP++  FT  I+ I+  C  ++ G VA+YIPQL+R SPH WG+S+CT+DGQR+++GD+  NFCLQS SK  NYA+  +EIGS+ LH+YVG+EPSG  FN + L++ N PHNP+IN+GAI++ S+IK   ++ +RFD++ +Q++K+ G   +GF+NA F+SE+ +ADRNYAL+YYM+EY CFP  S      L+E LDLYFQLCSLE NC++ +V+AAT ANGG+CP T +K L S   RD LSLM+SCGMYDYSG+FAF+ GLP KSGVSG  ++VIPNVMGI L+SPPLDK GNS R + FC +L+ KFNFH++DSLL  D   KIDPR+ +
Sbjct:  100 KVLRSFGIWENDPRLKQMFDRMKKHDEENEDSRQWAMSQEKFKEII----FPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKGLREELDLYFQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDPRRKI 494          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: glna-1 (GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7])

HSP 1 Score: 431.795 bits (1109), Expect = 5.352e-143
Identity = 206/401 (51.37%), Postives = 286/401 (71.32%), Query Frame = 3
Query:  174 KAIVNSGIPFTDFRIRECMHLLV------EESSDLIMNRDKFLSLLDNKEFA---IINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFP-------KSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLL--DHHNKIDPRKSL 1322
            K + + GI   D R+++    +       E+S    M+++KF  ++    F    +I++ L   L IP++  FT  I+ I+  C  ++ G VA+YIPQL+R SPH WG+S+CT+DGQR+++GD+  NFCLQS SK  NYA+  +EIGS+ LH+YVG+EPSG  FN + L++ N PHNP+IN+GAI++ S+IK   ++ +RFD++ +Q++K+ G   +GF+NA F+SE+ +ADRNYAL+YYM+EY CFP       K+  L+E LDLYFQLCSLE NC++ +V+AAT ANGG+CP T +K L S   RD LSLM+SCGMYDYSG+FAF+ GLP KSGVSG  ++VIPNVMGI L+SPPLDK GNS R + FC +L+ KFNFH++DSLL  D   KIDPR+ +
Sbjct:  148 KVLRSFGIWENDPRLKQMFDRMKKHDEENEDSRQWAMSQEKFKEII----FPCTILISRTLRNQLIIPSWLEFTQLIETIFETCRESKEGEVASYIPQLARQSPHLWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGRLFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNATFLSERDTADRNYALSYYMKEYRCFPDESQVYEKAKGLREELDLYFQLCSLETNCDTAAVMAATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVVIPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDKFNFHNYDSLLHPDDSRKIDPRRKI 544          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: GLS (gene:FBgn0261625 transcript:FBtr0302975)

HSP 1 Score: 446.432 bits (1147), Expect = 9.298e-151
Identity = 214/395 (54.18%), Postives = 269/395 (68.10%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVE-----------ESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSL----IKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
             +  +GI   D R+RE M  L +            +    +NR+ F +++      +I K       IP+F SF   I++IYN C  N  G +A YIPQL+R++P  WGLS+CT+DGQR++IGD  V F LQS SKP+ YA+AL ++G   +H YVG EPSG +FN L L+   KPHNPMIN+GAIL CSL    +K  +   E FDY    FK++ G E +GFNNAVF+SE+ +ADRNYAL +YMRE  CFPK +NL+E++D YFQ CS+E NCE+MSVIAA+ ANGG+CPTT++KV   E +RD LS+MHSCG YDYSGQFAFK GLP KSGVSG  +LVIPNVMGI  WSPPLD  GN+ R LQFC ELV  FNFH +D+L    NK DPRK
Sbjct:   76 GLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVV-APNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRK 469          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: GLS (gene:FBgn0261625 transcript:FBtr0302972)

HSP 1 Score: 447.203 bits (1149), Expect = 1.040e-150
Identity = 214/395 (54.18%), Postives = 269/395 (68.10%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVE-----------ESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSL----IKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
             +  +GI   D R+RE M  L +            +    +NR+ F +++      +I K       IP+F SF   I++IYN C  N  G +A YIPQL+R++P  WGLS+CT+DGQR++IGD  V F LQS SKP+ YA+AL ++G   +H YVG EPSG +FN L L+   KPHNPMIN+GAIL CSL    +K  +   E FDY    FK++ G E +GFNNAVF+SE+ +ADRNYAL +YMRE  CFPK +NL+E++D YFQ CS+E NCE+MSVIAA+ ANGG+CPTT++KV   E +RD LS+MHSCG YDYSGQFAFK GLP KSGVSG  +LVIPNVMGI  WSPPLD  GN+ R LQFC ELV  FNFH +D+L    NK DPRK
Sbjct:   99 GLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVV-APNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRK 492          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: GLS (gene:FBgn0261625 transcript:FBtr0302976)

HSP 1 Score: 446.432 bits (1147), Expect = 1.083e-150
Identity = 214/395 (54.18%), Postives = 269/395 (68.10%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVE-----------ESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSL----IKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
             +  +GI   D R+RE M  L +            +    +NR+ F +++      +I K       IP+F SF   I++IYN C  N  G +A YIPQL+R++P  WGLS+CT+DGQR++IGD  V F LQS SKP+ YA+AL ++G   +H YVG EPSG +FN L L+   KPHNPMIN+GAIL CSL    +K  +   E FDY    FK++ G E +GFNNAVF+SE+ +ADRNYAL +YMRE  CFPK +NL+E++D YFQ CS+E NCE+MSVIAA+ ANGG+CPTT++KV   E +RD LS+MHSCG YDYSGQFAFK GLP KSGVSG  +LVIPNVMGI  WSPPLD  GN+ R LQFC ELV  FNFH +D+L    NK DPRK
Sbjct:   86 GLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVV-APNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRK 479          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: GLS (gene:FBgn0261625 transcript:FBtr0302974)

HSP 1 Score: 447.203 bits (1149), Expect = 2.427e-150
Identity = 214/395 (54.18%), Postives = 269/395 (68.10%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVE-----------ESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSL----IKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
             +  +GI   D R+RE M  L +            +    +NR+ F +++      +I K       IP+F SF   I++IYN C  N  G +A YIPQL+R++P  WGLS+CT+DGQR++IGD  V F LQS SKP+ YA+AL ++G   +H YVG EPSG +FN L L+   KPHNPMIN+GAIL CSL    +K  +   E FDY    FK++ G E +GFNNAVF+SE+ +ADRNYAL +YMRE  CFPK +NL+E++D YFQ CS+E NCE+MSVIAA+ ANGG+CPTT++KV   E +RD LS+MHSCG YDYSGQFAFK GLP KSGVSG  +LVIPNVMGI  WSPPLD  GN+ R LQFC ELV  FNFH +D+L    NK DPRK
Sbjct:  134 GLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVV-APNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRK 527          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: GLS (gene:FBgn0261625 transcript:FBtr0344191)

HSP 1 Score: 447.973 bits (1151), Expect = 2.701e-150
Identity = 214/395 (54.18%), Postives = 269/395 (68.10%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVE-----------ESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSL----IKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
             +  +GI   D R+RE M  L +            +    +NR+ F +++      +I K       IP+F SF   I++IYN C  N  G +A YIPQL+R++P  WGLS+CT+DGQR++IGD  V F LQS SKP+ YA+AL ++G   +H YVG EPSG +FN L L+   KPHNPMIN+GAIL CSL    +K  +   E FDY    FK++ G E +GFNNAVF+SE+ +ADRNYAL +YMRE  CFPK +NL+E++D YFQ CS+E NCE+MSVIAA+ ANGG+CPTT++KV   E +RD LS+MHSCG YDYSGQFAFK GLP KSGVSG  +LVIPNVMGI  WSPPLD  GN+ R LQFC ELV  FNFH +D+L    NK DPRK
Sbjct:  155 GLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFKAVV-APNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNELVLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAVFLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANGGICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMGIFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRK 548          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: glsa (glutaminase a [Source:ZFIN;Acc:ZDB-GENE-050204-3])

HSP 1 Score: 442.58 bits (1137), Expect = 7.630e-150
Identity = 205/383 (53.52%), Postives = 275/383 (71.80%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM +L   ++ +SD  ++R  F   + +    ++ +       IP+F+SFT HI +IY        G VA YIPQL++FSP+ W +SLCTVDGQRY  GDT V FCLQS  KP+ YA+A+ + G+  +H+++G EPSG  FN L LN ++KPHNPM+N+GAI+  SL+KQ ++  E+FDY+    KK+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILDLYFQLCS+E  CES SV+AAT ANGG CP T ++V++ EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMGI  WSPPLDK GNS R +QFC +LVQ FNFH++D+L     K+DPR+
Sbjct:   86 ALKATGLRTGDPRLKECMEMLKITLKTTSDGALDRHLFKKCVQS-NIVLLTQAFRKKFVIPDFQSFTSHIDQIYESAKSLSGGQVADYIPQLAKFSPNLWAVSLCTVDGQRYTAGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVCTSLLKQGVSNAEKFDYVLNFMKKLAGNEYVGFSNATFQSERLSGDRNFAIGYYLKEKKCFPEGTDMISILDLYFQLCSIEVTCESASVMAATLANGGFCPITGERVVNPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVQLFNFHNYDNLRHFAKKLDPRR 467          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: gls2b (glutaminase 2b (liver, mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-050208-408])

HSP 1 Score: 441.039 bits (1133), Expect = 8.197e-149
Identity = 207/400 (51.75%), Postives = 278/400 (69.50%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I     +V +     A+ ++G+  +D R+R+CM  +   V +S+  +M   +      +    +++        IP F++F D I  IY      Q+G VA YIP L++FSP  WG+SLCTVDGQR+++GDT V FCLQS  KP+ YA+A+ E G+ ++H+YVG EPSG  FN L+L+ E+KPHNPM+N+GAI+I SLIKQ +N  E+FDY+    KK+ G+E +GF+NA F SEK + DRNYA+ YY++E  CFP    + + LD YFQLC++E  CES SV+AAT ANGG+CP T ++VLS+EAVR+TLSLMHSCGMYDYSGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPP+DK GNS R ++FC ELV  FNFH++D+L     K DPR+
Sbjct:  100 YTITEGAEKVPVSHFTAALKSTGLLTSDPRLRDCMEKIRRAVRDSTGEVMMDRELFKKCASGNIVLLSLAFRRKFIIPEFEAFVDIINHIYYTSKLQQDGQVAKYIPHLTKFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLEYAIAVHEHGTEHVHQYVGKEPSGFKFNKLSLDEEDKPHNPMVNAGAIVISSLIKQGVNKAEKFDYVMDFVKKMTGSEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPDGVEMIDALDFYFQLCAIEVTCESGSVMAATLANGGICPITGERVLSTEAVRNTLSLMHSCGMYDYSGQFAFHVGLPAKSGVSGAVLLVVPNVMGVMCWSPPVDKVGNSVRGIRFCQELVSLFNFHNYDNLRHFLKKQDPRR 499          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: gls2a (glutaminase 2a (liver, mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-081105-57])

HSP 1 Score: 436.802 bits (1122), Expect = 2.027e-147
Identity = 203/400 (50.75%), Postives = 272/400 (68.00%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM---HLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I     ++++     A+ ++G+  +D R+R+CM   H  V++S    M   +           ++ +       IP+F++FT  I  +Y      Q G VA YIPQL++FSP  WG+SLCTVDGQR+ +GDT V FCLQS  KP+ YALA+ E GS ++H+YVG EPSG  FN L+L+ E KPHNPM+N+GAI+I SL+K   N  E+FDY+    K++ G E +GF+NA F SEK +  RNYA+ YY++E  CFP  +++   LD YFQLCS+E  CES SV+AAT ANGG+CP T ++VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PN+MG+  WSP LD+ GNS R + FC ELV  FNFH++D+L     K+DPR+
Sbjct:   78 YTITQGEEKISVARFLTALKSTGLQTSDPRLRDCMRQIHHAVQDSVGTAMMDQELFRKCVGSNIVLLTQAFQRKFIIPDFEAFTSLINHLYCDAQTQQGGKVANYIPQLAKFSPDLWGVSLCTVDGQRHAVGDTNVPFCLQSCVKPLEYALAVHETGSEHVHRYVGKEPSGLKFNKLSLDEEEKPHNPMVNAGAIVISSLLKPGYNKAEKFDYMVDYLKRMAGREYVGFSNATFQSEKETGYRNYAIGYYLKEKKCFPNGADMTAALDFYFQLCSIEVTCESGSVMAATLANGGICPITGERVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAVLLVVPNIMGVMCWSPALDRVGNSIRGIHFCQELVSLFNFHNYDNLRHFAKKLDPRR 477          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: glsb (glutaminase b [Source:ZFIN;Acc:ZDB-GENE-030616-550])

HSP 1 Score: 434.106 bits (1115), Expect = 2.928e-147
Identity = 201/383 (52.48%), Postives = 266/383 (69.45%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM +L   ++ +SD +M               ++ +       IP+F+SF  HI  +Y    +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+++ + G+  +H+++G EPSG  FN L L+ ++KPHNPM+N+GAI+  SLIKQ     E+FDY+    KK+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP  +++  +LDLYFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVRDTLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMGI  WSPPLDK GNS R +QFC +LV  FNFH++D+L     K+DPR+
Sbjct:   32 ALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFQSFASHIDTLYEKGRNLSGGLVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAISVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIKQLAGNAEKFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPDGTDMTAVLDLYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRDTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLFNFHNYDNLRHFAKKLDPRR 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: gls2b (glutaminase 2b (liver, mitochondrial) [Source:ZFIN;Acc:ZDB-GENE-050208-408])

HSP 1 Score: 433.335 bits (1113), Expect = 5.545e-147
Identity = 206/400 (51.50%), Postives = 277/400 (69.25%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I     +V +     A+ ++G+  +D R+R+CM  +   V +S+  +M   +      +    +++        IP F++F D I  IY      Q+G VA YIP L++FSP  WG+SLCTVDGQR+++GDT V FCLQS  KP+ YA+A+ E G+ ++H+YVG EPSG  FN L+L+ E+KPHNPM+N+GAI+I SLIK  +N  E+FDY+    KK+ G+E +GF+NA F SEK + DRNYA+ YY++E  CFP    + + LD YFQLC++E  CES SV+AAT ANGG+CP T ++VLS+EAVR+TLSLMHSCGMYDYSGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPP+DK GNS R ++FC ELV  FNFH++D+L     K DPR+
Sbjct:   16 YTITEGAEKVPVSHFTAALKSTGLLTSDPRLRDCMEKIRRAVRDSTGEVMMDRELFKKCASGNIVLLSLAFRRKFIIPEFEAFVDIINHIYYTSKLQQDGQVAKYIPHLTKFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLEYAIAVHEHGTEHVHQYVGKEPSGFKFNKLSLDEEDKPHNPMVNAGAIVISSLIKG-VNKAEKFDYVMDFVKKMTGSEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPDGVEMIDALDFYFQLCAIEVTCESGSVMAATLANGGICPITGERVLSTEAVRNTLSLMHSCGMYDYSGQFAFHVGLPAKSGVSGAVLLVVPNVMGVMCWSPPVDKVGNSVRGIRFCQELVSLFNFHNYDNLRHFLKKQDPRR 414          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: GLS2 (glutaminase 2 [Source:NCBI gene;Acc:100492220])

HSP 1 Score: 446.817 bits (1148), Expect = 1.885e-151
Identity = 208/379 (54.88%), Postives = 275/379 (72.56%), Query Frame = 3
Query:  192 GIPFTDFRIRECMHLLVEESSDL----IMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            GI  +D R+++CM +L +   +L    +M+R+ F   + +     + +I+   LAIP+F+ FT H+  +Y +      G VA YIPQL++ SP  WG+SLCTVDGQR++IGDT V FCLQS  KP+ Y++A+ ++G+  +H+++G EPSG  FN L+LN+E KPHNPM+N+GAI++CSLIK   N  E+FDYI +  K + GNE +GF+NA F SEK + DRNYA+ YYM+E  CFP   ++   LDLYFQLCS+E  CES SVIAAT ANGG+CP T  +VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC ELV  FNFH++D+L     K+DPRK
Sbjct:   90 GILTSDPRLKDCMDMLQQTVQELATGAVMDREMFQKCVQSN-IVFLTQIVCKKLAIPDFEQFTLHVNRLYENASALDKGEVANYIPQLAKSSPERWGVSLCTVDGQRHSIGDTGVPFCLQSCVKPLKYSIAVNDLGTDFVHQHMGKEPSGNRFNKLSLNHEGKPHNPMVNAGAIVVCSLIKPSTNKAEKFDYIMQSLKNMAGNEFVGFSNATFQSEKETGDRNYAIGYYMKEKKCFPSGIDMISALDLYFQLCSIEVTCESGSVIAATLANGGICPITGQRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAILLVVPNVMGVFCWSPPLDRIGNSVRGIHFCQELVSLFNFHNYDNLRHCVRKLDPRK 467          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: GLS2 (glutaminase 2 [Source:NCBI gene;Acc:100492220])

HSP 1 Score: 446.817 bits (1148), Expect = 6.599e-151
Identity = 208/379 (54.88%), Postives = 275/379 (72.56%), Query Frame = 3
Query:  192 GIPFTDFRIRECMHLLVEESSDL----IMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            GI  +D R+++CM +L +   +L    +M+R+ F   + +     + +I+   LAIP+F+ FT H+  +Y +      G VA YIPQL++ SP  WG+SLCTVDGQR++IGDT V FCLQS  KP+ Y++A+ ++G+  +H+++G EPSG  FN L+LN+E KPHNPM+N+GAI++CSLIK   N  E+FDYI +  K + GNE +GF+NA F SEK + DRNYA+ YYM+E  CFP   ++   LDLYFQLCS+E  CES SVIAAT ANGG+CP T  +VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC ELV  FNFH++D+L     K+DPRK
Sbjct:   90 GILTSDPRLKDCMDMLQQTVQELATGAVMDREMFQKCVQSN-IVFLTQIVCKKLAIPDFEQFTLHVNRLYENASALDKGEVANYIPQLAKSSPERWGVSLCTVDGQRHSIGDTGVPFCLQSCVKPLKYSIAVNDLGTDFVHQHMGKEPSGNRFNKLSLNHEGKPHNPMVNAGAIVVCSLIKPSTNKAEKFDYIMQSLKNMAGNEFVGFSNATFQSEKETGDRNYAIGYYMKEKKCFPSGIDMISALDLYFQLCSIEVTCESGSVIAATLANGGICPITGQRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAILLVVPNVMGVFCWSPPLDRIGNSVRGIHFCQELVSLFNFHNYDNLRHCVRKLDPRK 467          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: GLS2 (glutaminase 2 [Source:NCBI gene;Acc:100492220])

HSP 1 Score: 446.817 bits (1148), Expect = 1.406e-150
Identity = 208/379 (54.88%), Postives = 275/379 (72.56%), Query Frame = 3
Query:  192 GIPFTDFRIRECMHLLVEESSDL----IMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            GI  +D R+++CM +L +   +L    +M+R+ F   + +     + +I+   LAIP+F+ FT H+  +Y +      G VA YIPQL++ SP  WG+SLCTVDGQR++IGDT V FCLQS  KP+ Y++A+ ++G+  +H+++G EPSG  FN L+LN+E KPHNPM+N+GAI++CSLIK   N  E+FDYI +  K + GNE +GF+NA F SEK + DRNYA+ YYM+E  CFP   ++   LDLYFQLCS+E  CES SVIAAT ANGG+CP T  +VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC ELV  FNFH++D+L     K+DPRK
Sbjct:  150 GILTSDPRLKDCMDMLQQTVQELATGAVMDREMFQKCVQSN-IVFLTQIVCKKLAIPDFEQFTLHVNRLYENASALDKGEVANYIPQLAKSSPERWGVSLCTVDGQRHSIGDTGVPFCLQSCVKPLKYSIAVNDLGTDFVHQHMGKEPSGNRFNKLSLNHEGKPHNPMVNAGAIVVCSLIKPSTNKAEKFDYIMQSLKNMAGNEFVGFSNATFQSEKETGDRNYAIGYYMKEKKCFPSGIDMISALDLYFQLCSIEVTCESGSVIAATLANGGICPITGQRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAILLVVPNVMGVFCWSPPLDRIGNSVRGIHFCQELVSLFNFHNYDNLRHCVRKLDPRK 527          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:Xenbase;Acc:XB-GENE-973341])

HSP 1 Score: 436.032 bits (1120), Expect = 4.106e-148
Identity = 202/383 (52.74%), Postives = 270/383 (70.50%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+  +D R++ECM +L   ++  SD +M   +           ++ +       IP+F SFT HI E+Y +      G VA YIPQL++FSP  WG+S+CTVDGQR+++GDT V FCLQS  KP+ YA+A+ ++ +  +H+YVG EPSG  FN L LN + KPHNPM+N+GAI+I SLIKQ  +  E+FDY+ + F K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++   LD YFQLCS+E  CES SV+AAT ANGG CP T +++LS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMG+  WSPPLDK GNS R +QFC +LV   NFH++D+L     K+DPR+
Sbjct:   93 ALKATGLRTSDPRLKECMDMLRLSLQTMSDGVMLDKELFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYENARKLSGGKVADYIPQLAKFSPDLWGVSICTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLSTEYVHRYVGKEPSGLRFNKLFLNEDEKPHNPMVNAGAIVITSLIKQGSSNAEKFDYVMQFFNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEHTDMVGTLDFYFQLCSIEVTCESASVMAATLANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPSKSGVSGGILLVVPNVMGMMCWSPPLDKLGNSVRGIQFCQDLVSLCNFHNYDNLRHFAKKLDPRR 475          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: spout1 (SPOUT domain containing methyltransferase 1 [Source:Xenbase;Acc:XB-GENE-973341])

HSP 1 Score: 436.417 bits (1121), Expect = 1.017e-147
Identity = 202/383 (52.74%), Postives = 270/383 (70.50%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+  +D R++ECM +L   ++  SD +M   +           ++ +       IP+F SFT HI E+Y +      G VA YIPQL++FSP  WG+S+CTVDGQR+++GDT V FCLQS  KP+ YA+A+ ++ +  +H+YVG EPSG  FN L LN + KPHNPM+N+GAI+I SLIKQ  +  E+FDY+ + F K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++   LD YFQLCS+E  CES SV+AAT ANGG CP T +++LS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMG+  WSPPLDK GNS R +QFC +LV   NFH++D+L     K+DPR+
Sbjct:   54 ALKATGLRTSDPRLKECMDMLRLSLQTMSDGVMLDKELFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYENARKLSGGKVADYIPQLAKFSPDLWGVSICTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVNDLSTEYVHRYVGKEPSGLRFNKLFLNEDEKPHNPMVNAGAIVITSLIKQGSSNAEKFDYVMQFFNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEHTDMVGTLDFYFQLCSIEVTCESASVMAATLANGGFCPITGERILSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPSKSGVSGGILLVVPNVMGMMCWSPPLDKLGNSVRGIQFCQDLVSLCNFHNYDNLRHFAKKLDPRR 436          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Gls (glutaminase [Source:MGI Symbol;Acc:MGI:95752])

HSP 1 Score: 443.351 bits (1139), Expect = 4.329e-150
Identity = 204/384 (53.12%), Postives = 278/384 (72.40%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  167 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 549          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Gls (glutaminase [Source:MGI Symbol;Acc:MGI:95752])

HSP 1 Score: 442.965 bits (1138), Expect = 6.372e-149
Identity = 204/384 (53.12%), Postives = 278/384 (72.40%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  167 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQS-NIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 549          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Gls (glutaminase [Source:MGI Symbol;Acc:MGI:95752])

HSP 1 Score: 430.639 bits (1106), Expect = 1.388e-146
Identity = 197/366 (53.83%), Postives = 265/366 (72.40%), Query Frame = 3
Query:  222 ECMHLLVEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            + + L ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:    2 DMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 366          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Gls2 (glutaminase 2 (liver, mitochondrial) [Source:MGI Symbol;Acc:MGI:2143539])

HSP 1 Score: 421.009 bits (1081), Expect = 2.898e-141
Identity = 195/401 (48.63%), Postives = 272/401 (67.83%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM----HLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I      + +     A+  +G+  +D R+++CM     ++ E SS  +++R+ F   + +    ++ +       IP+F+ FT H+  I+        G VA YIP L++ +P  WG+SLCTVDGQR+++G T + FCLQS  KP+ YA++++ +G+  +HK+VG EPSG  +N L+LN E  PHNPM+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R + FC +LV  FNFH++D+L     K+DPR+
Sbjct:   78 YTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQESSSGGLLDRELFQKCVSSN-IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKEPTGGKVAAYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPRR 477          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Gls (glutaminase [Source:MGI Symbol;Acc:MGI:95752])

HSP 1 Score: 293.893 bits (751), Expect = 6.751e-97
Identity = 131/219 (59.82%), Postives = 170/219 (77.63%), Query Frame = 3
Query:  660 ENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:    2 DDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 220          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P13264|GLSK_RAT (Glutaminase kidney isoform, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gls PE=1 SV=2)

HSP 1 Score: 442.965 bits (1138), Expect = 3.831e-148
Identity = 204/384 (53.12%), Postives = 278/384 (72.40%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  167 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 549          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|D3Z7P3|GLSK_MOUSE (Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 4.457e-148
Identity = 204/384 (53.12%), Postives = 278/384 (72.40%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  167 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQS-NIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 549          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O94925|GLSK_HUMAN (Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 3.482e-147
Identity = 203/384 (52.86%), Postives = 277/384 (72.14%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIM-NRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+ ++G+  +D R++ECM +L   ++ +SD +M ++D F   + +    ++ +       IP+F SFT HI E+Y        G VA YIPQL++FSP  WG+S+CTVDGQR++ GDT V FCLQS  KP+ YA+A+ ++G+  +H+YVG EPSG  FN L LN ++KPHNPM+N+GAI++ SLIKQ +N  E+FDY+ +   K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMG+  WSPPLDK GNS + + FC +LV   NFH++D+L     K+DPR+
Sbjct:  162 ALKSTGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSN-IVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR 544          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UI32|GLSL_HUMAN (Glutaminase liver isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS2 PE=1 SV=2)

HSP 1 Score: 425.246 bits (1092), Expect = 3.950e-142
Identity = 200/401 (49.88%), Postives = 274/401 (68.33%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM---HLLVEESSDL-IMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I      + +     A+  +G+  +D R+R+CM   H +V+ESS   +++RD F   + +    ++ +       IP+F+ FT H+  I+        G VA YIPQL++ +P  WG+SLCTVDGQR+++G T + FCLQS  KP+ YA++++ +G+  +HK+VG EPSG  +N L+LN E  PHNPM+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R   FC +LV  FNFH++D+L     K+DPR+
Sbjct:   78 YTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSEMHRVVQESSSGGLLDRDLFRKCVSSN-IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDVKELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGTSFCQKLVSLFNFHNYDNLRHCARKLDPRR 477          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q571F8|GLSL_MOUSE (Glutaminase liver isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls2 PE=1 SV=2)

HSP 1 Score: 421.009 bits (1081), Expect = 2.027e-140
Identity = 195/401 (48.63%), Postives = 272/401 (67.83%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM----HLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            Y I      + +     A+  +G+  +D R+++CM     ++ E SS  +++R+ F   + +    ++ +       IP+F+ FT H+  I+        G VA YIP L++ +P  WG+SLCTVDGQR+++G T + FCLQS  KP+ YA++++ +G+  +HK+VG EPSG  +N L+LN E  PHNPM+N+GAI++ SLIK   N  E+FD++ +   K+ GNE +GF+NA F SEK + DRNYA+ YY++E  CFPK  ++   LDLYFQLCS+E  CES SV+AAT ANGG+CP T + VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KS VSG+ LLV+PNVMG+   SPPLDK GNS R + FC +LV  FNFH++D+L     K+DPR+
Sbjct:   78 YTIAEGQERIPIHKFTTALKATGLQTSDPRLQDCMSKMQRMVQESSSGGLLDRELFQKCVSSN-IVLLTQAFRKKFVIPDFEEFTGHVDRIFEDAKEPTGGKVAAYIPHLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVSTLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAGNEFMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESGSVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSQRGINFCQKLVSLFNFHNYDNLRHCARKLDPRR 477          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: B1Q3K1 (Glutaminase OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 276/344 (80.23%), Postives = 307/344 (89.24%), Query Frame = 3
Query:   81 SRLFSNSIISAKHKKYLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCT-VDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFK 1109
            +R FSNS+I  K+ KYLID+++PE+NL+DV+  I NSGIPFTDFRI+EC++ LVEES+DLI+ RDKFL LL+ K+F I+NKILT +LAIPNFK+F++HIK+IYNHCVHNQNG          R      G   C  VDGQR+NIGD+TVNFCLQSTSKPINYALALTEIGSYNLHK+VGYEPSGTSFNHLTLN+ENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNE LGFNNAVFMSEKSSADRNYALAYYMREY CFPK+SNLQEILDLYFQLCSLE NCESMSVIA+TFANGGLCPTT++KVLSSE+VRDTLSLMHSCGMYDYSGQFAFK
Sbjct:    4 NRNFSNSVIPNKNWKYLIDIDSPEINLNDVKNVIQNSGIPFTDFRIKECINALVEESNDLIVRRDKFLQLLEGKDFHILNKILTDNLAIPNFKNFSEHIKDIYNHCVHNQNGRCCYIYSSTVRIQSSLLGGYHCVPVDGQRFNIGDSTVNFCLQSTSKPINYALALTEIGSYNLHKFVGYEPSGTSFNHLTLNHENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNEVLGFNNAVFMSEKSSADRNYALAYYMREYRCFPKNSNLQEILDLYFQLCSLEVNCESMSVIASTFANGGLCPTTEEKVLSSESVRDTLSLMHSCGMYDYSGQFAFK 347          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8HV90 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 4.480e-173
Identity = 239/410 (58.29%), Postives = 302/410 (73.66%), Query Frame = 3
Query:  129 LIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRD--KFLSLLDNKEFAIINK--------ILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQ 1328
            L D N   V++  +   I  +GI  TD R++EC+  +       I + D  K    LD K F  + +        IL  D  IP F  FT HIK I+ +C  N+ G+ A+YIPQL+RF P+YW +S+CT+DGQR+N GD  V FCLQSTSKP+NYA+ALTE+G   +HK VGYEPSG SFN + LN+  +PHNPM+NSG+I+ICSLI++  +L +RFDY+ +++K++ GNE LGFNN  F+SE+ +ADRN+ALAYYM+E GCFP  +NL+E LD YFQLCS+E NCES +VIA T ANGG+CP T + VLS EAVRDTLSLMHSCGMYDYSGQFAFKCGLP KSGVSG  LLVIPN+MGI LWSPPLDKQGNS R +QFC ELV KFNFH++DSL+   +K+DPR++ V+
Sbjct:   43 LKDRNRNRVSISRILSTIEGAGIQLTDPRLKECIRNIQNLQKRSIKSEDDAKNSFFLDKKTFTEVVRDNVIMLLTILQNDFVIPEFHEFTHHIKAIFENCRDNREGAPASYIPQLARFDPNYWAVSICTIDGQRFNCGDYHVPFCLQSTSKPLNYAIALTELGCDEVHKSVGYEPSGISFNSIALNDNKRPHNPMVNSGSIIICSLIRRMEHLADRFDYVMQEYKRMAGNEYLGFNNPTFLSERETADRNFALAYYMKENGCFPPGTNLKETLDFYFQLCSVEVNCESAAVIAGTLANGGICPLTGEPVLSPEAVRDTLSLMHSCGMYDYSGQFAFKCGLPAKSGVSGVILLVIPNLMGIALWSPPLDKQGNSCRGIQFCKELVAKFNFHNYDSLIYTQDKLDPRRAHVE 452          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267FC93 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018179g1 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 4.634e-173
Identity = 239/410 (58.29%), Postives = 302/410 (73.66%), Query Frame = 3
Query:  129 LIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRD--KFLSLLDNKEFAIINK--------ILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQ 1328
            L D N   V++  +   I  +GI  TD R++EC+  +       I + D  K    LD K F  + +        IL  D  IP F  FT HIK I+ +C  N+ G+ A+YIPQL+RF P+YW +S+CT+DGQR+N GD  V FCLQSTSKP+NYA+ALTE+G   +HK VGYEPSG SFN + LN+  +PHNPM+NSG+I+ICSLI++  +L +RFDY+ +++K++ GNE LGFNN  F+SE+ +ADRN+ALAYYM+E GCFP  +NL+E LD YFQLCS+E NCES +VIA T ANGG+CP T + VLS EAVRDTLSLMHSCGMYDYSGQFAFKCGLP KSGVSG  LLVIPN+MGI LWSPPLDKQGNS R +QFC ELV KFNFH++DSL+   +K+DPR++ V+
Sbjct:   47 LKDRNRNRVSISRILSTIEGAGIQLTDPRLKECIRNIQNLQKRSIKSEDDAKNSFFLDKKTFTEVVRDNVIMLLTILQNDFVIPEFHEFTHHIKAIFENCRDNREGAPASYIPQLARFDPNYWAVSICTIDGQRFNCGDYHVPFCLQSTSKPLNYAIALTELGCDEVHKSVGYEPSGISFNSIALNDNKRPHNPMVNSGSIIICSLIRRMEHLADRFDYVMQEYKRMAGNEYLGFNNPTFLSERETADRNFALAYYMKENGCFPPGTNLKETLDFYFQLCSVEVNCESAAVIAGTLANGGICPLTGEPVLSPEAVRDTLSLMHSCGMYDYSGQFAFKCGLPAKSGVSGVILLVIPNLMGIALWSPPLDKQGNSCRGIQFCKELVAKFNFHNYDSLIYTQDKLDPRRAHVE 456          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1I8HW02 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 7.809e-173
Identity = 239/410 (58.29%), Postives = 302/410 (73.66%), Query Frame = 3
Query:  129 LIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRD--KFLSLLDNKEFAIINK--------ILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQ 1328
            L D N   V++  +   I  +GI  TD R++EC+  +       I + D  K    LD K F  + +        IL  D  IP F  FT HIK I+ +C  N+ G+ A+YIPQL+RF P+YW +S+CT+DGQR+N GD  V FCLQSTSKP+NYA+ALTE+G   +HK VGYEPSG SFN + LN+  +PHNPM+NSG+I+ICSLI++  +L +RFDY+ +++K++ GNE LGFNN  F+SE+ +ADRN+ALAYYM+E GCFP  +NL+E LD YFQLCS+E NCES +VIA T ANGG+CP T + VLS EAVRDTLSLMHSCGMYDYSGQFAFKCGLP KSGVSG  LLVIPN+MGI LWSPPLDKQGNS R +QFC ELV KFNFH++DSL+   +K+DPR++ V+
Sbjct:   43 LKDRNRNRVSISRILSTIEGAGIQLTDPRLKECIRNIQNLQKRSIKSEDDAKNSFFLDKKTFTEVVRDNVIMLLTILQNDFVIPEFHEFTHHIKAIFENCRDNREGAPASYIPQLARFDPNYWAVSICTIDGQRFNCGDYHVPFCLQSTSKPLNYAIALTELGCDEVHKSVGYEPSGISFNSIALNDNKRPHNPMVNSGSIIICSLIRRMEHLADRFDYVMQEYKRMAGNEYLGFNNPTFLSERETADRNFALAYYMKENGCFPPGTNLKETLDFYFQLCSVEVNCESAAVIAGTLANGGICPLTGEPVLSPEAVRDTLSLMHSCGMYDYSGQFAFKCGLPAKSGVSGVILLVIPNLMGIALWSPPLDKQGNSCRGIQFCKELVAKFNFHNYDSLIYTQDKLDPRRAHVE 452          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A267FSX9 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012334g4 PE=3 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.919e-172
Identity = 239/410 (58.29%), Postives = 302/410 (73.66%), Query Frame = 3
Query:  129 LIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRD--KFLSLLDNKEFAIINK--------ILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQ 1328
            L D N   V++  +   I  +GI  TD R++EC+  +       I + D  K    LD K F  + +        IL  D  IP F  FT HIK I+ +C  N+ G+ A+YIPQL+RF P+YW +S+CT+DGQR+N GD  V FCLQSTSKP+NYA+ALTE+G   +HK VGYEPSG SFN + LN+  +PHNPM+NSG+I+ICSLI++  +L +RFDY+ +++K++ GNE LGFNN  F+SE+ +ADRN+ALAYYM+E GCFP  +NL+E LD YFQLCS+E NCES +VIA T ANGG+CP T + VLS EAVRDTLSLMHSCGMYDYSGQFAFKCGLP KSGVSG  LLVIPN+MGI LWSPPLDKQGNS R +QFC ELV KFNFH++DSL+   +K+DPR++ V+
Sbjct:   87 LKDRNRNRVSISRILSTIEGAGIQLTDPRLKECIRNIQNLQKRSIKSEDDAKNSFFLDKKTFTEVVRDNVIMLLTILQNDFVIPEFHEFTHHIKAIFENCRDNREGAPASYIPQLARFDPNYWAVSICTIDGQRFNCGDYHVPFCLQSTSKPLNYAIALTELGCDEVHKSVGYEPSGISFNSIALNDNKRPHNPMVNSGSIIICSLIRRMEHLADRFDYVMQEYKRMAGNEYLGFNNPTFLSERETADRNFALAYYMKENGCFPPGTNLKETLDFYFQLCSVEVNCESAAVIAGTLANGGICPLTGEPVLSPEAVRDTLSLMHSCGMYDYSGQFAFKCGLPAKSGVSGVILLVIPNLMGIALWSPPLDKQGNSCRGIQFCKELVAKFNFHNYDSLIYTQDKLDPRRAHVE 496          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: gls2b (glutaminase kidney isoform, mitochondrial-like [Source:NCBI gene;Acc:103043219])

HSP 1 Score: 437.187 bits (1123), Expect = 1.518e-147
Identity = 206/406 (50.74%), Postives = 278/406 (68.47%), Query Frame = 3
Query:  126 YLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECM----HLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQD 1331
            Y I      V +     AI ++G+  +D R+R+CM      + E + + +M+R+ F   +      ++++       IP F+ F   I  +Y+     ++G VA YIP L++FSP  WG+SLCTVDGQR++ GDT V FCLQS  KP+ YA+A+ E G+ ++H++VG EPSG  FN L+L+ ++KPHNPM+N+GAI+I SLIK   N  E+FDY+    KK+ G E +GF+NA F SEK + DRNYA+ YY++E  CFP  +++ + LD YFQLCS+E  CES SV+AAT ANGG+CP T ++VLS+EAVR+TLSLMHSCGMYDYSGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLDK GNS R + FC ELV  FNFH++D+L     K DPR+   +D
Sbjct:   90 YTITEGEERVPISQFIAAIKSTGLLTSDPRLRDCMENLRQAVRESAGEAMMDRELFRKCVGGN-IVLLSQAFRKKFIIPEFEGFIGIINHMYDRAKQEEDGQVADYIPHLAKFSPDLWGVSLCTVDGQRHSAGDTKVPFCLQSCVKPLEYAVAVHEHGTEHVHRFVGKEPSGLKFNMLSLDEDDKPHNPMVNAGAIVISSLIKPGTNKAEKFDYVMDFVKKMAGLEYVGFSNATFQSEKETGDRNYAIGYYLKEKKCFPHGADMIDALDFYFQLCSIEVTCESSSVMAATLANGGICPITGERVLSAEAVRNTLSLMHSCGMYDYSGQFAFHVGLPAKSGVSGAVLLVVPNVMGVMCWSPPLDKVGNSMRGIWFCQELVSLFNFHNYDNLRHFVKKQDPRRQSGED 494          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: glsa (glutaminase kidney isoform, mitochondrial-like [Source:NCBI gene;Acc:103029175])

HSP 1 Score: 432.95 bits (1112), Expect = 7.104e-146
Identity = 200/383 (52.22%), Postives = 272/383 (71.02%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM +L   ++ +SD  ++R  F   + +    ++ +       IP+F+SFT HI ++Y +      G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H+++G EPSG  FN L L+ ++KPHNPM+N+GAI+  SLIKQ     E+FDY+    KK+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VL+ EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMGI  WSPPLDK GNS R ++FC +LVQ  NFH++D+L     K+DPR+
Sbjct:  114 ALKATGLRTGDPRLKECMEMLKVTLKTTSDGALDRHLFKKCVQS-NIVLLTQAFRRKFVIPDFQSFTSHIDDLYENARKLSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIKQGAGNAEKFDYVMNFMKKLAGNEYVGFSNATFQSERLSGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLNPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIKFCTDLVQLCNFHNYDNLRHFAKKLDPRR 495          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: glsb (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:103024252])

HSP 1 Score: 431.409 bits (1108), Expect = 7.402e-146
Identity = 198/383 (51.70%), Postives = 267/383 (69.71%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM +L   ++ +SD +M               ++ +       IP+F SF  HI ++Y+   +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H+++G EPSG  FN L L+ ++KPHNPM+N+GAI+  SLIKQ  +  E+FDY+     K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS E+VR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMGI  WSPPLDK GNS R +QFC +LV  FNFH++D+L     K+DPR+
Sbjct:  138 ALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFMSFAAHIDKLYDKAKNMSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIKQRASNAEKFDYVVNFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPESVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCQDLVSLFNFHNYDNLRHFAKKLDPRR 520          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: glsb (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:103024252])

HSP 1 Score: 431.795 bits (1109), Expect = 5.292e-145
Identity = 198/383 (51.70%), Postives = 267/383 (69.71%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM +L   ++ +SD +M               ++ +       IP+F SF  HI ++Y+   +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H+++G EPSG  FN L L+ ++KPHNPM+N+GAI+  SLIKQ  +  E+FDY+     K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS E+VR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMGI  WSPPLDK GNS R +QFC +LV  FNFH++D+L     K+DPR+
Sbjct:  138 ALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFMSFAAHIDKLYDKAKNMSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIKQRASNAEKFDYVVNFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPESVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCQDLVSLFNFHNYDNLRHFAKKLDPRR 520          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: glsb (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:103024252])

HSP 1 Score: 406.757 bits (1044), Expect = 5.713e-137
Identity = 187/362 (51.66%), Postives = 251/362 (69.34%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQ 1253
            A+  +G+   D R++ECM +L   ++ +SD +M               ++ +       IP+F SF  HI ++Y+   +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H+++G EPSG  FN L L+ ++KPHNPM+N+GAI+  SLIKQ  +  E+FDY+     K+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  ILD YFQLCS+E  CES SV+AAT ANGG CP T ++VLS E+VR+TLSLMHSCGMYD+SGQFAF  GLP KSGV+G  LLV+PNVMGI  WSPPLDK GNS R +QFC  + Q
Sbjct:  136 ALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFRKKFVIPDFMSFAAHIDKLYDKAKNMSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNAGAIVCTSLIKQRASNAEKFDYVVNFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPESVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCQGISQ 497          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000298.1 (pep scaffold:Pmarinus_7.0:GL477977:46927:53949:-1 gene:ENSPMAG00000000268.1 transcript:ENSPMAT00000000298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 1.622e-64
Identity = 96/147 (65.31%), Postives = 116/147 (78.91%), Query Frame = 3
Query:  873 EYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPR 1313
            E  CFP+ ++L   LD YFQLCS+E  CES SV+AAT ANGG+CPTT ++V+S EAVR+TLSLMHSCGMYD+SGQFAF+ GLP KSGVSG  LLV+PNVMG+  WSP LD+ GNS R +QFC ELV  FNFH++D+L     K+DPR
Sbjct:    3 EPQCFPEGTDLIGCLDFYFQLCSIEVTCESASVMAATLANGGICPTTGERVMSPEAVRNTLSLMHSCGMYDFSGQFAFQVGLPAKSGVSGGILLVVPNVMGVMCWSPALDRLGNSVRGIQFCQELVSVFNFHNYDNLRHFVKKLDPR 149          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008075.1 (pep scaffold:Pmarinus_7.0:GL476963:1479:10051:1 gene:ENSPMAG00000007302.1 transcript:ENSPMAT00000008075.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 3.775e-64
Identity = 95/145 (65.52%), Postives = 113/145 (77.93%), Query Frame = 3
Query:  882 CFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            CFP++++L   LDLYFQLCS+E  CES SV+AAT ANGG+CP T +++LS EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGV G  LLV+PNVMGI  WSPPLDK GNS R + F  ELV  FNFH++D L     K+DPR+
Sbjct:    1 CFPENTDLTATLDLYFQLCSIEVTCESGSVMAATLANGGICPITGERLLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVGGGILLVVPNVMGIMCWSPPLDKLGNSVRGIHFSQELVSMFNFHNYDDLRHFDKKLDPRR 145          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007363.1 (pep scaffold:Pmarinus_7.0:GL477086:74946:89445:1 gene:ENSPMAG00000006642.1 transcript:ENSPMAT00000007363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 6.097e-51
Identity = 80/185 (43.24%), Postives = 121/185 (65.41%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIK 722
            A+  +G+  +D R+++ M  L   V+ ++D ++               ++ +       IP+F++FT  +  I+ +      G VA YIPQL++FSP  WG+S+CTVDGQR++IGDT + FCLQS  KP+ Y++A+ E+G+ ++H+YVG EPSG  FN L+LN ENKPHNPM+N+GAI+I SLIK
Sbjct:   27 ALKATGLRTSDPRLKDSMDALRKTVQTAADGVVLDKMLFRKCMGSNIVLLTQAFRRKFVIPDFENFTAQMDRIHENARGLTWGKVADYIPQLAKFSPDLWGVSMCTVDGQRHSIGDTKIPFCLQSCVKPLKYSVAVNELGTQHVHRYVGKEPSGLRFNTLSLNEENKPHNPMVNAGAIVITSLIK 211          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005500.1 (pep scaffold:Pmarinus_7.0:GL479158:172776:186681:1 gene:ENSPMAG00000004995.1 transcript:ENSPMAT00000005500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 6.411e-20
Identity = 85/335 (25.37%), Postives = 151/335 (45.07%), Query Frame = 3
Query:  312 IINKILTGDLAIPNFKSFTDHIKEIYNHC---VHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRY-NIGDTTVNFCLQSTSKPINYALALTEIGSYNLH---KYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATF--ANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPC---KSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDS 1280
            ++ + L G LAIP F+SF   ++ I+  C    H+Q+   A         +   WGL++CTVDGQR  ++G + + F L   S+ +++ALA   +G+  LH   +  G   +G     L L       +P+ +SG++L+ +L++  L          +  + + G    G     F +E  + +R  A+ Y M++  CFP+ ++    ++L  QL  ++  CE  + +A              ++ +L+++AVR  L   H+ G+   S     K        KS V     +   NV+G    S    +  +S+R      E V+ F  H +DS
Sbjct:    9 LLLRALQGCLAIPRFRSFASTLERIFLQCRRETHDQSDQAAAE-------AVTGWGLAVCTVDGQRRLSLGASALPFRLGHVSRLLSHALASHALGAARLHARLEAAGQAGAGVDPEKLFLLCAGCSLSPLSDSGSLLVAALLQAALREQSPGRDALQLVRSLAGPCGGGVAGGRFSTEFDNPNRLQAVKYIMKDRQCFPERTDADSAMELLVQLSGVQVTCEWCACVAGCLAAGGAPPVAAGEESLLAADAVRSALCCTHAEGLGGLSADVHRKAAGGANANKSVVRRGSKITQANVLGKRAVSV---RCISSARGAVCAQEFVRTFALHPYDS 333          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000942.1 (pep scaffold:Pmarinus_7.0:GL476542:424728:430529:1 gene:ENSPMAG00000000857.1 transcript:ENSPMAT00000000942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 8.208e-14
Identity = 35/111 (31.53%), Postives = 60/111 (54.05%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQR 500
            A+  +G+  +D R+R+ M  L   V+ +S+ +    +      +    ++ +       IP+F++FT  +  I+ +      G VA YIPQL++FS   WG+S+CTVDGQR
Sbjct:   28 ALKATGLRPSDPRLRDSMTTLRKAVKTASEGVTLDKELFRRCVSSNIVLLTQAFRRKFVIPDFENFTAQVDNIHENARALTWGKVADYIPQLAKFSKDLWGVSICTVDGQR 138          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: GLS (glutaminase kidney isoform, mitochondrial-like [Source:NCBI gene;Acc:101161278])

HSP 1 Score: 438.728 bits (1127), Expect = 6.325e-148
Identity = 203/384 (52.86%), Postives = 279/384 (72.66%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSD-LIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM  L   +++++D + ++R  F   + +    ++ +       IP+F+SFT HI E+Y +  +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H ++G EPSG  FN L LN ++KPHNPM+N+GAI+  SL+KQ+++  ERFDY+    KK+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  +LDLYFQLCS+E  CES SV+AAT ANGG+CP T ++VL+ EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMGI  WSPPLDK GNS R +QFC++LV+ FNFH++D+L     K DPR+
Sbjct:  193 ALKATGLRTGDPRLKECMDTLKDTLKKTADGVTLDRHLFKKCVQSN-IVLLTQAFRKKFVIPDFQSFTSHIDELYENAKNLSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAVAVNDHGTQYVHSFIGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVCTSLLKQNVSNAERFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSVLDLYFQLCSIEVTCESASVMAATLANGGICPITGERVLTPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIVCWSPPLDKLGNSVRGIQFCLDLVELFNFHNYDNLRHFAKKHDPRR 575          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: GLS (glutaminase kidney isoform, mitochondrial-like [Source:NCBI gene;Acc:101161278])

HSP 1 Score: 439.113 bits (1128), Expect = 2.861e-147
Identity = 203/384 (52.86%), Postives = 279/384 (72.66%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLL---VEESSD-LIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+   D R++ECM  L   +++++D + ++R  F   + +    ++ +       IP+F+SFT HI E+Y +  +   G VA YIPQL++FSP  W +SLCTVDGQR+ +GDT V FCLQS  KP+ YA+A+ + G+  +H ++G EPSG  FN L LN ++KPHNPM+N+GAI+  SL+KQ+++  ERFDY+    KK+ GNE +GF+NA F SE+ S DRN+A+ YY++E  CFP+ +++  +LDLYFQLCS+E  CES SV+AAT ANGG+CP T ++VL+ EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG  LLV+PNVMGI  WSPPLDK GNS R +QFC++LV+ FNFH++D+L     K DPR+
Sbjct:  193 ALKATGLRTGDPRLKECMDTLKDTLKKTADGVTLDRHLFKKCVQSN-IVLLTQAFRKKFVIPDFQSFTSHIDELYENAKNLSGGQVADYIPQLAKFSPDLWAVSLCTVDGQRHTVGDTKVPFCLQSCVKPLKYAVAVNDHGTQYVHSFIGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVCTSLLKQNVSNAERFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSVLDLYFQLCSIEVTCESASVMAATLANGGICPITGERVLTPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIVCWSPPLDKLGNSVRGIQFCLDLVELFNFHNYDNLRHFAKKHDPRR 575          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: gls2a (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:101162292])

HSP 1 Score: 432.565 bits (1111), Expect = 6.214e-147
Identity = 199/384 (51.82%), Postives = 275/384 (71.61%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVEESSD----LIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+  +D R++  +H + + S D    +++++  F   + N    + N        IP+F+ FT  I +IY    H   G VA YIPQL++FSP  WG+SLCT+DGQR+++G+T V FC+QS  KP+ YA+A+ E+GS ++H++VG EPSG  FN L+LN E+KPHNPM+N+GAI+I SLIK + N  ERFD++    K + G E +GF+NA F SE+ + DRNYA+ YY++E  CFP+++++   LD YFQLCS+E  CES SV+AAT ANGG+CP T D+VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC +LV  F+FH++D+L   + K DPR+
Sbjct:   27 ALKKTGLQPSDPRLQHGIHQMRQSSHDSSGSVLIDKTLFRRCVGNNVMLLTNA-FRKHFIIPDFEQFTHQIDKIYESAKHQDGGQVADYIPQLAKFSPDLWGVSLCTIDGQRHSVGNTKVPFCMQSCVKPLEYAIAVHELGSEHVHRFVGKEPSGFKFNKLSLNEEDKPHNPMVNAGAIVISSLIKPNANKAERFDHVMEFLKSMVGAEYVGFSNATFQSERETGDRNYAIGYYLKEKKCFPENADMMAALDFYFQLCSIEVTCESGSVMAATLANGGICPITGDRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAVLLVVPNVMGMMCWSPPLDRLGNSVRGIHFCNDLVSYFSFHNYDNLRHFNKKHDPRR 409          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: gls2a (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:101162292])

HSP 1 Score: 432.95 bits (1112), Expect = 5.068e-146
Identity = 199/384 (51.82%), Postives = 275/384 (71.61%), Query Frame = 3
Query:  177 AIVNSGIPFTDFRIRECMHLLVEESSD----LIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            A+  +G+  +D R++  +H + + S D    +++++  F   + N    + N        IP+F+ FT  I +IY    H   G VA YIPQL++FSP  WG+SLCT+DGQR+++G+T V FC+QS  KP+ YA+A+ E+GS ++H++VG EPSG  FN L+LN E+KPHNPM+N+GAI+I SLIK + N  ERFD++    K + G E +GF+NA F SE+ + DRNYA+ YY++E  CFP+++++   LD YFQLCS+E  CES SV+AAT ANGG+CP T D+VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC +LV  F+FH++D+L   + K DPR+
Sbjct:   97 ALKKTGLQPSDPRLQHGIHQMRQSSHDSSGSVLIDKTLFRRCVGNNVMLLTNA-FRKHFIIPDFEQFTHQIDKIYESAKHQDGGQVADYIPQLAKFSPDLWGVSLCTIDGQRHSVGNTKVPFCMQSCVKPLEYAIAVHELGSEHVHRFVGKEPSGFKFNKLSLNEEDKPHNPMVNAGAIVISSLIKPNANKAERFDHVMEFLKSMVGAEYVGFSNATFQSERETGDRNYAIGYYLKEKKCFPENADMMAALDFYFQLCSIEVTCESGSVMAATLANGGICPITGDRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAVLLVVPNVMGMMCWSPPLDRLGNSVRGIHFCNDLVSYFSFHNYDNLRHFNKKHDPRR 479          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: gls2a (glutaminase kidney isoform, mitochondrial [Source:NCBI gene;Acc:101162292])

HSP 1 Score: 425.246 bits (1092), Expect = 1.013e-142
Identity = 189/324 (58.33%), Postives = 249/324 (76.85%), Query Frame = 3
Query:  345 IPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRK 1316
            IP+F+ FT  I +IY    H   G VA YIPQL++FSP  WG+SLCT+DGQR+++G+T V FC+QS  KP+ YA+A+ E+GS ++H++VG EPSG  FN L+LN E+KPHNPM+N+GAI+I SLIK + N  ERFD++    K + G E +GF+NA F SE+ + DRNYA+ YY++E  CFP+++++   LD YFQLCS+E  CES SV+AAT ANGG+CP T D+VLS+EAVR+TLSLMHSCGMYD+SGQFAF  GLP KSGVSG+ LLV+PNVMG+  WSPPLD+ GNS R + FC +LV  F+FH++D+L   + K DPR+
Sbjct:  186 IPDFEQFTHQIDKIYESAKHQDGGQVADYIPQLAKFSPDLWGVSLCTIDGQRHSVGNTKVPFCMQSCVKPLEYAIAVHELGSEHVHRFVGKEPSGFKFNKLSLNEEDKPHNPMVNAGAIVISSLIKPNANKAERFDHVMEFLKSMVGAEYVGFSNATFQSERETGDRNYAIGYYLKEKKCFPENADMMAALDFYFQLCSIEVTCESGSVMAATLANGGICPITGDRVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGAVLLVVPNVMGMMCWSPPLDRLGNSVRGIHFCNDLVSYFSFHNYDNLRHFNKKHDPRR 509          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000002648.1 (SMESG000002648.1)

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 418/422 (99.05%), Postives = 419/422 (99.29%), Query Frame = 3
Query:   69 RLKSSRLFSNSIISAKHKKYLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQDT 1334
            +   SRLFSNSIISAKHKKYLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQDT
Sbjct:    2 KFSKSRLFSNSIISAKHKKYLIDLNTPEVNLDDVRKAIVNSGIPFTDFRIRECMHLLVEESSDLIMNRDKFLSLLDNKEFAIINKILTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLSLCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPSGTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKKICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLYFQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCGMYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRALQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQDT 423          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLS5.913e-14951.12glutaminase [Source:HGNC Symbol;Acc:HGNC:4331][more]
GLS7.250e-14852.86glutaminase [Source:HGNC Symbol;Acc:HGNC:4331][more]
GLS28.225e-14349.88glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570][more]
GLS23.134e-8959.91glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570][more]
GLS23.134e-8959.91glutaminase 2 [Source:HGNC Symbol;Acc:HGNC:29570][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glna-12.598e-14351.37GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7][more]
glna-13.659e-14354.03GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7][more]
glna-14.211e-14351.63GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7][more]
glna-14.211e-14351.63GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7][more]
glna-15.352e-14351.37GLutamiNAse [Source:UniProtKB/TrEMBL;Acc:U4PRW7][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLS9.298e-15154.18gene:FBgn0261625 transcript:FBtr0302975[more]
GLS1.040e-15054.18gene:FBgn0261625 transcript:FBtr0302972[more]
GLS1.083e-15054.18gene:FBgn0261625 transcript:FBtr0302976[more]
GLS2.427e-15054.18gene:FBgn0261625 transcript:FBtr0302974[more]
GLS2.701e-15054.18gene:FBgn0261625 transcript:FBtr0344191[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glsa7.630e-15053.52glutaminase a [Source:ZFIN;Acc:ZDB-GENE-050204-3][more]
gls2b8.197e-14951.75glutaminase 2b (liver, mitochondrial) [Source:ZFIN... [more]
gls2a2.027e-14750.75glutaminase 2a (liver, mitochondrial) [Source:ZFIN... [more]
glsb2.928e-14752.48glutaminase b [Source:ZFIN;Acc:ZDB-GENE-030616-550... [more]
gls2b5.545e-14751.50glutaminase 2b (liver, mitochondrial) [Source:ZFIN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLS21.885e-15154.88glutaminase 2 [Source:NCBI gene;Acc:100492220][more]
GLS26.599e-15154.88glutaminase 2 [Source:NCBI gene;Acc:100492220][more]
GLS21.406e-15054.88glutaminase 2 [Source:NCBI gene;Acc:100492220][more]
spout14.106e-14852.74SPOUT domain containing methyltransferase 1 [Sourc... [more]
spout11.017e-14752.74SPOUT domain containing methyltransferase 1 [Sourc... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gls4.329e-15053.13glutaminase [Source:MGI Symbol;Acc:MGI:95752][more]
Gls6.372e-14953.13glutaminase [Source:MGI Symbol;Acc:MGI:95752][more]
Gls1.388e-14653.83glutaminase [Source:MGI Symbol;Acc:MGI:95752][more]
Gls22.898e-14148.63glutaminase 2 (liver, mitochondrial) [Source:MGI S... [more]
Gls6.751e-9759.82glutaminase [Source:MGI Symbol;Acc:MGI:95752][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13264|GLSK_RAT3.831e-14853.13Glutaminase kidney isoform, mitochondrial OS=Rattu... [more]
sp|D3Z7P3|GLSK_MOUSE4.457e-14853.13Glutaminase kidney isoform, mitochondrial OS=Mus m... [more]
sp|O94925|GLSK_HUMAN3.482e-14752.86Glutaminase kidney isoform, mitochondrial OS=Homo ... [more]
sp|Q9UI32|GLSL_HUMAN3.950e-14249.88Glutaminase liver isoform, mitochondrial OS=Homo s... [more]
sp|Q571F8|GLSL_MOUSE2.027e-14048.63Glutaminase liver isoform, mitochondrial OS=Mus mu... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B1Q3K10.000e+080.23Glutaminase OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
A0A1I8HV904.480e-17358.29ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FC934.634e-17358.29ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A1I8HW027.809e-17358.29ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FSX91.919e-17258.29ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gls2b1.518e-14750.74glutaminase kidney isoform, mitochondrial-like [So... [more]
glsa7.104e-14652.22glutaminase kidney isoform, mitochondrial-like [So... [more]
glsb7.402e-14651.70glutaminase kidney isoform, mitochondrial [Source:... [more]
glsb5.292e-14551.70glutaminase kidney isoform, mitochondrial [Source:... [more]
glsb5.713e-13751.66glutaminase kidney isoform, mitochondrial [Source:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000298.11.622e-6465.31pep scaffold:Pmarinus_7.0:GL477977:46927:53949:-1 ... [more]
ENSPMAT00000008075.13.775e-6465.52pep scaffold:Pmarinus_7.0:GL476963:1479:10051:1 ge... [more]
ENSPMAT00000007363.16.097e-5143.24pep scaffold:Pmarinus_7.0:GL477086:74946:89445:1 g... [more]
ENSPMAT00000005500.16.411e-2025.37pep scaffold:Pmarinus_7.0:GL479158:172776:186681:1... [more]
ENSPMAT00000000942.18.208e-1431.53pep scaffold:Pmarinus_7.0:GL476542:424728:430529:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLS6.325e-14852.86glutaminase kidney isoform, mitochondrial-like [So... [more]
GLS2.861e-14752.86glutaminase kidney isoform, mitochondrial-like [So... [more]
gls2a6.214e-14751.82glutaminase kidney isoform, mitochondrial [Source:... [more]
gls2a5.068e-14651.82glutaminase kidney isoform, mitochondrial [Source:... [more]
gls2a1.013e-14258.33glutaminase kidney isoform, mitochondrial [Source:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002648.10.000e+099.05SMESG000002648.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018238 ID=SMED30018238|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1550bp
TTCAATAGTGTTGATATTAATATGCAATGAAATTTTTAAATTTATTACAA
AACTTTAATATTATTTTCCGTTTAAAATCCAGCCGATTATTTTCCAATTC
AATCATATCTGCAAAACATAAAAAGTATTTAATAGACTTGAATACTCCAG
AAGTGAATCTAGATGATGTTAGAAAAGCTATTGTGAATTCTGGTATTCCT
TTTACTGATTTCCGAATCAGAGAATGTATGCATTTATTAGTGGAGGAATC
TTCCGATCTAATAATGAATCGTGACAAATTCCTTTCATTATTAGATAACA
AAGAATTCGCTATTATTAATAAAATTCTCACCGGAGACTTAGCGATTCCG
AATTTTAAAAGCTTCACAGATCATATCAAAGAGATATACAATCATTGTGT
GCACAATCAAAACGGCTCAGTTGCCACTTACATTCCCCAATTGTCGCGAT
TCAGTCCTCATTATTGGGGATTGTCGCTGTGTACAGTCGATGGACAGAGA
TATAACATTGGTGATACAACGGTCAATTTTTGCCTGCAGTCTACCAGCAA
ACCCATTAATTATGCTCTTGCATTGACCGAGATCGGGTCGTACAATCTCC
ACAAATATGTTGGCTATGAACCGTCGGGCACTTCTTTCAACCATCTCACA
TTGAACAATGAAAACAAACCTCACAACCCAATGATTAATTCCGGCGCTAT
TTTAATCTGTAGTCTCATAAAGCAGCACCTGAATTTGCCGGAAAGATTTG
ATTATATATTTCGGCAATTTAAGAAGATTTGCGGAAATGAAACGCTTGGA
TTTAATAATGCTGTATTTATGTCAGAAAAGTCATCAGCTGACAGAAACTA
TGCTCTGGCTTATTATATGAGGGAGTATGGTTGTTTCCCTAAAAGTTCTA
ATCTGCAAGAAATACTGGATCTATATTTCCAATTATGCTCATTAGAAGCA
AACTGTGAGTCAATGAGTGTTATTGCGGCTACTTTTGCAAATGGTGGATT
GTGCCCGACAACCGATGATAAAGTGCTCAGTTCTGAAGCTGTCAGGGATA
CTCTATCATTGATGCATTCATGTGGAATGTATGACTATTCGGGACAATTT
GCATTTAAGTGTGGCTTGCCATGCAAATCTGGAGTGTCGGGCAGCTGCTT
ACTGGTAATCCCTAATGTTATGGGAATTGGCTTATGGTCACCCCCGCTTG
ACAAACAAGGGAATTCATCTCGAGCTCTTCAGTTTTGCATGGAACTTGTG
CAAAAATTTAATTTCCATCATTTTGACAGTCTGCTGGATCACCACAATAA
AATTGATCCCCGCAAATCACTGGTTCAAGATACCTGATAACGAATTGAGA
AATTCTACTTAATTGAATGCTTATATTTGTTATAAACTACCCATTACCCC
CTTGAAACTTCCCAATTAAATGTTATTTTATATCAAATGAAATTAACATG
AAATTTTGACTCCAGCCAGGCCTTATTTTATGTCTATTATTTTAATATAA
TATTGAGTTTGTTTTCTACCTTATTGATAATCGCGTGCTTTATTTATTCA
back to top

protein sequence of SMED30018238-orf-1

>SMED30018238-orf-1 ID=SMED30018238-orf-1|Name=SMED30018238-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=437bp
MKFLNLLQNFNIIFRLKSSRLFSNSIISAKHKKYLIDLNTPEVNLDDVRK
AIVNSGIPFTDFRIRECMHLLVEESSDLIMNRDKFLSLLDNKEFAIINKI
LTGDLAIPNFKSFTDHIKEIYNHCVHNQNGSVATYIPQLSRFSPHYWGLS
LCTVDGQRYNIGDTTVNFCLQSTSKPINYALALTEIGSYNLHKYVGYEPS
GTSFNHLTLNNENKPHNPMINSGAILICSLIKQHLNLPERFDYIFRQFKK
ICGNETLGFNNAVFMSEKSSADRNYALAYYMREYGCFPKSSNLQEILDLY
FQLCSLEANCESMSVIAATFANGGLCPTTDDKVLSSEAVRDTLSLMHSCG
MYDYSGQFAFKCGLPCKSGVSGSCLLVIPNVMGIGLWSPPLDKQGNSSRA
LQFCMELVQKFNFHHFDSLLDHHNKIDPRKSLVQDT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012338Beta-lactam/transpept-like
IPR015868Glutaminase
Vocabulary: biological process
TermDefinition
GO:0006541glutamine metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004359glutaminase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015868GlutaminasePFAMPF04960Glutaminasecoord: 130..416
e-value: 1.9E-117
score: 391.5
IPR015868GlutaminaseTIGRFAMTIGR03814TIGR03814coord: 119..414
e-value: 4.2E-91
score: 303.1
IPR015868GlutaminasePANTHERPTHR12544GLUTAMINASEcoord: 50..434
IPR012338Beta-lactamase/transpeptidase-likeGENE3DG3DSA:3.40.710.10coord: 102..432
e-value: 1.6E-158
score: 528.8
IPR012338Beta-lactamase/transpeptidase-likeSUPERFAMILYSSF56601beta-lactamase/transpeptidase-likecoord: 110..417