Bromodomain adjacent to zinc finger domain

Overview
NameBromodomain adjacent to zinc finger domain
Smed IDSMED30018236
Length (bp)5923
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bromodomain adjacent to zinc finger domain (SMED30018236) t-SNE clustered cells

Violin plots show distribution of expression levels for Bromodomain adjacent to zinc finger domain (SMED30018236) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bromodomain adjacent to zinc finger domain (SMED30018236) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bromodomain adjacent to zinc finger domain (SMED30018236) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018236

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018236SMESG000068165.1 Contig48575newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018236SMESG000068165.1 Contig48575uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018236SMESG000068165.1 Contig14060newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018236SMESG000068165.1 Contig14060uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30018236SMESG000068165.1 OX_Smed_1.0.04505ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30018236SMESG000068165.1 dd_Smed_v4_7394_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Match: BAZ2B (bromodomain adjacent to zinc finger domain 2B [Source:HGNC Symbol;Acc:HGNC:963])

HSP 1 Score: 137.502 bits (345), Expect = 1.809e-31
Identity = 77/223 (34.53%), Postives = 131/223 (58.74%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            + K EQ+ +E  ++KELKKP ED+ L + + LP    I G  LS S F+ CL+V +FL +F  VLG D++  +P +   Q   +N   +S+  +  LL+ LL  AVCDPG+         +G     + VN + +S +L+ F+ A     ++E+   L    ++  +  ++A +L F+INE+  S+ + SE+DK ++  S +RRDKW+++GKLR+L++  ++K
Sbjct: 1043 ERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIG-DSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHC--GQTELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHAKK 1262          

HSP 2 Score: 124.79 bits (312), Expect = 1.436e-27
Identity = 51/94 (54.26%), Postives = 67/94 (71.28%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            P L  WR+++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IP+G WFC  C++KA+ Q L
Sbjct: 1894 PGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTL 1987          

HSP 3 Score: 86.6557 bits (213), Expect = 4.588e-16
Identity = 53/98 (54.08%), Postives = 66/98 (67.35%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSK 5763
            C   L E+      +PFL PV++K VP YKKVIK PMDFST+  KLS   Y +   F  D+RL+F+NCE FNEDDSDIG+AGH +R +FEK W  + K
Sbjct: 2069 CSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFK 2166          

HSP 4 Score: 69.707 bits (169), Expect = 7.186e-11
Identity = 56/178 (31.46%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDL-KLEIKNELTACHANVSENG 3405
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L    H LR +  GQDRY R +++L   GGIF+E     +E     + I K     + EKL K E+ +  +++ + S      SN +    +K DLK +     D+ N+F Q +P    K SK  ++ K+  ++E+     N   NG
Sbjct: 1334 DEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVE----GMESGEGLEEIAK-----EREKLKKAESVQIKEEMFETSGDSLNCSN-TDHCEQKEDLKEK-----DNTNLFLQ-KPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANG 1495          

HSP 5 Score: 58.5362 bits (140), Expect = 1.605e-7
Identity = 30/89 (33.71%), Postives = 54/89 (60.67%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSLN-ELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLI 1827
            PL+ GW+RET +++    L G+V Y  P G K+   P++ + +SR  I ++S +NFSF   +++GD+ + + D   G +   ++E D+I
Sbjct:  748 PLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKLRQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYE-ARDGPQGMQWCLLKEEDVI 835          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Match: BAZ2B (bromodomain adjacent to zinc finger domain 2B [Source:HGNC Symbol;Acc:HGNC:963])

HSP 1 Score: 137.117 bits (344), Expect = 2.127e-31
Identity = 77/221 (34.84%), Postives = 130/221 (58.82%), Query Frame = 1
Query: 2020 KKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            K EQ+ +E  ++KELKKP ED+ L + + LP    I G  LS S F+ CL+V +FL +F  VLG D++  +P +   Q   +N   +S+  +  LL+ LL  AVCDPG+         +G     + VN + +S +L+ F+ A     ++E+   L    ++  +  ++A +L F+INE+  S+ + SE+DK ++  S +RRDKW+++GKLR+L++  ++K
Sbjct: 1009 KLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIG-DSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHC--GQTELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHAKK 1226          

HSP 2 Score: 124.405 bits (311), Expect = 1.748e-27
Identity = 51/94 (54.26%), Postives = 67/94 (71.28%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            P L  WR+++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IP+G WFC  C++KA+ Q L
Sbjct: 1858 PGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTL 1951          

HSP 3 Score: 86.6557 bits (213), Expect = 4.611e-16
Identity = 53/98 (54.08%), Postives = 66/98 (67.35%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSK 5763
            C   L E+      +PFL PV++K VP YKKVIK PMDFST+  KLS   Y +   F  D+RL+F+NCE FNEDDSDIG+AGH +R +FEK W  + K
Sbjct: 2033 CSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFK 2130          

HSP 4 Score: 69.707 bits (169), Expect = 7.666e-11
Identity = 56/178 (31.46%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDL-KLEIKNELTACHANVSENG 3405
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L    H LR +  GQDRY R +++L   GGIF+E     +E     + I K     + EKL K E+ +  +++ + S      SN +    +K DLK +     D+ N+F Q +P    K SK  ++ K+  ++E+     N   NG
Sbjct: 1298 DEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVE----GMESGEGLEEIAK-----EREKLKKAESVQIKEEMFETSGDSLNCSN-TDHCEQKEDLKEK-----DNTNLFLQ-KPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANG 1459          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:HGNC Symbol;Acc:HGNC:962])

HSP 1 Score: 134.035 bits (336), Expect = 1.845e-30
Identity = 81/235 (34.47%), Postives = 135/235 (57.45%), Query Frame = 1
Query: 1987 KPSIKTDKY---KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            KP+ K DK    + + E++  +  I +E+KKP ED+ L + Q LP F  + G  L   AF+ CL + EFL+SF  VLG D    +P++   Q   + +  +SL  +  LL+ LLK A+ DPG  +     +++G K SE+ +  + +S +LR F++A  V  E  +   L    ++     ++A +L F+++E+  S LI +E+DK LE  S  R++KWI++G+LRRLK   +++
Sbjct:  762 KPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQG-DSLGEVQDLLVRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGV--EPALCDRLRTQPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAKR 993          

HSP 2 Score: 99.3673 bits (246), Expect = 7.155e-20
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  C+  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+++  + +     G PK  +
Sbjct: 1609 PRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQ 1713          

HSP 3 Score: 85.5001 bits (210), Expect = 9.877e-16
Identity = 44/93 (47.31%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y+++IK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1772 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRW 1864          

HSP 4 Score: 60.077 bits (144), Expect = 5.362e-8
Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 1
Query: 2872 GEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILK 3120
            GE D TASS  + +LE++IE+L+ + L  +  L      LR + LGQDRY R +++L +L GIF+E      E ++ P+ ++K
Sbjct: 1044 GEVDATASS--IPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVE----GTEGNLVPEEVIK 1120          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:HGNC Symbol;Acc:HGNC:962])

HSP 1 Score: 134.035 bits (336), Expect = 1.873e-30
Identity = 81/235 (34.47%), Postives = 135/235 (57.45%), Query Frame = 1
Query: 1987 KPSIKTDKY---KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            KP+ K DK    + + E++  +  I +E+KKP ED+ L + Q LP F  + G  L   AF+ CL + EFL+SF  VLG D    +P++   Q   + +  +SL  +  LL+ LLK A+ DPG  +     +++G K SE+ +  + +S +LR F++A  V  E  +   L    ++     ++A +L F+++E+  S LI +E+DK LE  S  R++KWI++G+LRRLK   +++
Sbjct:  790 KPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQG-DSLGEVQDLLVRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGV--EPALCDRLRTQPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAKR 1021          

HSP 2 Score: 99.3673 bits (246), Expect = 6.662e-20
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  C+  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+++  + +     G PK  +
Sbjct: 1637 PRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQ 1741          

HSP 3 Score: 85.5001 bits (210), Expect = 1.069e-15
Identity = 44/93 (47.31%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y+++IK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1800 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRW 1892          

HSP 4 Score: 60.4622 bits (145), Expect = 4.858e-8
Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 1
Query: 2872 GEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILK 3120
            GE D TASS  + +LE++IE+L+ + L  +  L      LR + LGQDRY R +++L +L GIF+E      E ++ P+ ++K
Sbjct: 1072 GEVDATASS--IPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVE----GTEGNLVPEEVIK 1148          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:HGNC Symbol;Acc:HGNC:962])

HSP 1 Score: 134.035 bits (336), Expect = 1.874e-30
Identity = 81/235 (34.47%), Postives = 135/235 (57.45%), Query Frame = 1
Query: 1987 KPSIKTDKY---KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            KP+ K DK    + + E++  +  I +E+KKP ED+ L + Q LP F  + G  L   AF+ CL + EFL+SF  VLG D    +P++   Q   + +  +SL  +  LL+ LLK A+ DPG  +     +++G K SE+ +  + +S +LR F++A  V  E  +   L    ++     ++A +L F+++E+  S LI +E+DK LE  S  R++KWI++G+LRRLK   +++
Sbjct:  792 KPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQG-DSLGEVQDLLVRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGV--EPALCDRLRTQPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAKR 1023          

HSP 2 Score: 99.3673 bits (246), Expect = 6.608e-20
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  C+  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+++  + +     G PK  +
Sbjct: 1639 PRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQ 1743          

HSP 3 Score: 85.5001 bits (210), Expect = 1.070e-15
Identity = 44/93 (47.31%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y+++IK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1802 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRW 1894          

HSP 4 Score: 60.4622 bits (145), Expect = 4.777e-8
Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 1
Query: 2872 GEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILK 3120
            GE D TASS  + +LE++IE+L+ + L  +  L      LR + LGQDRY R +++L +L GIF+E      E ++ P+ ++K
Sbjct: 1074 GEVDATASS--IPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVE----GTEGNLVPEEVIK 1150          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Match: baz-2 (Bromodomain Adjacent to Zinc finger domain, 2A/2B, homolog [Source:UniProtKB/TrEMBL;Acc:Q23590])

HSP 1 Score: 120.553 bits (301), Expect = 9.098e-27
Identity = 131/521 (25.14%), Postives = 237/521 (45.49%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSLNE--LVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKID--GKPLKPSIKTDKYKHKKEQKLIEAHISKELK---KPVEDLRLLN---SQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWS---------GEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            PL+ GW+R+T ++S+    + GDV Y  P G K++   ++   +++  I  ++ +NF F   L +G+++ P             E  +    +      ED+I     +   L+     Q+ S SN  ++      KI+   +PL PS   D++  +     I ++   E K   +  +DL L+N    + LP F  I    LS   F   L+V EF+ +F  VLGIDL+  P ++    A ++ D         L  +LL+ A+  PG+ N K   Q  G    E+ ++    S V+R F++ +    E E+   L+   +  +S +++A +L F+ +E++ SR + +E+DK L++ S ++ +KW+ +GK R L+  +S+K          N   +       ++ +DS+    PD           + SV         Q  ++          E++E+ S   +D L   + +    + QK +D      K+R    G DR+HRN+++L H   + IE
Sbjct:  332 PLQLGWRRQTCVRSIASAGVKGDVSYFAPCGKKLSTYSEVVRYLTKNSIHYITRDNFLFNTKLVIGEFIVPK----------QTEADETQQEREFAMFTEDDINKELTRLNVLKFVPKIQA-STSNGVHEDDIKMSKIEEPDEPLDPSELNDEFTEELVHSQIMSNGVDECKIREREADDL-LVNINDVRHLPDFSRIGNQCLSSQGFADALMVHEFVQNFGHVLGIDLEIAPKLESL-CAGLDGDANHAEQTLQLTRQLLRLALEFPGMGNEKRFGQGGG----EMGLDRENFSEVMRLFLIDKGKRGE-ELSQPLLTCNFLSISPEQKASILAFLCDELVCSRNVVTEIDKNLDEISRLKGEKWMREGKARALRSARSKK---------KNDEKVVVVKEEQNHESDSEPPTRPDTPKKATVAPPTVVSVSPVSAAQQQQRKFTPGLGQCEVLTEQEESMSLQQMDSLIGDLHQEAQNINQKIHDTGL---KIRSFPFGTDRFHRNYWMLAHTDKVIIE 822          

HSP 2 Score: 97.4413 bits (241), Expect = 8.650e-20
Identity = 45/136 (33.09%), Postives = 72/136 (52.94%), Query Frame = 1
Query: 4588 DWRKSI-LEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAK--PTMTRVPRKWTCHNC 4986
            DW+  +  EA    QL+  ++TL   I W++S  + LCQIC K  +  ++L+CD C+ G H  CFRP ++ +PEG WFC  C  + + + +C  C + +T     C  C   +H  C++  P     P  + C +C
Sbjct: 1066 DWKSYVSTEAQTTSQLMVALQTLEGMIMWERSSREALCQIC-KSMDGDEMLVCDGCESGCHMECFRPRMTKVPEGDWFCQRCREEKSGRPMCMFCSR-ETGNLHQCQRCAYHVHQECSQDGPKEAINPETFICGHC 1199          

HSP 3 Score: 69.707 bits (169), Expect = 2.563e-11
Identity = 47/118 (39.83%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 5398 IKTLLTNHSSVPSNSTLSET-EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +K  L     VPS   L +    E C+  L E++      PFL PV+ K VP YK +I  PMD  T+ +K    +Y++  +F  D+ L+F NC QFN D S+IG+AG +L  FF+K W
Sbjct: 1257 VKGNLKRKLEVPSIGGLPKNMNKELCQLMLDELVVQANALPFLEPVNPKLVPGYKMIISKPMDLKTIRQKNEKLIYETPEDFAEDIELMFANCRQFNIDHSEIGRAGISLHKFFQKRW 1374          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 67.0106 bits (162), Expect = 1.889e-10
Identity = 34/110 (30.91%), Postives = 51/110 (46.36%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKA----------TDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRK--WTCHNCS 4989
            C+ C++D    +LLLCD+C + YHT C    +   PEG W C  C+              + + C +C +  T    +C  C    HA C  P +T VP++  W+C  C 
Sbjct:  259 CEECKQD---GELLLCDTCPRAYHTVCIDENMEEPPEGDWSCAHCIEHGPEVVKEEPAKQNDEFCKICKE--TENLLLCDSCVCSFHAYCIDPPLTEVPKEETWSCPRCE 363          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 65.855 bits (159), Expect = 3.448e-10
Identity = 33/110 (30.00%), Postives = 48/110 (43.64%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRM------------LHAICAKPTMTRVPR-KWTCHNC 4986
            C++C +D    +L+LCD+C + YH  C    +   PEG W C  C     D  +  V  +P  A    C +CK               HA C  P +T +P  +W+C  C
Sbjct:  268 CEVCNQD---GELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHCEEHGPD--VLIVEEEPAKANMDYCRICKETSNILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRC 372          

HSP 2 Score: 60.077 bits (144), Expect = 1.927e-8
Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            C+IC++  N   +LLCD+C   YH YC  PPL+ IPEG+W C  C+     Q++
Sbjct:  331 CRICKETSN---ILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRCIIPEPAQRI 381          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 60.8474 bits (146), Expect = 1.462e-8
Identity = 36/104 (34.62%), Postives = 44/104 (42.31%), Query Frame = 1
Query: 4693 LCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCH------DCVSKA------TDQKLCYVCGQ----PKTART-------TVCMVCKRMLHAIC 4935
            +C+ C    +EA LLLCD CD  YH YC +P L  IP+G W C        C  KA      T Q LC+ C      P+  R          C  C +  H  C
Sbjct:  479 VCEGCGTGGDEANLLLCDECDVSYHIYCMKPLLDKIPQGPWRCQWCSRCRRCNHKAASGNDLTSQGLCFPCASLRKCPRCERNYQLNEKLIRCSQCSKWQHGAC 582          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Match: athp-2 (AT Hook plus PHD finger transcription factor [Source:UniProtKB/TrEMBL;Acc:Q9N5L9])

HSP 1 Score: 54.6842 bits (130), Expect = 1.038e-6
Identity = 27/92 (29.35%), Postives = 45/92 (48.91%), Query Frame = 1
Query: 4558 NSSVTPPEL-ADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC 4830
            + ++ P EL   W++++LE  +   L   + T   +I WDKS ++  C+ CR+      L+LC  CD  YH  C +  ++      W C  C
Sbjct: 1068 HGNLKPSELFIRWQRALLECESHSALSLFISTFEGSIKWDKSRLQGKCRSCRRKAAAHDLVLCSECDNCYHLKCAKLDVNSDAPADWMCTSC 1159          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0088091)

HSP 1 Score: 153.295 bits (386), Expect = 1.520e-36
Identity = 65/145 (44.83%), Postives = 89/145 (61.38%), Query Frame = 1
Query: 4573 PPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPK---TARTTVCMVCKRMLHAICAKPTMTRVPR-KWTCHNCSGR 4995
            P  L  WR ++  ++   QL   +  L + +AWDKSIMK  CQ C    NE +LLLCD CD+GYHTYCF+P +  IP+G W+C++CV+KAT+++ C VCG  +     +   C +C R  HA C  P + +VPR KW CH C  R
Sbjct: 2468 PKGLVQWRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKANCQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISR 2612          

HSP 2 Score: 91.6633 bits (226), Expect = 7.049e-18
Identity = 62/263 (23.57%), Postives = 121/263 (46.01%), Query Frame = 1
Query: 2041 EAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQ---DYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEM------------------------------------------EAWLINTEYKD-----LSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            +A I + +++P ED  +     +P  + I GN+L   A    L+V EFL++F + LG D++++P++Q   D  M+  N D E    +  ++  LL  A+ DPG+ N    T ++G      ++  + +S +LR ++ A A G   +M                                          + W ++   KD     L+  ++A++L  + N++L ++ +  ++D  LE  + +R++K++ D K+R+ K    RK
Sbjct: 1219 DAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAE--EELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHHQLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLMNKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRK 1479          

HSP 3 Score: 89.7373 bits (221), Expect = 3.200e-17
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            E   C+  L E+      +PFL PV+ K+ P Y+K+IKTPMD ST+ +KL D  YK+  +F  D+R IF+NCE FNEDDS +GKAGH +R FFE  W
Sbjct: 2895 ELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRW 2991          

HSP 4 Score: 51.9878 bits (123), Expect = 8.918e-6
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPI 3216
            EEDE  +  S D+L+K+++++    L  K  L +  ++LR    GQDR+ R ++ L   GGIFIE   S+     D    L+A++  ++    K EN E+ KDV   S S QP+
Sbjct: 1663 EEDED-NRLSADELQKKLDKIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDANDEK-ENSENEKDVAAES-SEQPM 1773          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0333071)

HSP 1 Score: 124.02 bits (310), Expect = 1.247e-27
Identity = 53/118 (44.92%), Postives = 73/118 (61.86%), Query Frame = 1
Query: 4654 TNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPK---TARTTVCMVCKRMLHAICAKPTMTRVPR-KWTCHNCSGR 4995
            TN+  +  S+    CQ C    NE +LLLCD CD+GYHTYCF+P +  IP+G W+C++CV+KAT+++ C VCG  +     +   C +C R  HA C  P + +VPR KW CH C  R
Sbjct: 2592 TNSSKYSNSLQN--CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISR 2707          

HSP 2 Score: 109.768 bits (273), Expect = 2.494e-23
Identity = 108/492 (21.95%), Postives = 207/492 (42.07%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL---NELVGDVIYETPSGT---KVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLK---PSFDHILGFEKLSIEEV-----DLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFS----------------NRSNKLLNNHKKID----GKPLKPSIKTDKYKHKKEQKLI------------------------------------EAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQ---DYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEM------------------------------------------EAWLINTEYKD-----LSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            PL+ GWKRET ++ L    ++ G+V Y  P  T   K NG  Q+  ++ ++  SN+S ENFSF     +G +L+   P + +   + +++ E+V     DL        N+E  I ++  Q Q ++     Q    +                 R +K L N + ++     K +  + + ++ + ++   LI                                    +A I + +++P ED  +     +P  + I GN+L   A    L+V EFL++F + LG D++++P++Q   D  M+  N D E    +  ++  LL  A+ DPG+ N    T ++G      ++  + +S +LR ++ A A G   +M                                          + W ++   KD     L+  ++A++L  + N++L ++ +  ++D  LE  + +R++K++ D K+R+ K    RK
Sbjct:  957 PLELGWKRETVIRGLTKQGQIRGEVTYYAPGSTTPLKSNG--QVFAILEQQP-SNLSRENFSFSARAIVGSFLQPAPPPYANDGEYIRMTDEDVAKRLEDLKVFTRQTLNVEQRIEIAKQQ-QAMRDAKKLQKEELARNKEKARQEKNSKLEQQRKDKELKNQQAVEELQKQKEMLLAAEMERERRRQHMSLIRMLELRRKFEDREKKKHQLVLDRLLLRERRMAERKRDAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAE--EELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHHQLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLMNKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRK 1442          

HSP 3 Score: 89.3521 bits (220), Expect = 4.241e-17
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            E   C+  L E+      +PFL PV+ K+ P Y+K+IKTPMD ST+ +KL D  YK+  +F  D+R IF+NCE FNEDDS +GKAGH +R FFE  W
Sbjct: 2990 ELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRW 3086          

HSP 4 Score: 56.6102 bits (135), Expect = 3.676e-7
Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 1
Query: 4726 AQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQK 4854
             +++ CD C + YH  C+ PPL  +P G+W+CH C+S+A   K
Sbjct: 2670 GKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPK 2712          

HSP 5 Score: 53.5286 bits (127), Expect = 3.236e-6
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPI 3216
            EEDE  +  S D+L+K+++++    L  K  L +  ++LR    GQDR+ R ++ L   GGIFIE   S+     D    L+A++  ++    K EN E+ KDV   S S QP+
Sbjct: 1626 EEDED-NRLSADELQKKLDKIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDANDEK-ENSENEKDVAAES-SEQPM 1736          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0113066)

HSP 1 Score: 124.02 bits (310), Expect = 1.337e-27
Identity = 53/118 (44.92%), Postives = 73/118 (61.86%), Query Frame = 1
Query: 4654 TNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPK---TARTTVCMVCKRMLHAICAKPTMTRVPR-KWTCHNCSGR 4995
            TN+  +  S+    CQ C    NE +LLLCD CD+GYHTYCF+P +  IP+G W+C++CV+KAT+++ C VCG  +     +   C +C R  HA C  P + +VPR KW CH C  R
Sbjct: 2629 TNSSKYSNSLQN--CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISR 2744          

HSP 2 Score: 91.6633 bits (226), Expect = 7.525e-18
Identity = 62/263 (23.57%), Postives = 121/263 (46.01%), Query Frame = 1
Query: 2041 EAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQ---DYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEM------------------------------------------EAWLINTEYKD-----LSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            +A I + +++P ED  +     +P  + I GN+L   A    L+V EFL++F + LG D++++P++Q   D  M+  N D E    +  ++  LL  A+ DPG+ N    T ++G      ++  + +S +LR ++ A A G   +M                                          + W ++   KD     L+  ++A++L  + N++L ++ +  ++D  LE  + +R++K++ D K+R+ K    RK
Sbjct: 1219 DAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAE--EELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHHQLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLMNKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRK 1479          

HSP 3 Score: 89.3521 bits (220), Expect = 4.468e-17
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            E   C+  L E+      +PFL PV+ K+ P Y+K+IKTPMD ST+ +KL D  YK+  +F  D+R IF+NCE FNEDDS +GKAGH +R FFE  W
Sbjct: 3027 ELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRW 3123          

HSP 4 Score: 56.6102 bits (135), Expect = 3.648e-7
Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 1
Query: 4726 AQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQK 4854
             +++ CD C + YH  C+ PPL  +P G+W+CH C+S+A   K
Sbjct: 2707 GKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPK 2749          

HSP 5 Score: 51.9878 bits (123), Expect = 9.329e-6
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPI 3216
            EEDE  +  S D+L+K+++++    L  K  L +  ++LR    GQDR+ R ++ L   GGIFIE   S+     D    L+A++  ++    K EN E+ KDV   S S QP+
Sbjct: 1663 EEDED-NRLSADELQKKLDKIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDANDEK-ENSENEKDVAAES-SEQPM 1773          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0333070)

HSP 1 Score: 124.02 bits (310), Expect = 1.364e-27
Identity = 53/118 (44.92%), Postives = 73/118 (61.86%), Query Frame = 1
Query: 4654 TNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPK---TARTTVCMVCKRMLHAICAKPTMTRVPR-KWTCHNCSGR 4995
            TN+  +  S+    CQ C    NE +LLLCD CD+GYHTYCF+P +  IP+G W+C++CV+KAT+++ C VCG  +     +   C +C R  HA C  P + +VPR KW CH C  R
Sbjct: 2556 TNSSKYSNSLQN--CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISR 2671          

HSP 2 Score: 92.8189 bits (229), Expect = 3.291e-18
Identity = 62/263 (23.57%), Postives = 121/263 (46.01%), Query Frame = 1
Query: 2041 EAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQ---DYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEM------------------------------------------EAWLINTEYKD-----LSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            +A I + +++P ED  +     +P  + I GN+L   A    L+V EFL++F + LG D++++P++Q   D  M+  N D E    +  ++  LL  A+ DPG+ N    T ++G      ++  + +S +LR ++ A A G   +M                                          + W ++   KD     L+  ++A++L  + N++L ++ +  ++D  LE  + +R++K++ D K+R+ K    RK
Sbjct: 1146 DAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADLLMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAE--EELLSVMTHLLVCAIEDPGVPNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHHQLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLMNKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRK 1406          

HSP 3 Score: 88.9669 bits (219), Expect = 4.803e-17
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            E   C+  L E+      +PFL PV+ K+ P Y+K+IKTPMD ST+ +KL D  YK+  +F  D+R IF+NCE FNEDDS +GKAGH +R FFE  W
Sbjct: 2954 ELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRW 3050          

HSP 4 Score: 56.6102 bits (135), Expect = 3.703e-7
Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 1
Query: 4726 AQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQK 4854
             +++ CD C + YH  C+ PPL  +P G+W+CH C+S+A   K
Sbjct: 2634 GKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPK 2676          

HSP 5 Score: 53.5286 bits (127), Expect = 3.048e-6
Identity = 40/114 (35.09%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPI 3216
            EEDE  +  S D+L+K+++++    L  K  L +  ++LR    GQDR+ R ++ L   GGIFIE   S+     D    L+A++  ++    K EN E+ KDV   S S QP+
Sbjct: 1590 EEDED-NRLSADELQKKLDKIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHEALEAMDDKKDANDEK-ENSENEKDVAAES-SEQPM 1700          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Match: tou (gene:FBgn0033636 transcript:FBtr0088094)

HSP 1 Score: 89.7373 bits (221), Expect = 3.882e-19
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            E   C+  L E+      +PFL PV+ K+ P Y+K+IKTPMD ST+ +KL D  YK+  +F  D+R IF+NCE FNEDDS +GKAGH +R FFE  W
Sbjct:  145 ELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYRKIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFESRW 241          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Match: baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:ZFIN;Acc:ZDB-GENE-041010-202])

HSP 1 Score: 153.68 bits (387), Expect = 1.489e-36
Identity = 115/386 (29.79%), Postives = 199/386 (51.55%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGI----DLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAP---SSLEMSI--DPDYILKAINQSQNE 3144
            + KK+Q L+E     E+KKP ED+ L +   LP    I G KLS  AF++CL V EFL+ +  +LG+    D+ ++ T+Q+  +       E L     LL++L++ A+ DPG+ +     +++G K  +LE+N +T+S VLR F+ A   G E E+   L    ++ L  D +A +L FV+ E+  S +++ E+D  LE  +  R++KWI++GKLR+LK    RK     G     +        +   + + + I +  C +         +                  E E+ ++ S+ +LE++I++LT + +  +  L Q  H +R + LGQDRY R + LL ++G I +E A    +S E+++  +P   +K I  ++ E
Sbjct: 1348 ERKKQQMLLE-----EMKKPAEDMCLPDHTPLPPLTRIPGLKLSGLAFSNCLRVVEFLHGYGKILGLQVPKDIPSLITLQEGLLGMEKSQGELLD----LLIKLVESALHDPGLPSYYQSVKILGEKLVDLELNHSTVSEVLRVFLEAH--GFEMEVCNSLRTKSFQTLKPDVKASILAFVVEELNASNIVTREIDNTLENMATYRKNKWIIEGKLRKLKAALVRK----TGRPEEELVFEERRRSARVGVAEEESI-EESCVLERGSRRKAKEEPKHT-------------EIESPNTCSVAELERQIDKLTKRQVFFRKKLQQSSHSMRAVSLGQDRYRRRYLLLPYMGCILVEGAEDILASGEVTVTDEPVTYVKVITPAKAE 1704          

HSP 2 Score: 95.1301 bits (235), Expect = 8.880e-19
Identity = 45/100 (45.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query: 4552 SVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQ 4851
            S+ S +TP  L  WR+ +    +  QL  C+  L  AIAW++SI+KV CQ+CRK  ++  LLLCD CD+G H +C RP +  +P+G WFC +CV+K T +
Sbjct: 2189 SLESEITP-RLRTWRQGLDRCRSSSQLSLCLLQLEKAIAWERSIIKVTCQVCRKGDDDEYLLLCDGCDRGCHMFCLRPKVLQVPDGDWFCPNCVAKKTGE 2287          

HSP 3 Score: 82.0333 bits (201), Expect = 7.943e-15
Identity = 46/103 (44.66%), Postives = 67/103 (65.05%), Query Frame = 1
Query: 5440 STLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +T ++ +   C   L+E+   +  +PFL PV+ + VP Y+++IK PMDF T+  +L    Y S  EF  D +L+FNNCE FNED S++G+AGHA+R FFE  W
Sbjct: 2349 TTRNQPDLTYCEIILMEMEAHSDAWPFLEPVNPRMVPGYRRIIKNPMDFLTMRERLLQGGYCSCEEFAADAQLVFNNCELFNEDTSEVGQAGHAMRRFFESRW 2451          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Match: baz2ba (bromodomain adjacent to zinc finger domain, 2Ba [Source:ZFIN;Acc:ZDB-GENE-070615-37])

HSP 1 Score: 121.324 bits (303), Expect = 2.872e-28
Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQ 4851
            P +  WRK++ E  +  QL  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC +P ++ IPEG W+C DC+SKA+ Q
Sbjct:  159 PGMKLWRKALSEVRSSSQLAMCLQQLQKSIAWEKSIMKVYCQICRKGDNEDLLLLCDGCDKGCHTYCHKPKITTIPEGDWYCPDCISKASGQ 250          

HSP 2 Score: 88.5817 bits (218), Expect = 1.655e-17
Identity = 50/93 (53.76%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+KVIK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct:  345 CRILLAELERHQDAWPFLNPVNLKSVPGYRKVIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 437          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Match: baz2ba (bromodomain adjacent to zinc finger domain, 2Ba [Source:ZFIN;Acc:ZDB-GENE-070615-37])

HSP 1 Score: 121.324 bits (303), Expect = 8.563e-27
Identity = 71/232 (30.60%), Postives = 132/232 (56.90%), Query Frame = 1
Query: 1999 KTDKYKHKKEQKL----IEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE-SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            K D+ +  KE+K+    +E  + +E+KKP ED+ L + + LP    I G  L  S F+ CL+V +FL SF  VLG+D   +PT+   Q   +N    S+  +  LL+ LL  AV DPG+        ++G   + + +N + +S VL+ ++ A     + +++   L    ++  +  ++A +L F++NE+  S+ + SE+DK LE  +++R+D+ I++GKL+++K   +++
Sbjct: 1078 KRDEKRLNKERKMELRRLELEMIREMKKPNEDMCLTDHKPLPGVPRIPGLVLPGSVFSDCLMVVQFLRSFGKVLGLDSSELPTLGILQEGLLNLG-NSMGQVQDLLVRLLSSAVSDPGLPQGHRAKSILGDHLTNVGLNRDNVSEVLQLYMEAHCSQTDLADLTLSLRTKAFQAHTPAQKASVLAFLVNELSCSKSVVSEIDKSLEHMNVLRKDECIVEGKLKKMKTIYAKR 1308          

HSP 2 Score: 59.3066 bits (142), Expect = 5.640e-8
Identity = 25/67 (37.31%), Postives = 45/67 (67.16%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++   L GDV Y +P G ++   P + + +SR  I++++ +NFSF   +++GD+
Sbjct:  812 PLEMGWQRETRIKTVAGRLQGDVAYYSPCGKRLRQYPDVVKYLSRYGITDITRDNFSFSAKIRVGDF 878          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Match: baz2ba (bromodomain adjacent to zinc finger domain, 2Ba [Source:ZFIN;Acc:ZDB-GENE-070615-37])

HSP 1 Score: 120.939 bits (302), Expect = 1.007e-26
Identity = 71/232 (30.60%), Postives = 132/232 (56.90%), Query Frame = 1
Query: 1999 KTDKYKHKKEQKL----IEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE-SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            K D+ +  KE+K+    +E  + +E+KKP ED+ L + + LP    I G  L  S F+ CL+V +FL SF  VLG+D   +PT+   Q   +N    S+  +  LL+ LL  AV DPG+        ++G   + + +N + +S VL+ ++ A     + +++   L    ++  +  ++A +L F++NE+  S+ + SE+DK LE  +++R+D+ I++GKL+++K   +++
Sbjct: 1100 KRDEKRLNKERKMELRRLELEMIREMKKPNEDMCLTDHKPLPGVPRIPGLVLPGSVFSDCLMVVQFLRSFGKVLGLDSSELPTLGILQEGLLNLG-NSMGQVQDLLVRLLSSAVSDPGLPQGHRAKSILGDHLTNVGLNRDNVSEVLQLYMEAHCSQTDLADLTLSLRTKAFQAHTPAQKASVLAFLVNELSCSKSVVSEIDKSLEHMNVLRKDECIVEGKLKKMKTIYAKR 1330          

HSP 2 Score: 59.3066 bits (142), Expect = 5.425e-8
Identity = 25/67 (37.31%), Postives = 45/67 (67.16%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++   L GDV Y +P G ++   P + + +SR  I++++ +NFSF   +++GD+
Sbjct:  812 PLEMGWQRETRIKTVAGRLQGDVAYYSPCGKRLRQYPDVVKYLSRYGITDITRDNFSFSAKIRVGDF 878          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Match: baz2ba (bromodomain adjacent to zinc finger domain, 2Ba [Source:ZFIN;Acc:ZDB-GENE-070615-37])

HSP 1 Score: 120.553 bits (301), Expect = 1.473e-26
Identity = 71/232 (30.60%), Postives = 132/232 (56.90%), Query Frame = 1
Query: 1999 KTDKYKHKKEQKL----IEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE-SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            K D+ +  KE+K+    +E  + +E+KKP ED+ L + + LP    I G  L  S F+ CL+V +FL SF  VLG+D   +PT+   Q   +N    S+  +  LL+ LL  AV DPG+        ++G   + + +N + +S VL+ ++ A     + +++   L    ++  +  ++A +L F++NE+  S+ + SE+DK LE  +++R+D+ I++GKL+++K   +++
Sbjct: 1044 KRDEKRLNKERKMELRRLELEMIREMKKPNEDMCLTDHKPLPGVPRIPGLVLPGSVFSDCLMVVQFLRSFGKVLGLDSSELPTLGILQEGLLNLG-NSMGQVQDLLVRLLSSAVSDPGLPQGHRAKSILGDHLTNVGLNRDNVSEVLQLYMEAHCSQTDLADLTLSLRTKAFQAHTPAQKASVLAFLVNELSCSKSVVSEIDKSLEHMNVLRKDECIVEGKLKKMKTIYAKR 1274          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:100126219])

HSP 1 Score: 170.244 bits (430), Expect = 1.722e-41
Identity = 119/374 (31.82%), Postives = 191/374 (51.07%), Query Frame = 1
Query: 1987 KPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDP 3105
            KP  K    + + E++  +  I +ELKKP ED+ L + Q LP F  + G  L   AF+ CL   EFL+S+  VLG+D    IP++   Q    N   +SL  +  LL++LL+ A+ +PG+       +++G K SE+ +N   +S  LR F+   + G + E+   L +  ++  +   +A++L F++NE+  S LI SE+DK LE  S  R+ KWI++GK+RRLK   S++        +    S    +   +   D+  I D                         S +     E E  SS+S+ +LE++IE+LT + +  +  +     +LR + LGQDRY R ++++ HLGGIFIE  P S E   +P
Sbjct:  650 KPDRKQLAQQRRLEERKRQQFILEELKKPTEDMCLPDHQQLPDFPCVPGLVLPSCAFSDCLTTVEFLHSYGKVLGLDEAKDIPSLCTLQEGLFNVG-DSLGEVQDLLVKLLRAAMINPGLPPYCQSLKILGEKVSEIGLNRENVSEPLRLFL--ESYGGDIELCDSLRSHPFQAHAPHVKAKILAFLVNELNASSLIISEIDKTLENMSHYRKHKWIIEGKIRRLKFALSKRKSSEESQTTTAEESQRRRSERNAEENDALDIDD-------------------------STIQKDFVEVEIPSSTSVVELERQIEKLTKRQMFFRKKILGSSQRLRTVCLGQDRYRRCYWMVPHLGGIFIEGLPESAEPDKEP 995          

HSP 2 Score: 80.4925 bits (197), Expect = 3.440e-14
Identity = 47/103 (45.63%), Postives = 66/103 (64.08%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENI 5778
            C   L+E+      +PFL PV+ + VP Y+K+IK PMDFST+  KL +  Y S  EF  D  L+F+NC+ FNEDDS++GKAG  L+ F++  W   S+E+  I
Sbjct: 1548 CEIILMELESHEDAWPFLEPVNPRLVPGYRKIIKNPMDFSTIRHKLLNGKYSSCEEFAEDAELVFSNCQLFNEDDSEVGKAGLILKKFYDARWEEFSQERNQI 1650          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:100126219])

HSP 1 Score: 169.859 bits (429), Expect = 1.889e-41
Identity = 119/374 (31.82%), Postives = 191/374 (51.07%), Query Frame = 1
Query: 1987 KPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDP 3105
            KP  K    + + E++  +  I +ELKKP ED+ L + Q LP F  + G  L   AF+ CL   EFL+S+  VLG+D    IP++   Q    N   +SL  +  LL++LL+ A+ +PG+       +++G K SE+ +N   +S  LR F+   + G + E+   L +  ++  +   +A++L F++NE+  S LI SE+DK LE  S  R+ KWI++GK+RRLK   S++        +    S    +   +   D+  I D                         S +     E E  SS+S+ +LE++IE+LT + +  +  +     +LR + LGQDRY R ++++ HLGGIFIE  P S E   +P
Sbjct:  650 KPDRKQLAQQRRLEERKRQQFILEELKKPTEDMCLPDHQQLPDFPCVPGLVLPSCAFSDCLTTVEFLHSYGKVLGLDEAKDIPSLCTLQEGLFNVG-DSLGEVQDLLVKLLRAAMINPGLPPYCQSLKILGEKVSEIGLNRENVSEPLRLFL--ESYGGDIELCDSLRSHPFQAHAPHVKAKILAFLVNELNASSLIISEIDKTLENMSHYRKHKWIIEGKIRRLKFALSKRKSSEESQTTTAEESQRRRSERNAEENDALDIDD-------------------------STIQKDFVEVEIPSSTSVVELERQIEKLTKRQMFFRKKILGSSQRLRTVCLGQDRYRRCYWMVPHLGGIFIEGLPESAEPDKEP 995          

HSP 2 Score: 98.9821 bits (245), Expect = 7.959e-20
Identity = 48/122 (39.34%), Postives = 69/122 (56.56%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTR 4956
            WR+++    +  QL  C++ L  +IAW++S+ KV C  CRK  N+  LLLCDSCD+G HTYC +P ++ IPEG WFC  C+S   + +     G  +  R   C +  R      AKP+  R
Sbjct: 1447 WRQTVERCRSAAQLSLCLQQLERSIAWERSVNKVTCLYCRKGDNDEFLLLCDSCDRGCHTYCHKPQMNEIPEGDWFCPTCISLQCESEFLRTSGSSRRIRK--CTL--RFKENSPAKPSRRR 1564          

HSP 3 Score: 80.1073 bits (196), Expect = 3.738e-14
Identity = 47/103 (45.63%), Postives = 66/103 (64.08%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENI 5778
            C   L+E+      +PFL PV+ + VP Y+K+IK PMDFST+  KL +  Y S  EF  D  L+F+NC+ FNEDDS++GKAG  L+ F++  W   S+E+  I
Sbjct: 1597 CEIILMELESHEDAWPFLEPVNPRLVPGYRKIIKNPMDFSTIRHKLLNGKYSSCEEFAEDAELVFSNCQLFNEDDSEVGKAGLILKKFYDARWEEFSQERNQI 1699          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Match: BAZ2A (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:100126219])

HSP 1 Score: 166.777 bits (421), Expect = 1.545e-40
Identity = 117/367 (31.88%), Postives = 188/367 (51.23%), Query Frame = 1
Query: 1987 KPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSS 3084
            KP  K    + + E++  +  I +ELKKP ED+ L + Q LP F  + G  L   AF+ CL   EFL+S+  VLG+D    IP++   Q    N   +SL  +  LL++LL+ A+ +PG+       +++G K SE+ +N   +S  LR F+   + G + E+   L +  ++  +   +A++L F++NE+  S LI SE+DK LE  S  R+ KWI++GK+RRLK   S++        +    S    +   +   D+  I D                         S +     E E  SS+S+ +LE++IE+LT + +  +  +     +LR + LGQDRY R ++++ HLGGIFIE  P S
Sbjct:  416 KPDRKQLAQQRRLEERKRQQFILEELKKPTEDMCLPDHQQLPDFPCVPGLVLPSCAFSDCLTTVEFLHSYGKVLGLDEAKDIPSLCTLQEGLFNVG-DSLGEVQDLLVKLLRAAMINPGLPPYCQSLKILGEKVSEIGLNRENVSEPLRLFL--ESYGGDIELCDSLRSHPFQAHAPHVKAKILAFLVNELNASSLIISEIDKTLENMSHYRKHKWIIEGKIRRLKFALSKRKSSEESQTTTAEESQRRRSERNAEENDALDIDD-------------------------STIQKDFVEVEIPSSTSVVELERQIEKLTKRQMFFRKKILGSSQRLRTVCLGQDRYRRCYWMVPHLGGIFIEGLPES 754          

HSP 2 Score: 98.5969 bits (244), Expect = 1.030e-19
Identity = 42/100 (42.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            WR+++    +  QL  C++ L  +IAW++S+ KV C  CRK  N+  LLLCDSCD+G HTYC +P ++ IPEG WFC  C+S   + +     G  +  R
Sbjct: 1191 WRQTVERCRSAAQLSLCLQQLERSIAWERSVNKVTCLYCRKGDNDEFLLLCDSCDRGCHTYCHKPQMNEIPEGDWFCPTCISLQCESEFLRTSGSSRRIR 1290          

HSP 3 Score: 77.0258 bits (188), Expect = 3.629e-13
Identity = 45/95 (47.37%), Postives = 62/95 (65.26%), Query Frame = 1
Query: 5494 LDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENI 5778
            L     +PFL PV+ + VP Y+K+IK PMDFST+  KL +  Y S  EF  D  L+F+NC+ FNEDDS++GKAG  L+ F++  W   S+E+  I
Sbjct: 1346 LSAEYAWPFLEPVNPRLVPGYRKIIKNPMDFSTIRHKLLNGKYSSCEEFAEDAELVFSNCQLFNEDDSEVGKAGLILKKFYDARWEEFSQERNQI 1440          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Match: BAZ2B (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:100151715])

HSP 1 Score: 157.918 bits (398), Expect = 8.851e-38
Identity = 129/469 (27.51%), Postives = 234/469 (49.89%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGK---LRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDL-KLEIKNELTACHANVSENG 3405
            + K EQ+ +E  ++KELKKP ED+ L + +  P    I G  L  S F++CL+V +FL +F  VL  D+   IPT+   Q   +N   +S+  +  LL+ LL  AVCDPG+         +G     + +N + +S VL+ F+ A     ++++   L    ++  S ++++ +L F++NE+  S+ + SE+DK ++  S +RRDKW+++GK   LR +   ++ K     G+  +                      D D +      D   D  + +E+    ++    +ED+   ++++++LEK+I++L  Q  Q +  L +  H LR +  GQDRY R +++L   GGIF+E     +E    P+ + K     + E+    EN +  +++++ S+  + ++ +SS    + D         DS N+F Q +P    K SK  ++ K+  + ++    AN S NG
Sbjct:  903 ERKLEQRRLELELAKELKKPTEDMCLADHKPFPELPRIPGLVLCGSTFSNCLMVVQFLRNFGKVLDFDIHKDIPTLSVIQEGLLNMG-DSMGEVQDLLVRLLSAAVCDPGVPPGYKAKTALGEHILNIGINRDNVSEVLQIFMEAHC--GQTDITESLKTKAFQAHSPEQKSSILAFLVNELACSKSVVSEIDKNIDHMSNLRRDKWMVEGKLRKLRMIHAKKTGKKDSIAGSEGSEEQQSLGTPTQGRKRRRKGADSDYDDDDDDDSDDQAEDEDEEDEDKKGKKVETCDDEDDGDQTATVEELEKQIDKLLKQQNQYRKKLFESSHCLRSMMFGQDRYRRRYWILPQCGGIFVE----GMESGEGPEEMAK-----ERERKRAAENIQIKEEMLE-SYE-EKVNCLSSGNREQKD--------KDSTNLFLQ-KPGSFSKLSKLLEVAKMPPEMDVLTQKANASPNG 1348          

HSP 2 Score: 122.865 bits (307), Expect = 4.258e-27
Identity = 56/121 (46.28%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 4513 DNKKSSTLASKLESVNSSV------TPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            DN  + T+ +   S+N           P L  WR+++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IPEG WFC  C++KA+   L
Sbjct: 1754 DNVGTVTVPAPAPSINGDGDGTEDDIAPGLKVWRRALSEARSAAQVSLCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPEGDWFCPACIAKASGHNL 1874          

HSP 3 Score: 84.3445 bits (207), Expect = 2.489e-15
Identity = 51/93 (54.84%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L E+      +PFL PV++K VP YKKVIK PMDF+T+  KLS+  Y S   F  D+RL+FNNCE FNED+S+IG+AGH +R  FEK W
Sbjct: 1953 CSVILSEMESHEDAWPFLLPVNLKLVPGYKKVIKKPMDFATIRDKLSNGQYPSFEAFALDVRLVFNNCETFNEDESEIGRAGHKMRVHFEKRW 2045          

HSP 4 Score: 59.3066 bits (142), Expect = 8.505e-8
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K+L   L G+V Y  P G K    P++ + +SR  I ++S +NFSF   +++GD+
Sbjct:  667 PLEYGWQRETRIKNLSGRLQGEVTYYAPCGKKFRQYPEVMKYLSRNGIMDISRDNFSFSAKIRVGDF 733          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Match: BAZ2B (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:100151715])

HSP 1 Score: 157.918 bits (398), Expect = 8.853e-38
Identity = 129/469 (27.51%), Postives = 234/469 (49.89%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGK---LRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDL-KLEIKNELTACHANVSENG 3405
            + K EQ+ +E  ++KELKKP ED+ L + +  P    I G  L  S F++CL+V +FL +F  VL  D+   IPT+   Q   +N   +S+  +  LL+ LL  AVCDPG+         +G     + +N + +S VL+ F+ A     ++++   L    ++  S ++++ +L F++NE+  S+ + SE+DK ++  S +RRDKW+++GK   LR +   ++ K     G+  +                      D D +      D   D  + +E+    ++    +ED+   ++++++LEK+I++L  Q  Q +  L +  H LR +  GQDRY R +++L   GGIF+E     +E    P+ + K     + E+    EN +  +++++ S+  + ++ +SS    + D         DS N+F Q +P    K SK  ++ K+  + ++    AN S NG
Sbjct:  872 ERKLEQRRLELELAKELKKPTEDMCLADHKPFPELPRIPGLVLCGSTFSNCLMVVQFLRNFGKVLDFDIHKDIPTLSVIQEGLLNMG-DSMGEVQDLLVRLLSAAVCDPGVPPGYKAKTALGEHILNIGINRDNVSEVLQIFMEAHC--GQTDITESLKTKAFQAHSPEQKSSILAFLVNELACSKSVVSEIDKNIDHMSNLRRDKWMVEGKLRKLRMIHAKKTGKKDSIAGSEGSEEQQSLGTPTQGRKRRRKGADSDYDDDDDDDSDDQAEDEDEEDEDKKGKKVETCDDEDDGDQTATVEELEKQIDKLLKQQNQYRKKLFESSHCLRSMMFGQDRYRRRYWILPQCGGIFVE----GMESGEGPEEMAK-----ERERKRAAENIQIKEEMLE-SYE-EKVNCLSSGNREQKD--------KDSTNLFLQ-KPGSFSKLSKLLEVAKMPPEMDVLTQKANASPNG 1317          

HSP 2 Score: 122.865 bits (307), Expect = 4.093e-27
Identity = 56/121 (46.28%), Postives = 75/121 (61.98%), Query Frame = 1
Query: 4513 DNKKSSTLASKLESVNSSV------TPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            DN  + T+ +   S+N           P L  WR+++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IPEG WFC  C++KA+   L
Sbjct: 1723 DNVGTVTVPAPAPSINGDGDGTEDDIAPGLKVWRRALSEARSAAQVSLCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPEGDWFCPACIAKASGHNL 1843          

HSP 3 Score: 83.9593 bits (206), Expect = 2.862e-15
Identity = 51/93 (54.84%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L E+      +PFL PV++K VP YKKVIK PMDF+T+  KLS+  Y S   F  D+RL+FNNCE FNED+S+IG+AGH +R  FEK W
Sbjct: 1922 CSVILSEMESHEDAWPFLLPVNLKLVPGYKKVIKKPMDFATIRDKLSNGQYPSFEAFALDVRLVFNNCETFNEDESEIGRAGHKMRVHFEKRW 2014          

HSP 4 Score: 59.3066 bits (142), Expect = 8.346e-8
Identity = 27/67 (40.30%), Postives = 43/67 (64.18%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K+L   L G+V Y  P G K    P++ + +SR  I ++S +NFSF   +++GD+
Sbjct:  636 PLEYGWQRETRIKNLSGRLQGEVTYYAPCGKKFRQYPEVMKYLSRNGIMDISRDNFSFSAKIRVGDF 702          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Match: Baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:MGI Symbol;Acc:MGI:2151152])

HSP 1 Score: 160.614 bits (405), Expect = 1.233e-38
Identity = 115/370 (31.08%), Postives = 192/370 (51.89%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP ED+ L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  779 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1128          

HSP 2 Score: 102.449 bits (254), Expect = 5.994e-21
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1625 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1729          

HSP 3 Score: 86.2705 bits (212), Expect = 4.169e-16
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1786 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1878          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Match: Baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:MGI Symbol;Acc:MGI:2151152])

HSP 1 Score: 160.229 bits (404), Expect = 1.285e-38
Identity = 115/370 (31.08%), Postives = 192/370 (51.89%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP ED+ L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  777 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1126          

HSP 2 Score: 102.449 bits (254), Expect = 6.043e-21
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1623 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1727          

HSP 3 Score: 86.2705 bits (212), Expect = 4.133e-16
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1784 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1876          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Match: Baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:MGI Symbol;Acc:MGI:2151152])

HSP 1 Score: 160.229 bits (404), Expect = 1.285e-38
Identity = 115/370 (31.08%), Postives = 192/370 (51.89%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP ED+ L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  777 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1126          

HSP 2 Score: 102.449 bits (254), Expect = 6.043e-21
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1623 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1727          

HSP 3 Score: 86.2705 bits (212), Expect = 4.133e-16
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1784 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1876          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Match: Baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:MGI Symbol;Acc:MGI:2151152])

HSP 1 Score: 160.229 bits (404), Expect = 1.285e-38
Identity = 115/370 (31.08%), Postives = 192/370 (51.89%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP ED+ L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  778 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1127          

HSP 2 Score: 102.449 bits (254), Expect = 6.044e-21
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1624 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1728          

HSP 3 Score: 86.2705 bits (212), Expect = 4.133e-16
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1785 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1877          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Match: Baz2a (bromodomain adjacent to zinc finger domain, 2A [Source:MGI Symbol;Acc:MGI:2151152])

HSP 1 Score: 160.229 bits (404), Expect = 1.297e-38
Identity = 115/370 (31.08%), Postives = 192/370 (51.89%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP ED+ L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  780 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEDMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPSFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1129          

HSP 2 Score: 102.449 bits (254), Expect = 5.995e-21
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1626 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1730          

HSP 3 Score: 86.2705 bits (212), Expect = 4.031e-16
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1787 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1879          
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Match: sp|B7ZS37|BAZ2A_XENLA (Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis OX=8355 GN=baz2a PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.605e-39
Identity = 116/369 (31.44%), Postives = 194/369 (52.57%), Query Frame = 1
Query: 1987 KPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLE 3090
            KP  K    + + E++  +  I +ELKKP ED+ L + Q LP F  + G  L   AF+ CL   EFL+S+  VLG+D    IP++   Q    N   +SL  +  LL++LL+ A+ +PG+       +++G K SE+ ++   +S  LR F+   A G + E+   L +  ++  +   +  +L F++NE+  S LI SE+DK LE  S  R+ KWI++GK+RRLK   S++                       +  +SQI          ++ +++ +    + + +  Q ++  EE +   S+S+ +LE++IE+LT + +  +  +     +LR + LGQDRY R +++L HLGGIFIE  P S E
Sbjct:  648 KPDRKLLAQQRRLEERKRQQFILEELKKPTEDMCLPDHQQLPDFPCVPGLFLPSCAFSDCLTTVEFLHSYGKVLGLDEAKDIPSLCTLQEGLFNVG-DSLGEVQDLLVKLLQAAMINPGLPPYCQSLKILGEKVSEIVLSRENVSEPLRIFL--EAYGGDIELCDSLRSHPFQAHAPHIKTAILAFIVNELNASSLIISEIDKTLENMSHYRKHKWIIEGKIRRLKFALSKR----------------------KSSEESQITTTEVSLRRRSERNAEENDELDSIDESAIQKDYVQEEVDIPPSTSVVELERQIEKLTKRQMFFRKKILGSSQRLRTVCLGQDRYRRCYWMLPHLGGIFIEGLPESAE 991          

HSP 2 Score: 102.449 bits (254), Expect = 4.080e-20
Identity = 50/122 (40.98%), Postives = 70/122 (57.38%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTR 4956
            WR+++    +  QL  C++ L  +IAW++S+ KV C  CRK  N+  LLLCDSCD+G HTYC RP ++ IPEG WFC  C+S  ++ +     G  K  R   C V  R      +KP+  R
Sbjct: 1444 WRQTVERCRSAAQLSLCLQQLERSIAWERSLNKVTCLYCRKGDNDELLLLCDSCDRGCHTYCHRPRMNEIPEGDWFCPTCISLQSESEFLRSSGSSKRIRK--CTV--RFTEDSPSKPSRRR 1561          

HSP 3 Score: 78.9518 bits (193), Expect = 5.485e-13
Identity = 47/103 (45.63%), Postives = 65/103 (63.11%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENI 5778
            C   L+E+      +PFL PV+ + VP Y+K+IK PMDFST+  KL +  Y    EF  D  LIF+NC+ FNED+SD+GKAG  L+ F++  W   S+E+  I
Sbjct: 1594 CEIILMELESHEDAWPFLEPVNPRLVPGYRKIIKNPMDFSTMRHKLLNGNYSRCEEFAEDAELIFSNCQLFNEDESDVGKAGLILKKFYDARWEEFSQERNQI 1696          
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Match: sp|Q91YE5|BAZ2A_MOUSE (Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 4.704e-37
Identity = 114/370 (30.81%), Postives = 191/370 (51.62%), Query Frame = 1
Query: 1975 GKPLKPSIKTDKY----KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            G   +PS + DK     K  +EQ+  +A I +E+KKP E + L + Q LP F  I G  LS  AF+ CL + EFL+SF  VLG DL   +P++   Q   + +  +SL  +  LL+ LLK A+ DPG+       +++G K SE+ +  + +S +LR F++A  V  E      L    ++     ++A +L F+++E+ +S +I +E+DK LE  S  R++KWI++G+LRRLK   +++     G     +    +      +             I       + +  + N    + +      E + A+S S+ +LE+ IE+L+ + L  +  L      LR + LGQDRY R++++L +L GIF+E
Sbjct:  779 GPRARPSCRADKTLATQKRLEEQQRQQA-ILEEMKKPTEGMCLSDHQPLPDFTRIPGLTLSSRAFSDCLTIVEFLHSFGKVLGFDLTKDVPSLGVLQEGLLCQG-DSLDKVQDLLVRLLKAALHDPGLPPYCQSLKILGEKMSEIPLTRDNVSEILRCFLMAYRV--EPPFCDSLRTQPFQAQPPQQKAAILAFLVHELNSSTIIINEIDKTLESVSSCRKNKWIVEGRLRRLKTALAKR----TGRPEVMMEGAEDGLGRRRSS-----------RIMEETSGIEEEEEEENTTAVHGRRGRKEGEIDVAAS-SIPELERHIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRHYWVLPYLAGIFVE 1128          

HSP 2 Score: 102.064 bits (253), Expect = 4.485e-20
Identity = 43/105 (40.95%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  CM  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+S+  +++     G PK  +
Sbjct: 1625 PRVRVWRQTLERCRSAAQVCLCMGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCAVCLSQQVEEEYTQRPGFPKRGQ 1729          

HSP 3 Score: 86.2705 bits (212), Expect = 2.991e-15
Identity = 45/93 (48.39%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y++VIK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1786 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRVIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHVMRRFFESRW 1878          
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Match: sp|Q9UIF8|BAZ2B_HUMAN (Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3)

HSP 1 Score: 137.502 bits (345), Expect = 8.687e-31
Identity = 77/223 (34.53%), Postives = 131/223 (58.74%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            + K EQ+ +E  ++KELKKP ED+ L + + LP    I G  LS S F+ CL+V +FL +F  VLG D++  +P +   Q   +N   +S+  +  LL+ LL  AVCDPG+         +G     + VN + +S +L+ F+ A     ++E+   L    ++  +  ++A +L F+INE+  S+ + SE+DK ++  S +RRDKW+++GKLR+L++  ++K
Sbjct: 1043 ERKLEQRRLELEMAKELKKPNEDMCLADQKPLPELPRIPGLVLSGSTFSDCLMVVQFLRNFGKVLGFDVNIDVPNLSVLQEGLLNIG-DSMGEVQDLLVRLLSAAVCDPGLITGYKAKTALGEHLLNVGVNRDNVSEILQIFMEAHC--GQTELTESLKTKAFQAHTPAQKASVLAFLINELACSKSVVSEIDKNIDYMSNLRRDKWVVEGKLRKLRIIHAKK 1262          

HSP 2 Score: 124.79 bits (312), Expect = 6.896e-27
Identity = 51/94 (54.26%), Postives = 67/94 (71.28%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            P L  WR+++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IP+G WFC  C++KA+ Q L
Sbjct: 1894 PGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTL 1987          

HSP 3 Score: 86.6557 bits (213), Expect = 2.203e-15
Identity = 53/98 (54.08%), Postives = 66/98 (67.35%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSK 5763
            C   L E+      +PFL PV++K VP YKKVIK PMDFST+  KLS   Y +   F  D+RL+F+NCE FNEDDSDIG+AGH +R +FEK W  + K
Sbjct: 2069 CSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFK 2166          

HSP 4 Score: 69.707 bits (169), Expect = 3.451e-10
Identity = 56/178 (31.46%), Postives = 92/178 (51.69%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDL-KLEIKNELTACHANVSENG 3405
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L    H LR +  GQDRY R +++L   GGIF+E     +E     + I K     + EKL K E+ +  +++ + S      SN +    +K DLK +     D+ N+F Q +P    K SK  ++ K+  ++E+     N   NG
Sbjct: 1334 DEDEGDQAASVEELEKQIEKLSKQQSQYRRKLFDASHSLRSVMFGQDRYRRRYWILPQCGGIFVE----GMESGEGLEEIAK-----EREKLKKAESVQIKEEMFETSGDSLNCSN-TDHCEQKEDLKEK-----DNTNLFLQ-KPGSFSKLSKLLEVAKMPPESEVMTPKPNAGANG 1495          

HSP 5 Score: 58.5362 bits (140), Expect = 7.707e-7
Identity = 30/89 (33.71%), Postives = 54/89 (60.67%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSLN-ELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLI 1827
            PL+ GW+RET +++    L G+V Y  P G K+   P++ + +SR  I ++S +NFSF   +++GD+ + + D   G +   ++E D+I
Sbjct:  748 PLEYGWQRETRIRNFGGRLQGEVAYYAPCGKKLRQYPEVIKYLSRNGIMDISRDNFSFSAKIRVGDFYE-ARDGPQGMQWCLLKEEDVI 835          
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Match: sp|Q9DE13|BAZ2B_CHICK (Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus OX=9031 GN=BAZ2B PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.692e-30
Identity = 74/223 (33.18%), Postives = 133/223 (59.64%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            + K EQ+ +E  ++KELKKP ED+ L + + LP    I G  LS S F+ CL++ +FL +F  VLG D++T +P++   Q   +N   +S   +  LL++L+  AVCDPG+        ++G     + +N + +S +L+ F+ A     ++E+   L    ++  +  ++A +L F++NE+  S+ + SE+DK ++  S +RRDKW+++GKLR L++  ++K
Sbjct:  966 ERKLEQRRLELEMAKELKKPNEDMCLADQKALPELPRIPGLVLSGSTFSDCLMIVQFLRNFGKVLGFDVNTDVPSLSTLQEGLLNIG-DSRGEVQDLLVKLVTAAVCDPGLVTGYKAKTILGEHLLNVGINRDNVSEILQIFMEAHC--GQTELTESLKTKAFQAHTPAQKAAVLAFLVNELACSKSVVSEIDKNIDYMSNLRRDKWMVEGKLRNLRIIHAKK 1185          

HSP 2 Score: 124.79 bits (312), Expect = 6.143e-27
Identity = 52/94 (55.32%), Postives = 67/94 (71.28%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            P L  WRK++ EA +  Q+  C++ L  +IAW+KSIMKV CQICRK  NE  LLLCD CD+G HTYC RP ++ IP+G WFC  C++KA+ Q L
Sbjct: 1858 PGLRVWRKALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQICRKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTL 1951          

HSP 3 Score: 85.1149 bits (209), Expect = 7.953e-15
Identity = 51/93 (54.84%), Postives = 64/93 (68.82%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L E+      +PFL PV++K VP YKKVIK PMDFST+  KL+   Y +   F  D+RL+F+NCE FNEDDSDIG+AGH +R +FEK W
Sbjct: 2031 CSMILSELETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIRDKLTSGQYPNVEAFSLDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKW 2123          

HSP 4 Score: 63.1586 bits (152), Expect = 3.175e-8
Identity = 28/65 (43.08%), Postives = 43/65 (66.15%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +ED+   + S+++LEK+IE+LT Q  Q +  L +  H LR +  GQDRY R +++L   GGIF+E
Sbjct: 1257 DEDDGDQTVSVEELEKQIEKLTKQQSQYRKKLFEASHCLRSMMFGQDRYRRRYWILPQCGGIFVE 1321          
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Match: sp|Q9UIF9|BAZ2A_HUMAN (Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A PE=1 SV=4)

HSP 1 Score: 134.035 bits (336), Expect = 9.001e-30
Identity = 81/235 (34.47%), Postives = 135/235 (57.45%), Query Frame = 1
Query: 1987 KPSIKTDKY---KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGID-LDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            KP+ K DK    + + E++  +  I +E+KKP ED+ L + Q LP F  + G  L   AF+ CL + EFL+SF  VLG D    +P++   Q   + +  +SL  +  LL+ LLK A+ DPG  +     +++G K SE+ +  + +S +LR F++A  V  E  +   L    ++     ++A +L F+++E+  S LI +E+DK LE  S  R++KWI++G+LRRLK   +++
Sbjct:  792 KPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVPGLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQG-DSLGEVQDLLVRLLKAALHDPGFPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGV--EPALCDRLRTQPFQAQPPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAKR 1023          

HSP 2 Score: 99.3673 bits (246), Expect = 3.173e-19
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTAR 4890
            P +  WR+++    +  Q+  C+  L  +IAW+KS+ KV C +CRK  N+  LLLCD CD+G H YC RP +  +PEG WFC  C+++  + +     G PK  +
Sbjct: 1639 PRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQ 1743          

HSP 3 Score: 85.5001 bits (210), Expect = 5.137e-15
Identity = 44/93 (47.31%), Postives = 62/93 (66.67%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            C   L+E+   +  +PFL PV+ + V  Y+++IK PMDFST+  +L    Y S+ EF  D  L+F+NC+ FNEDDS++GKAGH +R FFE  W
Sbjct: 1802 CEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEFAADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRW 1894          

HSP 4 Score: 60.4622 bits (145), Expect = 2.294e-7
Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 1
Query: 2872 GEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILK 3120
            GE D TASS  + +LE++IE+L+ + L  +  L      LR + LGQDRY R +++L +L GIF+E      E ++ P+ ++K
Sbjct: 1074 GEVDATASS--IPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVE----GTEGNLVPEEVIK 1150          
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Match: G4VAA0 (Putative bromodomain containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_170760 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.629e-63
Identity = 145/370 (39.19%), Postives = 233/370 (62.97%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWL-INTEYKDLSEDKQAELLGFVINEML-TSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE-----PAPSSLEMSID 3102
            K  KE K+ E  I +ELKKPVEDLRL++ + +P  + I GN+++K  F +CL++ EFL++FSDVL ID + IP M + Q A ++R P+    +  L++ LLK AV DPG+ +++LITQ++G KF+E+E+N  T+S +LRAFI++R  G E +M  WL    ++ DL+ ++QA LL F+ +E++ +SRLIS+E+D+ +EQQS+++R+KWI++ K+RRL+L  ++KL      I+N I       +     T  +       N+S+  +         + +      + S +ED T     + +LE +IE LT +  QK+ ++++C  +L G+ LGQDRY+ N+Y+LKH+GGI+IE       P+  E  ID
Sbjct:  936 KQFKEMKIREL-IDQELKKPVEDLRLIDPKPIPKLDSIPGNRMTKKMFGNCLMIIEFLHAFSDVLCIDTEAIPNMGELQSALIDRHPQCQRFLVHLVIGLLKLAVEDPGLPSSRLITQLLGQKFNEIELNEQTISVILRAFIISRN-GYEDDMSDWLHPRVQFIDLTGEQQASLLAFICDELICSSRLISNEIDRTIEQQSLLKREKWIIESKIRRLRLLIAQKLTITGNLINNTITEYDRKAIDIEPTTYQK-------NMSLTTLPKLTSMPVVSNSCGVLSTSLSDDEDSTC---KISELEAKIESLTRKTEQKQREIDECSSRLSGLFLGQDRYYCNYYVLKHMGGIYIECESFDSMPTKSECCID 1293          

HSP 2 Score: 174.481 bits (441), Expect = 1.700e-39
Identity = 105/262 (40.08%), Postives = 143/262 (54.58%), Query Frame = 1
Query: 4072 QHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            +H +++SE   L  VE L   V+ ASL  K WK P K   D+ I +IP   +K+  FE +PL+LA+ RLL++E  +ERRYLLPP N E    ++   + + +                       F+ + R+                      L   +    ++  P +L DWR ++ +A++   + +CM  L  AIAWDKSIMKVLCQICR+D NE  LLLCD CD+GYHTYCFRP LS IP G WFC+DCVSKAT + L
Sbjct: 2034 EHEEFMSECQLLYDVEALEDKVIYASLQTKEWKIPNKTSEDEIISLIPRTEVKKSRFEHWPLELARNRLLDIERHIERRYLLPPFNSEVHLNIIPEVETTDV----------------------PFLPEVRN---------------------GLNGPIHDQTNNNVPQDLMDWRTNLNQASDVNTIRSCMNQLILAIAWDKSIMKVLCQICRRDNNEDCLLLCDGCDRGYHTYCFRPQLSNIPSGDWFCYDCVSKATSKHL 2252          

HSP 3 Score: 82.0333 bits (201), Expect = 1.810e-11
Identity = 54/121 (44.63%), Postives = 83/121 (68.60%), Query Frame = 1
Query: 5389 IEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSD-FVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +E I+ L   +  + SN      E E CR+   ++L+    + F +PV++K+VPIY+K+IK PMD ST+ RK+ D   Y + + +++D+RLIF+NCE FNEDDS++G+AGHA+RA+FE  W
Sbjct: 2312 LESIQPLCQTYQPMKSN------ELEWCRRATEDLLNHEASWAFRKPVNLKQVPIYRKIIKHPMDLSTIWRKVQDPAAYTTFSNWVHDVRLIFSNCEFFNEDDSEVGRAGHAMRAYFESRW 2426          
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Match: A0A3Q0KSP2 (Putative bromodomain containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.756e-63
Identity = 141/357 (39.50%), Postives = 230/357 (64.43%), Query Frame = 1
Query: 2005 DKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWL-INTEYKDLSEDKQAELLGFVINEML-TSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            ++ K  KE K+ E  I +ELKKPVEDLRL++ + +P  + I GN+++K  F +CL++ EFL++FSDVL ID + IP M + Q A ++R P+    +  L++ LLK AV DPG+ +++LITQ++G KF+E+E+N  T+S +LRAFI++R  G E +M  WL    ++ DL+ ++QA LL F+ +E++ +SRLIS+E+D+ +EQQS+++R+KWI++ K+RRL+L  ++KL      I+N I       +     T  +       N+S+  +         + +      + S +ED T     + +LE +IE LT +  QK+ ++++C  +L G+ LGQDRY+ N+Y+LKH+GGI+IE
Sbjct:  933 EEQKQFKEMKIREL-IDQELKKPVEDLRLIDPKPIPKLDSIPGNRMTKKMFGNCLMIIEFLHAFSDVLCIDTEAIPNMGELQSALIDRHPQCQRFLVHLVIGLLKLAVEDPGLPSSRLITQLLGQKFNEIELNEQTISVILRAFIISRN-GYEDDMSDWLHPRVQFIDLTGEQQASLLAFICDELICSSRLISNEIDRTIEQQSLLKREKWIIESKIRRLRLLIAQKLTITGNLINNTITEYDRKAIDIEPTTYQK-------NMSLTTLPKLTSMPVVSNSCGVLSTSLSDDEDSTC---KISELEAKIESLTRKTEQKQREIDECSSRLSGLFLGQDRYYCNYYVLKHMGGIYIE 1277          

HSP 2 Score: 226.098 bits (575), Expect = 3.241e-55
Identity = 141/353 (39.94%), Postives = 186/353 (52.69%), Query Frame = 1
Query: 4072 QHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWE---------------FKPKVLSTTKES----HLRKTLNYVVSSSCGF------EDGAESTSSFIDDTRSINTDQSPSAQMSQDT-------DNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCG-------QPKT---------ARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNC 4986
            +H +++SE   L  VE L   V+ ASL  K WK P K   D+ I +IP   +K+  FE +PL+LA+ RLL++E  +ERRYLLPP N E               F P+V S T+ +          N +    C F      +D   S  S I     +   QS S     ++       D   S  L   +    ++  P +L DWR ++ +A++   + +CM  L  AIAWDKSIMKVLCQICR+D NE  LLLCD CD+GYHTYCFRP LS IP G WFC+DCVSKAT + LCY+CG       Q +T          R  VC  C R +H  CA+P   R+P++W C NC
Sbjct: 2034 EHEEFMSECQLLYDVEALEDKVIYASLQTKEWKIPNKTSEDEIISLIPRTEVKKSRFEHWPLELARNRLLDIERHIERRYLLPPFNSEVHLNIIPEVETTDVPFLPEVRSNTESTDTGIETEGECNDIKYDRCEFNTEIVGDDINVSGQSHIPQILHVTNKQSNSNDPVDNSNVCDMQLDVNHSDGLNGPIHDQTNNNVPQDLMDWRTNLNQASDVNTIRSCMNQLILAIAWDKSIMKVLCQICRRDNNEDCLLLCDGCDRGYHTYCFRPQLSNIPSGDWFCYDCVSKATSKHLCYICGGSEMDDLQQQTDSNSSISEVKRLAVCYHCSRAVHNSCARPAFVRIPKRWYCSNC 2386          

HSP 3 Score: 83.1889 bits (204), Expect = 7.939e-12
Identity = 54/121 (44.63%), Postives = 83/121 (68.60%), Query Frame = 1
Query: 5389 IEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSD-FVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +E I+ L   +  + SN      E E CR+   ++L+    + F +PV++K+VPIY+K+IK PMD ST+ RK+ D   Y + + +++D+RLIF+NCE FNEDDS++G+AGHA+RA+FE  W
Sbjct: 2585 LESIQPLCQTYQPMKSN------ELEWCRRATEDLLNHEASWAFRKPVNLKQVPIYRKIIKHPMDLSTIWRKVQDPAAYTTFSNWVHDVRLIFSNCEFFNEDDSEVGRAGHAMRAYFESRW 2699          
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Match: A0A158QSF1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS743 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.255e-62
Identity = 141/383 (36.81%), Postives = 229/383 (59.79%), Query Frame = 1
Query: 1942 NKLLNNHKKIDGKP---LKPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINT---EYKDLSEDKQAELLGFVINEML-TSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
             KL+ + ++++ +    LK  ++    K + E+  +E  + +EL++PVEDL LLN+  LPTF+ I+GN++S   F+ C+ V EFL++F++   ID +TIP+M+  Q AFV+RD   L  I  L++ELLKFA+ DPGI   +L+TQ++G +FSE+EV+ NT++G+LR F++ R  G E EM  WL  +      DLS  + A LL F+ +E+  +SRLIS+EVD+ +E Q  +RRDK+ L+ K+RR+++  +RK                          D  ++P     +     + +  +   N      Q   SG+E+E    +++D+LEKRIE LT  +  K+  + +C  +L G+ LGQDR+HRN+++L  +GGI++E
Sbjct:  907 TKLVEDQRRLETEKETQLKAELEAQTTKARVER--LEHLVEEELRRPVEDLCLLNATVLPTFDRIDGNRMSSQVFSDCIFVLEFLHAFTEAFCIDPETIPSMRCMQAAFVDRDETCLEVINHLIIELLKFAILDPGIPTPRLVTQLLGQRFSEMEVDTNTVTGLLRVFLIGRN-GYEDEMSDWLAPSSVDHLTDLSGPRLASLLAFICDELACSSRLISNEVDRTIELQVSLRRDKFNLEAKIRRIRVILARKF-----------------------GLDHAVLPGQTSGL-DEATNKNQPAFLQNVRQPAMQNYDSGDEEEL---NTVDELEKRIETLTYALNAKQRAIEECSFRLSGVFLGQDRFHRNYFVLGSVGGIYVE 1259          

HSP 2 Score: 229.565 bits (584), Expect = 2.730e-56
Identity = 146/350 (41.71%), Postives = 196/350 (56.00%), Query Frame = 1
Query: 4084 YLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCG-------QPKTARTTV------------CMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMS----KDVSSENDTNLLPSLTVSLSN 5064
            +L E   LE VE L+  V++ASL  KGW+ P KA  DD+I++IP    K + ++ +PLDLA+ERLL+LE  +ERRYLLPPL+ E +  V+ T +ES   +    V S S   E G  ST   I   R +   Q   A      D+ K+S L  +         P  L +WR+   +A+    L  C      AIAWDKSIMKVLCQICR+D NEA+LLLCD CD GYHTYCFRPP+  IP+G WFC+DCVSKAT +  C+VCG        P  + +TV            C  C R  H  C +P + R+P++W C  C+   +    K VS E++ +     ++SLS+
Sbjct: 1795 FLDECRFLELVEGLVDRVLSASLQTKGWQAPMKATDDDSIQIIPRSAPKVYRYDYWPLDLARERLLDLEAHVERRYLLPPLSCESRLDVVQTPEESSA-EVEGSVCSDSTHDEPGEISTVPHI---RRVLRRQPGGA------DDDKTSDLPGQ------QGLPLGLLEWRRGTKKADTIADLKRCAMQFEAAIAWDKSIMKVLCQICRRDKNEARLLLCDGCDHGYHTYCFRPPMVSIPDGDWFCYDCVSKATGKCHCFVCGLSKPLGSTPGASESTVMVALDPAHRLVQCTTCSRGAHPSCLRPPLNRLPKRWNCMFCTSTGAILQEKAVSPESNPSRKFQASMSLSS 2128          

HSP 3 Score: 82.4185 bits (202), Expect = 1.384e-11
Identity = 53/124 (42.74%), Postives = 79/124 (63.71%), Query Frame = 1
Query: 5404 TLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLS----DFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSK 5763
            + L  H +      +   E E CR+   +++   L +PF +PV  K VP Y+KVIK PMD ST+ +++S    +F Y S +E+  D+RL+F NC+ FNEDDS+IGKAGH LR +FE +W ++S+
Sbjct: 2265 SALRRHGTGKLRKAMCFAEREFCRRATEDLMKHELSWPFRKPVCCKTVPFYRKVIKRPMDLSTILKRISVDRWNF-YSSISEWREDVRLVFKNCQIFNEDDSEIGKAGHELRRYFESNWANASR 2387          

HSP 4 Score: 63.5438 bits (153), Expect = 8.116e-6
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = 1
Query: 1552 NYQKPLKNGWKRETYLKSLNE--LVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIF 1830
             Y+ PL  GW+RET +K +    L+GDV+Y +P G ++  I  +RE +     S ++TE+F+F+  ++LGDY + + D   GF K+S   V+ + 
Sbjct:  669 GYRLPLALGWRRETLVKGVGPGGLLGDVVYISPCGRQIWNIESVREYLRSTGTSILTTEDFTFKSYIRLGDYYECNKDS-KGFVKMSEASVNALI 762          
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Match: A0A5K3EX38 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.278e-62
Identity = 141/383 (36.81%), Postives = 229/383 (59.79%), Query Frame = 1
Query: 1942 NKLLNNHKKIDGKP---LKPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINT---EYKDLSEDKQAELLGFVINEML-TSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
             KL+ + ++++ +    LK  ++    K + E+  +E  + +EL++PVEDL LLN+  LPTF+ I+GN++S   F+ C+ V EFL++F++   ID +TIP+M+  Q AFV+RD   L  I  L++ELLKFA+ DPGI   +L+TQ++G +FSE+EV+ NT++G+LR F++ R  G E EM  WL  +      DLS  + A LL F+ +E+  +SRLIS+EVD+ +E Q  +RRDK+ L+ K+RR+++  +RK                          D  ++P     +     + +  +   N      Q   SG+E+E    +++D+LEKRIE LT  +  K+  + +C  +L G+ LGQDR+HRN+++L  +GGI++E
Sbjct:  732 TKLVEDQRRLETEKETQLKAELEAQTTKARVER--LEHLVEEELRRPVEDLCLLNATVLPTFDRIDGNRMSSQVFSDCIFVLEFLHAFTEAFCIDPETIPSMRCMQAAFVDRDETCLEVINHLIIELLKFAILDPGIPTPRLVTQLLGQRFSEMEVDTNTVTGLLRVFLIGRN-GYEDEMSDWLAPSSVDHLTDLSGPRLASLLAFICDELACSSRLISNEVDRTIELQVSLRRDKFNLEAKIRRIRVILARKF-----------------------GLDHAVLPGQTSGL-DEATNKNQPAFLQNVRQPAMQNYDSGDEEEL---NTVDELEKRIETLTYALNAKQRAIEECSFRLSGVFLGQDRFHRNYFVLGSVGGIYVE 1084          

HSP 2 Score: 229.565 bits (584), Expect = 2.233e-56
Identity = 146/350 (41.71%), Postives = 196/350 (56.00%), Query Frame = 1
Query: 4084 YLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCG-------QPKTARTTV------------CMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMS----KDVSSENDTNLLPSLTVSLSN 5064
            +L E   LE VE L+  V++ASL  KGW+ P KA  DD+I++IP    K + ++ +PLDLA+ERLL+LE  +ERRYLLPPL+ E +  V+ T +ES   +    V S S   E G  ST   I   R +   Q   A      D+ K+S L  +         P  L +WR+   +A+    L  C      AIAWDKSIMKVLCQICR+D NEA+LLLCD CD GYHTYCFRPP+  IP+G WFC+DCVSKAT +  C+VCG        P  + +TV            C  C R  H  C +P + R+P++W C  C+   +    K VS E++ +     ++SLS+
Sbjct: 1620 FLDECRFLELVEGLVDRVLSASLQTKGWQAPMKATDDDSIQIIPRSAPKVYRYDYWPLDLARERLLDLEAHVERRYLLPPLSCESRLDVVQTPEESSA-EVEGSVCSDSTHDEPGEISTVPHI---RRVLRRQPGGA------DDDKTSDLPGQ------QGLPLGLLEWRRGTKKADTIADLKRCAMQFEAAIAWDKSIMKVLCQICRRDKNEARLLLCDGCDHGYHTYCFRPPMVSIPDGDWFCYDCVSKATGKCHCFVCGLSKPLGSTPGASESTVMVALDPAHRLVQCTTCSRGAHPSCLRPPLNRLPKRWNCMFCTSTGAILQEKAVSPESNPSRKFQASMSLSS 1953          

HSP 3 Score: 82.4185 bits (202), Expect = 1.390e-11
Identity = 53/124 (42.74%), Postives = 79/124 (63.71%), Query Frame = 1
Query: 5404 TLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLS----DFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSK 5763
            + L  H +      +   E E CR+   +++   L +PF +PV  K VP Y+KVIK PMD ST+ +++S    +F Y S +E+  D+RL+F NC+ FNEDDS+IGKAGH LR +FE +W ++S+
Sbjct: 2090 SALRRHGTGKLRKAMCFAEREFCRRATEDLMKHELSWPFRKPVCCKTVPFYRKVIKRPMDLSTILKRISVDRWNF-YSSISEWREDVRLVFKNCQIFNEDDSEIGKAGHELRRYFESNWANASR 2212          

HSP 4 Score: 63.1586 bits (152), Expect = 9.050e-6
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = 1
Query: 1552 NYQKPLKNGWKRETYLKSLNE--LVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIF 1830
             Y+ PL  GW+RET +K +    L+GDV+Y +P G ++  I  +RE +     S ++TE+F+F+  ++LGDY + + D   GF K+S   V+ + 
Sbjct:  494 GYRLPLALGWRRETLVKGVGPGGLLGDVVYISPCGRQIWNIESVREYLRSTGTSILTTEDFTFKSYIRLGDYYECNKDS-KGFVKMSEASVNALI 587          
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Match: A0A4Z2DAZ8 (Bromodomain adjacent to zinc finger domain protein OS=Schistosoma japonicum OX=6182 GN=EWB00_002755 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.279e-60
Identity = 146/357 (40.90%), Postives = 198/357 (55.46%), Query Frame = 1
Query: 4051 IKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVL-STTKESHLRKTLNYVVSSSCGFE----------DGAESTSSFIDDTRSIN--TDQSPSAQ-MSQDTDNKKSSTLASKLES-------------VNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCG-----------------QPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCS 4989
            I+    ++H+ ++SE   L  VE L   V+ ASL  KGWK P K   D+TI +IP   +K+  FE +PL+LA+ RLL++E  LERRYLLPP N E    ++  T   S+L +  +   S+  G E          D  ES +  ++D  +++  T Q+ S   +S D+ +  SST   +L++              N+   P  L  WR  + +A +   L  CM  L  AIAWDKSIMKVLCQICR+D NEA LLLCD CD+GYHTYCF+P LS IP G WFC+DCVSKAT + LCY+CG                   +  R  VC  C R +H  CA+PT  R+P++W C NC+
Sbjct: 2095 IEDTSTDEHTTFISECQLLRDVEALEDKVLYASLQTKGWKVPSKISEDETISLIPRTAVKQSRFEHWPLELARNRLLDIECHLERRYLLPPFNSEVHLNIVPETIDASYLPEVRSNTESTDTGIETEGEYCDMKYDKCESNAEAVEDDINVSRQTRQTTSKHPISNDSVDNNSSTYDFQLDNNHLDELNTVSNDQTNNYNVPQGLIKWRTKLNQATDAASLRRCMNQLVLAIAWDKSIMKVLCQICRRDNNEACLLLCDGCDRGYHTYCFKPQLSNIPTGDWFCYDCVSKATSKHLCYICGGSELDDIQQQQTDSNSSNSEVKRMAVCYHCSRAVHNSCARPTFVRIPKRWYCSNCT 2451          

HSP 2 Score: 207.223 bits (526), Expect = 1.905e-49
Identity = 100/228 (43.86%), Postives = 167/228 (73.25%), Query Frame = 1
Query: 2020 KKEQKL-----IEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWL-INTEYKDLSEDKQAELLGFVINEML-TSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKL 2682
            K+EQK      +   I +ELKKPVEDLRL++S+ +P  + I GN+++++ F +CL++ EFL++FSDVL ID + IP M + Q A ++RDP+    +  L++ LLK A+ DPG+ +++L+TQ++G +F++ E+N  T+S +LRAFI++R  G E +M  WL    ++ +L+ ++QA LL FV +E++ +SRLIS+E+D+ +E+QSI++R+KWI++ K+RRL+L  ++KL
Sbjct:  937 KEEQKQFREMNVRELIEQELKKPVEDLRLIDSKPIPKLDSIPGNRMTRNMFGNCLMIIEFLHAFSDVLFIDHEAIPNMGELQSALIDRDPQCQRFLVHLMIGLLKLAIDDPGMPSSRLVTQLLGQRFNDTELNEQTISSILRAFIISRN-GYEDDMSDWLHPPIQFTELTGEQQATLLAFVCDELICSSRLISNEIDRTIEKQSILKREKWIIESKIRRLRLLIAQKL 1163          

HSP 3 Score: 83.9593 bits (206), Expect = 5.059e-12
Identity = 49/102 (48.04%), Postives = 75/102 (73.53%), Query Frame = 1
Query: 5446 LSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSD-FVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            ++  E E CR+   ++L+    + F +PV++K+VPIY+K+IK PMD ST+ RK+ D   Y + N +++D+RLIF+NCE FNEDDS++G+AGH +RA+FE  W
Sbjct: 2660 MNSNELEWCRRATEDLLNHEASWAFRKPVNLKQVPIYRKIIKHPMDLSTIWRKVQDPAAYTTFNSWVHDVRLIFSNCEFFNEDDSEVGRAGHVMRAYFESRW 2761          

HSP 4 Score: 73.9442 bits (180), Expect = 4.770e-9
Identity = 37/81 (45.68%), Postives = 54/81 (66.67%), Query Frame = 1
Query: 2887 TASSSSLDD----------LEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSI 3099
            T SS+SL D          LE +IE L   V QK+ ++++C  +L G++LGQDRY+RN+Y+LKH+GGI+IE   SS+ M +
Sbjct: 1285 TVSSNSLSDDEDNMCKISELESKIETLNRTVEQKQKEIDECSSRLSGLYLGQDRYYRNYYVLKHMGGIYIE-GESSVSMHL 1364          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:103024561])

HSP 1 Score: 147.517 bits (371), Expect = 9.306e-35
Identity = 104/362 (28.73%), Postives = 184/362 (50.83%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGI----DLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSL 3087
            + K++Q+++E     ELKKP ED+ L +   LP    I G  LS   F+HC++V EFL+S+  VLG+    D+ ++ T+Q   +   N   E L     LL++L++  + DPG+       +++G K  +LE+  NT+S VLR F+ +   G E E+   L    ++ L  + +A +L F++ E+  S  +  EVD  LE  +  R++KWI++GKLR+LK    +K     G     ++       +   + + + + +   N  +               +T         E E+ +++++ +LE+ I++LT + +  +  L Q  H +R + LGQDRY R ++LL  +G + +E A   L
Sbjct: 1441 ERKRQQQILE-----ELKKPAEDMCLTDHTPLPELSRIPGLALSGVTFSHCVIVVEFLHSYGKVLGLQVPKDIPSLATLQKGLLDVGNSQKELLD----LLVKLMEAVLIDPGLPPYYQSVKILGEKLVDLELTHNTVSEVLRIFLESH--GFELEVCNTLRTKSFQTLCPEVKASILAFLVEELNASNTVIREVDNSLENMATYRKNKWIIEGKLRKLKAALLKK----TGLSEEQLSYEDRRRSTRMGVAEEESLEE---NSRLKRGGRRRRRPKEEPKLT---------EAESPNNATVPELERHIDKLTKRQVFFRKKLQQSSHSMRAMALGQDRYRRRYWLLPRIGCVLVEGAEDIL 1775          

HSP 2 Score: 106.686 bits (265), Expect = 2.208e-22
Identity = 49/129 (37.98%), Postives = 76/129 (58.91%), Query Frame = 1
Query: 4552 SVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICA 4938
            S+ S +TP  L  WR+++    +  QL  C+  L  AIAW+KSI++V CQ CRK  N+  LLLCD CD+G+H +C +P ++ +PEG WFC +C++K   +        P++AR       +R ++   A
Sbjct: 2284 SMESEITP-RLMLWRQALDRCRSASQLALCLLQLERAIAWEKSIVRVTCQFCRKGDNDECLLLCDGCDRGWHMFCLKPKVTEVPEGDWFCPNCIAKGIGEG----PRSPRSARQRTNARKRRFVYGAEA 2407          

HSP 3 Score: 80.4925 bits (197), Expect = 2.179e-14
Identity = 45/103 (43.69%), Postives = 65/103 (63.11%), Query Frame = 1
Query: 5440 STLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +T ++ +   C   L+E+      +PFL PV+ + VP Y++++K PMDF T+  KL    Y S  EF  D +L+FNNCE FNED S++G AGH++R FFE  W
Sbjct: 2443 ATRNQPDLTYCEIILMEMEAHADAWPFLEPVNPRLVPGYRRIVKNPMDFLTMREKLLQGGYCSCEEFAADAQLVFNNCELFNEDSSEVGVAGHSMRRFFESRW 2545          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:103024561])

HSP 1 Score: 147.517 bits (371), Expect = 9.595e-35
Identity = 104/362 (28.73%), Postives = 184/362 (50.83%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGI----DLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSL 3087
            + K++Q+++E     ELKKP ED+ L +   LP    I G  LS   F+HC++V EFL+S+  VLG+    D+ ++ T+Q   +   N   E L     LL++L++  + DPG+       +++G K  +LE+  NT+S VLR F+ +   G E E+   L    ++ L  + +A +L F++ E+  S  +  EVD  LE  +  R++KWI++GKLR+LK    +K     G     ++       +   + + + + +   N  +               +T         E E+ +++++ +LE+ I++LT + +  +  L Q  H +R + LGQDRY R ++LL  +G + +E A   L
Sbjct: 1441 ERKRQQQILE-----ELKKPAEDMCLTDHTPLPELSRIPGLALSGVTFSHCVIVVEFLHSYGKVLGLQVPKDIPSLATLQKGLLDVGNSQKELLD----LLVKLMEAVLIDPGLPPYYQSVKILGEKLVDLELTHNTVSEVLRIFLESH--GFELEVCNTLRTKSFQTLCPEVKASILAFLVEELNASNTVIREVDNSLENMATYRKNKWIIEGKLRKLKAALLKK----TGLSEEQLSYEDRRRSTRMGVAEEESLEE---NSRLKRGGRRRRRPKEEPKLT---------EAESPNNATVPELERHIDKLTKRQVFFRKKLQQSSHSMRAMALGQDRYRRRYWLLPRIGCVLVEGAEDIL 1775          

HSP 2 Score: 106.686 bits (265), Expect = 2.377e-22
Identity = 49/129 (37.98%), Postives = 76/129 (58.91%), Query Frame = 1
Query: 4552 SVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICA 4938
            S+ S +TP  L  WR+++    +  QL  C+  L  AIAW+KSI++V CQ CRK  N+  LLLCD CD+G+H +C +P ++ +PEG WFC +C++K   +        P++AR       +R ++   A
Sbjct: 2262 SMESEITP-RLMLWRQALDRCRSASQLALCLLQLERAIAWEKSIVRVTCQFCRKGDNDECLLLCDGCDRGWHMFCLKPKVTEVPEGDWFCPNCIAKGIGEG----PRSPRSARQRTNARKRRFVYGAEA 2385          

HSP 3 Score: 80.4925 bits (197), Expect = 2.250e-14
Identity = 45/103 (43.69%), Postives = 65/103 (63.11%), Query Frame = 1
Query: 5440 STLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +T ++ +   C   L+E+      +PFL PV+ + VP Y++++K PMDF T+  KL    Y S  EF  D +L+FNNCE FNED S++G AGH++R FFE  W
Sbjct: 2421 ATRNQPDLTYCEIILMEMEAHADAWPFLEPVNPRLVPGYRRIVKNPMDFLTMREKLLQGGYCSCEEFAADAQLVFNNCELFNEDSSEVGVAGHSMRRFFESRW 2523          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Match: baz2ba (bromodomain adjacent to zinc finger domain, 2Ba [Source:ZFIN;Acc:ZDB-GENE-070615-37])

HSP 1 Score: 137.502 bits (345), Expect = 9.129e-32
Identity = 77/232 (33.19%), Postives = 137/232 (59.05%), Query Frame = 1
Query: 1999 KTDKYKHKKEQKL----IEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTE-YKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            K D+ +  +E+KL    +E  + +E+KKP ED+ L + + LP F  I+G  L    F+ CLVV +FL SF  VLGID+  +PT+   Q   +N    S+  +  LL+ LL  AVCDPG+   +    ++G   + + +N + +S VL+ ++ A     E    A  + T+ ++  +  ++A +L F++NE+  S+ + SE+DK L+Q +++R+D+ I++GKL++LK   +++
Sbjct: 1105 KRDEKRLNRERKLELRRLELEMIREMKKPNEDMCLTDHKPLPEFSRIQGLVLPGQVFSDCLVVVQFLRSFGKVLGIDVSDLPTLGVLQEGLLNLG-NSMGQVQDLLVRLLSCAVCDPGLPPGQRTKSILGDHLTNMGLNRDNVSEVLQQYMEAHCSQTEMADVALSLKTKAFQAHTPAQKASVLAFLVNELACSKSVVSEIDKSLDQMNVLRKDECIVEGKLKKLKTIHAKR 1335          

HSP 2 Score: 122.479 bits (306), Expect = 3.486e-27
Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQ 4851
            P +  WRK++ E  N  QL  C++ L  +IAW++SIMKV CQICRK  NE  LLLCD CD+G HTYC +P +S IPEG W+C  C+SKA+ Q
Sbjct: 2039 PGMKVWRKALSEVKNSSQLAMCLQQLQKSIAWERSIMKVYCQICRKGDNEDLLLLCDGCDKGCHTYCHKPKISTIPEGDWYCPACISKASGQ 2130          

HSP 3 Score: 88.9669 bits (219), Expect = 5.160e-17
Identity = 50/93 (53.76%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+KVIK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct: 2225 CRVLLAELERHQDAWPFLTPVNLKSVPGYRKVIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 2317          

HSP 4 Score: 61.6178 bits (148), Expect = 9.725e-9
Identity = 26/65 (40.00%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +EDE   ++S+++LEK+IE+++ Q+   +  L + +H LR +  GQDRY R +++L   GG+FIE
Sbjct: 1402 DEDEGDQATSIEELEKQIEKVSKQLNLIRRKLFESNHALRSMSYGQDRYRRRYWVLPQCGGVFIE 1466          

HSP 5 Score: 60.4622 bits (145), Expect = 2.411e-8
Identity = 26/71 (36.62%), Postives = 46/71 (64.79%), Query Frame = 1
Query: 1552 NYQKPLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            + + PL+ GW+RET +K++   L GDV Y  P G ++   P + + +SR  IS+++ +NFSF   +++GD+
Sbjct:  803 DLKSPLEMGWRRETRIKAVAGRLQGDVAYYAPCGKRLRQYPDVVKYLSRYGISDITRDNFSFSAKIRVGDF 873          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Match: ENSAMXT00000010217.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:378618:383521:-1 gene:ENSAMXG00000009943.2 transcript:ENSAMXT00000010217.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.142e-25
Identity = 91/275 (33.09%), Postives = 132/275 (48.00%), Query Frame = 1
Query: 4069 EQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPE-------------KAVFDDTIKVIPSDTLKR--FNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATD 4848
            E+H+  L +I  L++VE+L   V +ASL  KGW  PE             KAV ++  +  P+D L+         PLD+A  R                         LS  + S  R+ L   +S++             +D+  ++ T  +P+   S D D  +   LA            P +  WRK++ E  +  QL  C++ L  +IAW++SIMKV CQ+CRK  NE  LLLCD CD+G HTYC +P +S IPEG WFC  C++KA+D
Sbjct:   22 EEHAMDL-DIAVLQQVEELERRVTSASLQVKGWMPPEPQSEREDLVYYQHKAVSENDSE--PADKLETSIVRHANNPLDIAVAR-------------------------LSELERSIERRYLKSPLSTTIQI---------TLDNVGTV-TVPAPAPSPSADGDGGEEE-LA------------PGMKQWRKALSEVRSGAQLSLCLQQLQRSIAWERSIMKVYCQMCRKGDNEELLLLCDGCDKGCHTYCHKPQISTIPEGDWFCPACIAKASD 245          

HSP 2 Score: 88.1965 bits (217), Expect = 1.769e-17
Identity = 49/97 (50.52%), Postives = 68/97 (70.10%), Query Frame = 1
Query: 5458 EFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            + E CR  L E+      +PF+ PV+ K VP Y+KVIK PMDFST+  KLS+  Y++   F+ D+ L+F+NCE+FNED SDIG+AGH +R FF++ W
Sbjct:  333 DLELCRLLLAELQSHQDAWPFMIPVNPKSVPGYRKVIKKPMDFSTIREKLSNSQYQNLETFIIDVNLVFDNCEKFNEDHSDIGRAGHNMRRFFQRRW 429          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Match: baz1a (bromodomain adjacent to zinc finger domain, 1A [Source:ZFIN;Acc:ZDB-GENE-030131-6105])

HSP 1 Score: 84.7297 bits (208), Expect = 9.455e-16
Identity = 34/92 (36.96%), Postives = 53/92 (57.61%), Query Frame = 1
Query: 4582 LADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKL 4857
            L  WR+S+L  ++  QL   + TL  ++ W KSI+   C++CRK  +   +LLCD CD+ +H +C RP L  +P   WFC +C  K    ++
Sbjct: 1015 LERWRESLLGCSSLSQLFLHLSTLERSVIWAKSILNARCKVCRKKGDCENMLLCDGCDRSHHIFCVRPKLKAVPTEDWFCPECRPKQRSHRI 1106          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008180.1 (pep scaffold:Pmarinus_7.0:GL476358:693784:714018:-1 gene:ENSPMAG00000007373.1 transcript:ENSPMAT00000008180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 1.246e-32
Identity = 82/227 (36.12%), Postives = 130/227 (57.27%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDL-DTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILAR----AVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            + K E + +E  I+ ELKKP ED+ L   + +P    + G  L  SAF  CL+V EFL SF  VLG+D+   +P++   Q   +NR   +   +  L M LL+  + DPG+ +      V+G +  ++E+   TLS VLR F+ AR    A+ +    +A+L +T        ++A +L F+ +E+L SR ++SE+DK ++  S +RRDKWI++GKLR L+   SR+
Sbjct:  424 ERKMEMRRLEMQIAMELKKPNEDMCLSEHKPMPDLPRMPGLVLPGSAFADCLMVVEFLRSFGKVLGLDVVREVPSIAALQEGLLNRGDTATSELLDLTMRLLRAVLRDPGLPHAFKDATVLGCRLRDMELTRETLSEVLRIFLEARSFSAALVSSFRTKAFLAHTP------SQKASVLAFLCDELLCSRTVTSEIDKNIDHISSLRRDKWIVEGKLRTLRSKHSRR 644          

HSP 2 Score: 62.003 bits (149), Expect = 1.732e-9
Identity = 23/67 (34.33%), Postives = 49/67 (73.13%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSLNE-LVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL +GW+RET ++++ + L G+V+Y TP G K+   P++ + ++R +I++++ ++FSF   +++GD+
Sbjct:  128 PLDHGWRRETRIQTIGDRLHGEVLYYTPCGRKLRQYPEVNKFLTRNRITDINRQSFSFSAKMRVGDF 194          

HSP 3 Score: 56.9954 bits (136), Expect = 5.051e-8
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSS 3084
            EE E A+SS  ++ +K++E+L  Q    +  L +  H LR +  GQDRY R +++L H GG+F+E   S+
Sbjct:  732 EEKEMAASS--NEFQKQMEKLNKQQNLYRRKLFEASHSLRALTFGQDRYRRRYWVLPHCGGLFVEAMESA 799          

HSP 4 Score: 50.447 bits (119), Expect = 4.997e-6
Identity = 37/144 (25.69%), Postives = 65/144 (45.14%), Query Frame = 1
Query: 3754 IPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKA 4185
            IP  ++  W  + D + I  +L +LH RGIRE++L + +++H                +Y C   +          + R S+    G K      L  ++ S   E+ + +  ++  L  VE+L   V +AS+  KGW+ PE+A
Sbjct: 1105 IPQDLRHGWWRVTDTDTIHSVLKALHPRGIREKALQKQLQKH---------------LDYTCQACA----------RHRDSACRDKGEKAECV--LRREVASWSVEEQA-FQVDLAVLRLVEELEERVASASMQVKGWRCPERA 1220          

HSP 5 Score: 50.0618 bits (118), Expect = 7.060e-6
Identity = 21/39 (53.85%), Postives = 28/39 (71.79%), Query Frame = 1
Query: 4576 PELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKV 4692
            P L DWR+++L A N  Q+  C++ L  AIAW+KSIMKV
Sbjct: 1287 PGLRDWRRALLCAQNASQVALCLQQLEKAIAWEKSIMKV 1325          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 67.0106 bits (162), Expect = 4.530e-11
Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTA 4887
            C +C +  +EA+LLLCD CD  YHT+C  PPL  +P+G W C  CV++         C +P+ A
Sbjct:  323 CLVCGRGDDEAKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAQE--------CSKPQEA 378          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Match: kdm5c (lysine (K)-specific demethylase 5C [Source:ZFIN;Acc:ZDB-GENE-060810-94])

HSP 1 Score: 64.3142 bits (155), Expect = 2.235e-10
Identity = 28/66 (42.42%), Postives = 40/66 (60.61%), Query Frame = 1
Query: 4642 MRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSK 4839
            MR  T A++  + I   +C +C +   E +LLLCD CD  YHT+C  PPL  +P+G W C  CV++
Sbjct:  299 MRQRTGALS-AQFIEMYVCLVCGRGDEEDKLLLCDGCDDSYHTFCLIPPLQDVPKGDWRCPKCVAE 363          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002602.1 (pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 gene:ENSPMAG00000002341.1 transcript:ENSPMAT00000002602.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 1.945e-9
Identity = 31/110 (28.18%), Postives = 47/110 (42.73%), Query Frame = 1
Query: 4705 CRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVS-----------------------------KATDQKLCYVCGQPKTARTT----VCMVCKRMLHAIC 4935
            C +  +++++L+CD+CD+G+HTYC RP +  IP+  W C  C S                             +    + C VCG+    R       C  C RM+HA C
Sbjct:  264 CMQPGDDSKMLVCDACDKGFHTYCLRPAMQSIPKNTWKCKHCRSCSDCGSRSAGAEPGSRWHRDYSLCERCHQQRASGRACPVCGRAHGRRPASTLLACQRCSRMVHAEC 373          

HSP 2 Score: 60.077 bits (144), Expect = 6.810e-9
Identity = 32/106 (30.19%), Postives = 42/106 (39.62%), Query Frame = 1
Query: 4693 LCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCV-----------------------SKATDQKLCYVCGQPKTARTTV--CMVCKRMLHAIC 4935
            +C+ C    +  +LLLCD CD  YH YC  PPL  +P+G W C  CV                       +  T    C VC Q    +  +  C  C R +H  C
Sbjct:  854 VCESCGLTSDPGRLLLCDDCDISYHIYCLEPPLHTVPKGGWKCKWCVCCLQCGASEPGFRCEWQNNHTQCAPCTSLSTCPVCSQAYREQQLIVQCRQCDRWMHGSC 959          

HSP 3 Score: 54.6842 bits (130), Expect = 3.022e-7
Identity = 30/99 (30.30%), Postives = 42/99 (42.42%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQP-KTARTTVCMVCKRMLHAICAKPTMTRVPRK-WTCHNC 4986
            C +C +       L C SC Q YH  C     S      W C +C    T++K    C QP   ++  VC  C +  H  C +P M  +P+  W C +C
Sbjct:  214 CVVCDQPGELHNQLFCTSCGQHYHGRCLEIAPSTAIRAGWQCPEC---KTNKK----CMQPGDDSKMLVCDACDKGFHTYCLRPAMQSIPKNTWKCKHC 305          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Match: dpf2 (D4, zinc and double PHD fingers family 2 [Source:ZFIN;Acc:ZDB-GENE-041024-2])

HSP 1 Score: 60.4622 bits (145), Expect = 2.026e-9
Identity = 30/71 (42.25%), Postives = 39/71 (54.93%), Query Frame = 1
Query: 4636 ACMRTLTNAIAWDKS-----IMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCV 4833
            +C++  +N IA  K+     I    C IC    N+ QLL CD CD+GYH YC  P +S  PEG W C  C+
Sbjct:  321 SCLQFTSNMIAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLSPAMSEPPEGSWSCRLCL 391          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Yeast
Match: JHD2 (JmjC domain family histone demethylase; promotes global demethylation of H3K4 and repression of noncoding intergenic transcription during sporulation; removes methyl groups added by Set1p methyltransferase; negatively regulated by H3K14 acetylation; protein levels regulated by Not4p polyubiquitin-mediated degradation; regulates sporulation timing by extending period of active transcription in opposition to programmed global transcriptional quiescence; regulates rDNA silencing [Source:SGD;Acc:S000003880])

HSP 1 Score: 60.077 bits (144), Expect = 2.930e-9
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCV 4833
            C +CRK  +  + +LCDSCD+ +H YC  PPL  +P G W C+ C+
Sbjct:  238 CIVCRKTNDPKRTILCDSCDKPFHIYCLSPPLERVPSGDWICNTCI 283          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Yeast
Match: BDF1 (Protein involved in transcription initiation; functions at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p; BDF1 has a paralog, BDF2, that arose from the whole genome duplication [Source:SGD;Acc:S000004391])

HSP 1 Score: 59.6918 bits (143), Expect = 3.825e-9
Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 1
Query: 5575 PMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            PMD  T+A+KL+D+ Y++  +F  D+RL+F NC  FN D + +   GH L   F   W
Sbjct:  361 PMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKW 418          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Yeast
Match: BDF2 (Protein involved in transcription initiation; acts at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p; protein abundance increases in response to DNA replication stress; BDF2 has a paralog, BDF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002228])

HSP 1 Score: 58.5362 bits (140), Expect = 8.751e-9
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query: 5422 SSVPSNSTLSETEFENCRKFLLEIL-----DLNLVYPFLRXXXXXXXXXXX--XXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWM 5751
            +S P + TL + +F  C K L  ++     D+N  +PFL+PVD   + +     V+K PMD  T++  L ++ YK+ ++F++DL L+F NC QFN + +++   G  L+  F  HW+
Sbjct:  311 NSKPKSKTL-QKKFRTCLKILKVLMSKKNSDIN--FPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLKELFNFHWL 424          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 49.6766 bits (117), Expect = 3.550e-6
Identity = 33/89 (37.08%), Postives = 51/89 (57.30%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFF 5736
             +  L E+ +    +PFL+PV+ ++VP Y   IK PMD ST+  KL    Y+   +F+ D RL+FNNC  +N +++   K  + L  FF
Sbjct:  336 IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFF 424          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Match: EDO44814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU7])

HSP 1 Score: 113.62 bits (283), Expect = 4.061e-27
Identity = 48/84 (57.14%), Postives = 57/84 (67.86%), Query Frame = 1
Query: 4582 LADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCV 4833
            L  WR ++   +N  QL  C+  L   IAWDKSIMKV CQ+CRK  NE  LLLCD CD+GYHTYC  P L+ IPEG W+C DC+
Sbjct:   64 LKVWRAAVASVSNASQLAMCLSMLVGYIAWDKSIMKVFCQMCRKGDNEELLLLCDGCDRGYHTYCCMPKLTTIPEGDWYCMDCI 147          

HSP 2 Score: 83.5741 bits (205), Expect = 5.746e-17
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+   +  +PFL PV+ K+ P Y K+I+ PMDF T+  KL D+ Y S  EF  D RL+F NCE+FNEDDS++G+AG  L  FFE  W
Sbjct:  218 CRTILAEMEKHDDAWPFLIPVNAKQFPEYYKIIRKPMDFHTMKIKLRDYQYSSPQEFAQDSRLVFANCEEFNEDDSEVGQAGKRLSKFFESRW 310          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Match: EDO44815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU8])

HSP 1 Score: 83.1889 bits (204), Expect = 9.463e-18
Identity = 59/188 (31.38%), Postives = 103/188 (54.79%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLI 2574
            + K EQK  E  +++ELKKPVED+ L +++ LP    +    L   AF   L+V EF+++F   L ID    +P++ D Q++ + +  +    +  L   LL  A+ DPG      +T+ +G    ++E+  N  S +LR F+++R  G  +E+   L    ++ LS  ++  +L F++NE+L SR+I
Sbjct:   18 ERKLEQKRRELILTRELKKPVEDMVLRDAKPLPEIPRLSKCILPGKAFADLLMVEEFVHNFGGALDIDPAAEMPSISDMQLSMLCQGED---VLLPLCQLLLTQAMADPGCDGPYAVTK-LGQPLHKVELTDNNTSEILRLFVMSRN-GGPNELSDALEEQPFQSLSPVQKGSVLAFLVNELLCSRVI 200          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Match: EDO44054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWY0])

HSP 1 Score: 73.9442 bits (180), Expect = 2.557e-14
Identity = 25/48 (52.08%), Postives = 36/48 (75.00%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSK 4839
            C++CR+  +  ++LLCD+CD+G+H YC +PP+  IPEG WFC DC  K
Sbjct:    1 CKLCRRKGDAEKMLLCDACDRGHHMYCLKPPIKHIPEGNWFCPDCRPK 48          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Match: EDO37588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA6])

HSP 1 Score: 62.7734 bits (151), Expect = 1.892e-10
Identity = 29/48 (60.42%), Postives = 33/48 (68.75%), Query Frame = 1
Query: 4693 LCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVS 4836
            LC+ C K  +EA+LLLCDSCD  YHTYC  PPL  +P G W C  CVS
Sbjct:   51 LCEGCGKGSDEARLLLCDSCDISYHTYCLDPPLEKVPPGGWKCKWCVS 98          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Match: EDO41238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z1])

HSP 1 Score: 60.077 bits (144), Expect = 2.963e-9
Identity = 23/45 (51.11%), Postives = 27/45 (60.00%), Query Frame = 1
Query: 4696 CQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC 4830
            C +C    N+ QLL CD CD+GYH YC  PP+   PEG W C  C
Sbjct:  249 CTLCGTSDNDDQLLFCDDCDRGYHMYCLNPPMDKPPEGHWMCSLC 293          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Match: baz2ba (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:101156961])

HSP 1 Score: 130.954 bits (328), Expect = 9.287e-30
Identity = 73/225 (32.44%), Postives = 134/225 (59.56%), Query Frame = 1
Query: 2014 KHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE--SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            + K+EQ+ +E  I++ELKKP ED+ L + + LP F  I G  L   A + CL++  FL  F  VLG+D++  +PT+   Q   +N   +S+  +  L+++LL  AVCDPG+   +    ++G   + + +N + +S VL+ ++ A   GN   + +   L    ++  +  ++A +LGF+ NE+  S+ + SE+DK L+Q + +R+DK I++GKL++L+   +++
Sbjct: 1197 ERKQEQRRLELEIARELKKPNEDMCLSDHKALPEFSRIPGLILPGRAVSDCLMLMHFLRGFGKVLGLDMNVDVPTLGMLQEGLLNVG-DSMGQVQDLVVKLLSLAVCDPGLPPGQKTKTMLGDHLTNVGINRDNVSEVLQMYMGAH-CGNTDLAPLALSLKTKAFQAHTPAQKASILGFLANELACSKAVISEIDKNLDQMANLRKDKIIMEGKLKKLRTIYAKR 1419          

HSP 2 Score: 113.235 bits (282), Expect = 2.366e-24
Identity = 45/85 (52.94%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKAT 4845
            WRK++ E  +  QL  C++ L  +IAW++SIMKV CQ+C+K  NE  LLLCD CD+G HTYC +P ++ IPEG W+C  C+SKA+
Sbjct: 2143 WRKALSEVRSAAQLAMCIQQLQKSIAWERSIMKVYCQMCKKGDNEDLLLLCDGCDKGCHTYCHKPKITSIPEGDWYCPACISKAS 2227          

HSP 3 Score: 88.5817 bits (218), Expect = 7.872e-17
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+K+IK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct: 2325 CRVLLAELERHQDAWPFLTPVNLKSVPGYRKIIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 2417          

HSP 4 Score: 68.5514 bits (166), Expect = 7.603e-11
Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L +  H LR +  GQDRY R +++L H GG+FIE
Sbjct: 1487 DEDEVDQATSVEELEKQIEKLSKQHHQTRRKLFEISHSLRSMMYGQDRYRRRYWVLPHCGGVFIE 1551          

HSP 5 Score: 56.225 bits (134), Expect = 5.131e-7
Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++     G+V Y  P G K+   P + + ++R  IS ++ +NFSF   +++GD+
Sbjct:  911 PLELGWRRETRIKTVAGRPQGEVAYYAPCGKKLRQYPDVMKYLARNGISGITRDNFSFSAKIRVGDF 977          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Match: baz2ba (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:101156961])

HSP 1 Score: 130.954 bits (328), Expect = 9.868e-30
Identity = 73/224 (32.59%), Postives = 133/224 (59.38%), Query Frame = 1
Query: 2017 HKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE--SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
             K+EQ+ +E  I++ELKKP ED+ L + + LP F  I G  L   A + CL++  FL  F  VLG+D++  +PT+   Q   +N   +S+  +  L+++LL  AVCDPG+   +    ++G   + + +N + +S VL+ ++ A   GN   + +   L    ++  +  ++A +LGF+ NE+  S+ + SE+DK L+Q + +R+DK I++GKL++L+   +++
Sbjct: 1211 RKQEQRRLELEIARELKKPNEDMCLSDHKALPEFSRIPGLILPGRAVSDCLMLMHFLRGFGKVLGLDMNVDVPTLGMLQEGLLNVG-DSMGQVQDLVVKLLSLAVCDPGLPPGQKTKTMLGDHLTNVGINRDNVSEVLQMYMGAH-CGNTDLAPLALSLKTKAFQAHTPAQKASILGFLANELACSKAVISEIDKNLDQMANLRKDKIIMEGKLKKLRTIYAKR 1432          

HSP 2 Score: 113.235 bits (282), Expect = 2.369e-24
Identity = 45/85 (52.94%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKAT 4845
            WRK++ E  +  QL  C++ L  +IAW++SIMKV CQ+C+K  NE  LLLCD CD+G HTYC +P ++ IPEG W+C  C+SKA+
Sbjct: 2156 WRKALSEVRSAAQLAMCIQQLQKSIAWERSIMKVYCQMCKKGDNEDLLLLCDGCDKGCHTYCHKPKITSIPEGDWYCPACISKAS 2240          

HSP 3 Score: 88.5817 bits (218), Expect = 7.184e-17
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+K+IK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct: 2338 CRVLLAELERHQDAWPFLTPVNLKSVPGYRKIIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 2430          

HSP 4 Score: 68.9366 bits (167), Expect = 7.481e-11
Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L +  H LR +  GQDRY R +++L H GG+FIE
Sbjct: 1500 DEDEVDQATSVEELEKQIEKLSKQHHQTRRKLFEISHSLRSMMYGQDRYRRRYWVLPHCGGVFIE 1564          

HSP 5 Score: 56.225 bits (134), Expect = 5.091e-7
Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++     G+V Y  P G K+   P + + ++R  IS ++ +NFSF   +++GD+
Sbjct:  911 PLELGWRRETRIKTVAGRPQGEVAYYAPCGKKLRQYPDVMKYLARNGISGITRDNFSFSAKIRVGDF 977          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Match: baz2ba (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:101156961])

HSP 1 Score: 130.954 bits (328), Expect = 1.102e-29
Identity = 73/224 (32.59%), Postives = 133/224 (59.38%), Query Frame = 1
Query: 2017 HKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE--SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
             K+EQ+ +E  I++ELKKP ED+ L + + LP F  I G  L   A + CL++  FL  F  VLG+D++  +PT+   Q   +N   +S+  +  L+++LL  AVCDPG+   +    ++G   + + +N + +S VL+ ++ A   GN   + +   L    ++  +  ++A +LGF+ NE+  S+ + SE+DK L+Q + +R+DK I++GKL++L+   +++
Sbjct: 1220 RKQEQRRLELEIARELKKPNEDMCLSDHKALPEFSRIPGLILPGRAVSDCLMLMHFLRGFGKVLGLDMNVDVPTLGMLQEGLLNVG-DSMGQVQDLVVKLLSLAVCDPGLPPGQKTKTMLGDHLTNVGINRDNVSEVLQMYMGAH-CGNTDLAPLALSLKTKAFQAHTPAQKASILGFLANELACSKAVISEIDKNLDQMANLRKDKIIMEGKLKKLRTIYAKR 1441          

HSP 2 Score: 113.235 bits (282), Expect = 2.312e-24
Identity = 45/85 (52.94%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKAT 4845
            WRK++ E  +  QL  C++ L  +IAW++SIMKV CQ+C+K  NE  LLLCD CD+G HTYC +P ++ IPEG W+C  C+SKA+
Sbjct: 2165 WRKALSEVRSAAQLAMCIQQLQKSIAWERSIMKVYCQMCKKGDNEDLLLLCDGCDKGCHTYCHKPKITSIPEGDWYCPACISKAS 2249          

HSP 3 Score: 88.5817 bits (218), Expect = 7.372e-17
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+K+IK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct: 2347 CRVLLAELERHQDAWPFLTPVNLKSVPGYRKIIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 2439          

HSP 4 Score: 68.5514 bits (166), Expect = 7.741e-11
Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L +  H LR +  GQDRY R +++L H GG+FIE
Sbjct: 1509 DEDEVDQATSVEELEKQIEKLSKQHHQTRRKLFEISHSLRSMMYGQDRYRRRYWVLPHCGGVFIE 1573          

HSP 5 Score: 56.225 bits (134), Expect = 5.267e-7
Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++     G+V Y  P G K+   P + + ++R  IS ++ +NFSF   +++GD+
Sbjct:  911 PLELGWRRETRIKTVAGRPQGEVAYYAPCGKKLRQYPDVMKYLARNGISGITRDNFSFSAKIRVGDF 977          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Match: baz2ba (bromodomain adjacent to zinc finger domain 2B [Source:NCBI gene;Acc:101156961])

HSP 1 Score: 130.568 bits (327), Expect = 1.161e-29
Identity = 73/224 (32.59%), Postives = 133/224 (59.38%), Query Frame = 1
Query: 2017 HKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNE--SEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
             K+EQ+ +E  I++ELKKP ED+ L + + LP F  I G  L   A + CL++  FL  F  VLG+D++  +PT+   Q   +N   +S+  +  L+++LL  AVCDPG+   +    ++G   + + +N + +S VL+ ++ A   GN   + +   L    ++  +  ++A +LGF+ NE+  S+ + SE+DK L+Q + +R+DK I++GKL++L+   +++
Sbjct: 1166 RKQEQRRLELEIARELKKPNEDMCLSDHKALPEFSRIPGLILPGRAVSDCLMLMHFLRGFGKVLGLDMNVDVPTLGMLQEGLLNVG-DSMGQVQDLVVKLLSLAVCDPGLPPGQKTKTMLGDHLTNVGINRDNVSEVLQMYMGAH-CGNTDLAPLALSLKTKAFQAHTPAQKASILGFLANELACSKAVISEIDKNLDQMANLRKDKIIMEGKLKKLRTIYAKR 1387          

HSP 2 Score: 113.235 bits (282), Expect = 2.279e-24
Identity = 45/85 (52.94%), Postives = 62/85 (72.94%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKAT 4845
            WRK++ E  +  QL  C++ L  +IAW++SIMKV CQ+C+K  NE  LLLCD CD+G HTYC +P ++ IPEG W+C  C+SKA+
Sbjct: 2111 WRKALSEVRSAAQLAMCIQQLQKSIAWERSIMKVYCQMCKKGDNEDLLLLCDGCDKGCHTYCHKPKITSIPEGDWYCPACISKAS 2195          

HSP 3 Score: 88.5817 bits (218), Expect = 7.529e-17
Identity = 49/93 (52.69%), Postives = 66/93 (70.97%), Query Frame = 1
Query: 5470 CRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            CR  L E+      +PFL PV++K VP Y+K+IK PMDFST+  KL    Y++   F+ D+ L+F+NCE+FNED+SDIG+AGH +R FFEK W
Sbjct: 2293 CRVLLAELERHQDAWPFLTPVNLKSVPGYRKIIKKPMDFSTIREKLVSSQYQNLETFIIDVNLVFDNCEKFNEDNSDIGRAGHNMRKFFEKRW 2385          

HSP 4 Score: 68.5514 bits (166), Expect = 7.982e-11
Identity = 29/65 (44.62%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 2875 EEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            +EDE   ++S+++LEK+IE+L+ Q  Q +  L +  H LR +  GQDRY R +++L H GG+FIE
Sbjct: 1455 DEDEVDQATSVEELEKQIEKLSKQHHQTRRKLFEISHSLRSMMYGQDRYRRRYWVLPHCGGVFIE 1519          

HSP 5 Score: 56.225 bits (134), Expect = 5.124e-7
Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1564 PLKNGWKRETYLKSL-NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDY 1761
            PL+ GW+RET +K++     G+V Y  P G K+   P + + ++R  IS ++ +NFSF   +++GD+
Sbjct:  857 PLELGWRRETRIKTVAGRPQGEVAYYAPCGKKLRQYPDVMKYLARNGISGITRDNFSFSAKIRVGDF 923          
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Match: baz2a (bromodomain adjacent to zinc finger domain 2A [Source:NCBI gene;Acc:101161807])

HSP 1 Score: 130.183 bits (326), Expect = 1.609e-29
Identity = 74/221 (33.48%), Postives = 130/221 (58.82%), Query Frame = 1
Query: 2020 KKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDT-IPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRK 2679
            +K Q+LI    + ELKKP ED+ L + + LP    I G  LS +AF HCL V EFL+ +  ++G+D+   IP++   Q   +    +S   +  LL++L+  A+ DPG+ +     +++G K  ELE+  +T+S  LR F+ +   G ++E+   L    +  L  D +A +LGF++ E+ +S +++S++D  LE  +  R++KWI++ KLR+LK   +++
Sbjct: 1518 RKRQQLI----ADELKKPTEDMCLTDHKLLPELSRIPGLVLSGTAFAHCLCVVEFLHGYGKMIGLDVPKDIPSLATLQEGLLGLG-DSQGQVQDLLIKLVDAALHDPGLPSYYQSVKILGDKLVELELTRSTVSEALRIFLESH--GYKTEVCNSLRTKPFHALPPDTKASILGFLVEELNSSNVVTSDIDNTLENMTTYRKNKWIIEAKLRKLKAVLAKR 1731          

HSP 2 Score: 91.2781 bits (225), Expect = 1.037e-17
Identity = 41/83 (49.40%), Postives = 56/83 (67.47%), Query Frame = 1
Query: 4591 WRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSK 4839
            WR+++    +  QL  C+  L  AIAW++SI KV CQ+CRK  N+  LLLCDSCD+G H YC +P ++ +PEG WFC  C +K
Sbjct: 2401 WRQALDRCRSAPQLCLCLLQLEKAIAWERSITKVTCQVCRKGDNDECLLLCDSCDRGCHMYCLKPKITQVPEGDWFCPTCTAK 2483          

HSP 3 Score: 81.2629 bits (199), Expect = 1.372e-14
Identity = 45/103 (43.69%), Postives = 67/103 (65.05%), Query Frame = 1
Query: 5440 STLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHW 5748
            +T ++ +   C   L+E+      +PFL PV+ + VP Y+++IK PMDF T+  +L   +Y S +EF  D +L+FNNCE FNED S++G AGH++R FFE  W
Sbjct: 2548 TTRNQPDLAFCEIILMEMEAHRDAWPFLEPVNPRLVPGYRRIIKNPMDFLTMRERLLQGMYCSCDEFAADAQLVFNNCELFNEDTSEVGMAGHSMRRFFESRW 2650          

HSP 4 Score: 55.0694 bits (131), Expect = 1.160e-6
Identity = 23/62 (37.10%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 2884 ETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIE 3069
            E+ + +S+ +LE++I++LT +    +  L Q  H +R + LGQDRY R +  L HLG + +E
Sbjct: 1783 ESPAVASIPELERQIDKLTKRQAFFRKKLLQTSHSMRVVMLGQDRYRRRYLALPHLGAVLVE 1844          
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 3522.64 bits (9133), Expect = 0.000e+0
Identity = 1898/1901 (99.84%), Postives = 1898/1901 (99.84%), Query Frame = 1
Query:  109 MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPEAKNESLNYLNVFEKPYQASGSTPITSCYLLGEXXXXXXXXXXXXVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPXXXXXXXXXIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCXXXXXXXXXXXXXXXXXXXXAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTXXXXXXXXXXXXXXXXWQFXXXXXXXXXXXXXMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI 5811
            MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFSRNSSPVYSRSNSSNPGRGRGRPPKSLGSRSSLSFPE KNESLNYLNVFEKPYQASGSTPITSCYLLGESTSRSSPSSNISVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPKKSTSSTSSIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRD ESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTISNNINSISNNNLSASNITDSQIIPDPDCNISVADVDSDLDSVDSNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKERLLELEDQLERRYLLPPLNWEFKPKVLSTTKESHLRKTLN VVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCSELSVSCPNSNSSTTTSDFNAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTKSNKSISSDCSKSKNDWQFKESSSGKEEKSPSMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI
Sbjct:    1 MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFSRNSSPVYSRSNSSNPGRGRGRPPKSLGSRSSLSFPETKNESLNYLNVFEKPYQASGSTPITSCYLLGESTSRSSPSSNISVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPKKSTSSTSSIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKKEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDQESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTISNNINSISNNNLSASNITDSQIIPDPDCNISVADVDSDLDSVDSNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKERLLELEDQLERRYLLPPLNWEFKPKVLSTTKESHLRKTLNDVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCSELSVSCPNSNSSTTTSDFNAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTKSNKSISSDCSKSKNDWQFKESSSGKEEKSPSMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI 1901          
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 3518.01 bits (9121), Expect = 0.000e+0
Identity = 1898/1902 (99.79%), Postives = 1898/1902 (99.79%), Query Frame = 1
Query:  109 MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPEAKNESLNYLNVFEKPYQASGSTPITSCYLLGEXXXXXXXXXXXXVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPXXXXXXXXXIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKK-EQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTXXXXXXXXXXXXXXXXXXTDSQIIPDPDCNIXXXXXXXXXXXXXXNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKXXXXXXXXXXXXXXXXPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCXXXXXXXXXXXXXXXXXXXXAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTXXXXXXXXXXXXXXXXWQFXXXXXXXXXXXXXMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRXXXXXXXXXXXXXXXTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI 5811
            MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFSRNSSPVYSRSNSSNPGRGRGRPPKSLGSRSSLSFPE KNESLNYLNVFEKPYQASGSTPITSCYLLGESTSRSSPSSNISVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPKKSTSSTSSIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKK EQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRD ESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTISNNINSISNNNLSASNITDSQIIPDPDCNISVADVDSDLDSVDSNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKERLLELEDQLERRYLLPPLNWEFKPKVLSTTKESHLRKTLN VVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCSELSVSCPNSNSSTTTSDFNAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTKSNKSISSDCSKSKNDWQFKESSSGKEEKSPSMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI
Sbjct:    1 MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMRLSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNFNWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGATSINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVRIPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQNSFYSKSQSKEFSRNSSPVYSRSNSSNPGRGRGRPPKSLGSRSSLSFPETKNESLNYLNVFEKPYQASGSTPITSCYLLGESTSRSSPSSNISVAKSSIPVTSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNPKKSTSSTSSIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYPEDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSLNELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGDYLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMENDFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKKVEQKLIEAHISKELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVLGIDLDTIPTMQDYQMAFVNRDQESLHTICWLLMELLKFAVCDPGITNTKLITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDLSEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRLKLFQSRKLYCANGTISNNINSISNNNLSASNITDSQIIPDPDCNISVADVDSDLDSVDSNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQKKNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPDYILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLKIELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGKGKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRDCNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADKELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSLYRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQIGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHKKGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKERLLELEDQLERRYLLPPLNWEFKPKVLSTTKESHLRKTLNDVVSSSCGFEDGAESTSSFIDDTRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSILEANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMVCKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSLSNCSELSVSCPNSNSSTTTSDFNAAYSSVKQSLCSNIAFSNILYKKRSCKRVLDSQNAGAINKKRIKRISTDTKSNKSISSDCSKSKNDWQFKESSSGKEEKSPSMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVRI 1902          
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Match: SMESG000002851.1 (SMESG000002851.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.368e-18
Identity = 62/202 (30.69%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 4510 TDNKKSSTLASKLESVNSSV--TPPELADWRKSILEANNDKQLLACMRTLTN----AIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC--VSKATD------------------------------QKLCYVC----GQPKTARTTVCMVCKRMLHAICAKPTMTRVPR-KWTCHNC 4986
            T N+   TL S    V+      P + A+ R   L A    Q  A +  L +     + W KS     C++CRK  +E  +LLCDSC+  +HT+C RP L  IPEG+WFC  C  VS+A D                              Q+ C+VC    G+ + A+   C  C ++ HA C +P + ++ R  W C  C
Sbjct:  962 TLNEMKETLVSVFLGVHERFWNVPLKSANGRNEFLNAVEQAQTQARLNMLQSFLDACVCWSKSAKDDKCRVCRKASDENSMLLCDSCNHAFHTFCLRPALHDIPEGEWFCPHCKPVSRARDADSDTVAMTFVPPAHSVTQSIKSKTRQNSHQEQCFVCHSSNGEQQLAK---CTSCNKLFHAHCHEPPLRQIRRTNWHCCQC 1160          
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.000e-13
Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 1
Query: 4657 NAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC 4830
            N    +  I+   C+IC    N+ QLLLCD+C++GYH YC   PLS IPEG WFC +C
Sbjct:  162 NGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLADPLSEIPEGDWFCEEC 219          
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Match: SMESG000045165.1 (SMESG000045165.1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.175e-13
Identity = 29/58 (50.00%), Postives = 37/58 (63.79%), Query Frame = 1
Query: 4657 NAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQGYHTYCFRPPLSGIPEGQWFCHDC 4830
            N    +  I+   C+IC    N+ QLLLCD+C++GYH YC   PLS IPEG WFC +C
Sbjct:  158 NGDGDNDEILNTTCEICNLGNNDHQLLLCDNCNRGYHIYCLADPLSEIPEGDWFCEEC 215          
The following BLAST results are available for this feature:
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BAZ2B1.809e-3134.53bromodomain adjacent to zinc finger domain 2B [Sou... [more]
BAZ2B2.127e-3134.84bromodomain adjacent to zinc finger domain 2B [Sou... [more]
BAZ2A1.845e-3034.47bromodomain adjacent to zinc finger domain 2A [Sou... [more]
BAZ2A1.873e-3034.47bromodomain adjacent to zinc finger domain 2A [Sou... [more]
BAZ2A1.874e-3034.47bromodomain adjacent to zinc finger domain 2A [Sou... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz-29.098e-2725.14Bromodomain Adjacent to Zinc finger domain, 2A/2B,... [more]
let-4181.889e-1030.91pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-33.448e-1030.00Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
set-161.462e-834.62Histone-lysine N-methyltransferase [Source:UniPro... [more]
athp-21.038e-629.35AT Hook plus PHD finger transcription factor [Sou... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tou1.520e-3644.83gene:FBgn0033636 transcript:FBtr0088091[more]
tou1.247e-2744.92gene:FBgn0033636 transcript:FBtr0333071[more]
tou1.337e-2744.92gene:FBgn0033636 transcript:FBtr0113066[more]
tou1.364e-2744.92gene:FBgn0033636 transcript:FBtr0333070[more]
tou3.882e-1951.55gene:FBgn0033636 transcript:FBtr0088094[more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz2a1.489e-3629.79bromodomain adjacent to zinc finger domain, 2A [So... [more]
baz2ba2.872e-2855.43bromodomain adjacent to zinc finger domain, 2Ba [S... [more]
baz2ba8.563e-2730.60bromodomain adjacent to zinc finger domain, 2Ba [S... [more]
baz2ba1.007e-2630.60bromodomain adjacent to zinc finger domain, 2Ba [S... [more]
baz2ba1.473e-2630.60bromodomain adjacent to zinc finger domain, 2Ba [S... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BAZ2A1.722e-4131.82bromodomain adjacent to zinc finger domain 2A [Sou... [more]
BAZ2A1.889e-4131.82bromodomain adjacent to zinc finger domain 2A [Sou... [more]
BAZ2A1.545e-4031.88bromodomain adjacent to zinc finger domain 2A [Sou... [more]
BAZ2B8.851e-3827.51bromodomain adjacent to zinc finger domain 2B [Sou... [more]
BAZ2B8.853e-3827.51bromodomain adjacent to zinc finger domain 2B [Sou... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Baz2a1.233e-3831.08bromodomain adjacent to zinc finger domain, 2A [So... [more]
Baz2a1.285e-3831.08bromodomain adjacent to zinc finger domain, 2A [So... [more]
Baz2a1.285e-3831.08bromodomain adjacent to zinc finger domain, 2A [So... [more]
Baz2a1.285e-3831.08bromodomain adjacent to zinc finger domain, 2A [So... [more]
Baz2a1.297e-3831.08bromodomain adjacent to zinc finger domain, 2A [So... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B7ZS37|BAZ2A_XENLA8.605e-3931.44Bromodomain adjacent to zinc finger domain protein... [more]
sp|Q91YE5|BAZ2A_MOUSE4.704e-3730.81Bromodomain adjacent to zinc finger domain protein... [more]
sp|Q9UIF8|BAZ2B_HUMAN8.687e-3134.53Bromodomain adjacent to zinc finger domain protein... [more]
sp|Q9DE13|BAZ2B_CHICK1.692e-3033.18Bromodomain adjacent to zinc finger domain protein... [more]
sp|Q9UIF9|BAZ2A_HUMAN9.001e-3034.47Bromodomain adjacent to zinc finger domain protein... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VAA01.629e-6339.19Putative bromodomain containing protein OS=Schisto... [more]
A0A3Q0KSP21.756e-6339.50Putative bromodomain containing protein OS=Schisto... [more]
A0A158QSF11.255e-6236.81Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EX381.278e-6236.81Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2DAZ81.279e-6040.90Bromodomain adjacent to zinc finger domain protein... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz2a9.306e-3528.73bromodomain adjacent to zinc finger domain 2A [Sou... [more]
baz2a9.595e-3528.73bromodomain adjacent to zinc finger domain 2A [Sou... [more]
baz2ba9.129e-3233.19bromodomain adjacent to zinc finger domain, 2Ba [S... [more]
ENSAMXT00000010217.22.142e-2533.09pep primary_assembly:Astyanax_mexicanus-2.0:19:378... [more]
baz1a9.455e-1636.96bromodomain adjacent to zinc finger domain, 1A [So... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008180.11.246e-3236.12pep scaffold:Pmarinus_7.0:GL476358:693784:714018:-... [more]
kdm5c4.530e-1142.19lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
kdm5c2.235e-1042.42lysine (K)-specific demethylase 5C [Source:ZFIN;Ac... [more]
ENSPMAT00000002602.11.945e-928.18pep scaffold:Pmarinus_7.0:GL477730:26567:61347:1 g... [more]
dpf22.026e-942.25D4, zinc and double PHD fingers family 2 [Source:Z... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
JHD22.930e-945.65JmjC domain family histone demethylase; promotes g... [more]
BDF13.825e-941.38Protein involved in transcription initiation; func... [more]
BDF28.751e-934.19Protein involved in transcription initiation; acts... [more]
GCN53.550e-637.08Catalytic subunit of ADA and SAGA histone acetyltr... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448144.061e-2757.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448159.463e-1831.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440542.557e-1452.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375881.892e-1060.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412382.963e-951.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
baz2ba9.287e-3032.44bromodomain adjacent to zinc finger domain 2B [Sou... [more]
baz2ba9.868e-3032.59bromodomain adjacent to zinc finger domain 2B [Sou... [more]
baz2ba1.102e-2932.59bromodomain adjacent to zinc finger domain 2B [Sou... [more]
baz2ba1.161e-2932.59bromodomain adjacent to zinc finger domain 2B [Sou... [more]
baz2a1.609e-2933.48bromodomain adjacent to zinc finger domain 2A [Sou... [more]
back to top
BLAST of Bromodomain adjacent to zinc finger domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068165.10.000e+099.84SMESG000068165.1[more]
SMESG000068165.10.000e+099.79SMESG000068165.1[more]
SMESG000002851.11.368e-1830.69SMESG000002851.1[more]
SMESG000045165.13.000e-1350.00SMESG000045165.1[more]
SMESG000045165.13.175e-1350.00SMESG000045165.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018236 ID=SMED30018236|Name=Bromodomain adjacent to zinc finger domain|organism=Schmidtea mediterranea sexual|type=transcript|length=5923bp
TTTGTATCCGGATGTTCATGATAATTTGAAATTTTGTCACTGGATTTTTT
ATGAAAGATAATTAGATTGATAAATTTTAATTTTATCTTTTTCCCAACAA
AAGACAAGATGAGCGATCCAAGTCGAACTGCACCGAGCCATCCGGCAGAT
CCGTCTATTACGAACAGTTTGTATGGTTCTGGATTGGCATTAAATCCAAC
AATGACAGCAATGGGGTTTGCCAATAATTTGAATCCAAATTATCAGTTTT
TGATGAGATTGAGTGAATTGTCAAGTAAAATCCAGCCATCAAATCAAAGT
CTTGGTTTCGGCTCGGTTCCCCATAATAATTTCCTTCAACCAACCCTCCC
GAATATAACCCAGACATTGCCATCAGCAGCTAATGGAAATGACTTAATGA
GTAACTTCAATTGGCTTCAATATGCACAATTGTTATCTTGCGGATCATTA
AACAATCTAGATCCAACCAGCTCATGGAATCCTAGCAACAACGGAGATCA
AATGTGGAAAGCCATTCAAAGTTTATACTCAGATCTTTACAATCCGATGG
GAGCAACCTCGATTAATGCAAATCACAATTTTCAGTCACCGTTAAATAAT
CTCAATATGCCTCAGTTTTTTCATTGTGAATCTCAAGAAAGTTTTAACGA
TGTCCTTGCAAAACTGGGACATGGTTTAAATGCTTCCAAGAGAAGGGAAG
AAGTGAGAATTCCCGATCTGTTGAGGGATCCTGTAATTCAGTCAGCAATG
AACAATCGGATTGGTGAAGTTAGCAATGACCGCTTATCCAACACTGGCAA
TTCATTTGATGCAAATCAAACAGATATGCTTCGTGACATTCCTTTAAGTT
TACAAAATTCCTTCTATTCAAAATCTCAGAGCAAAGAATTTTCTCGAAAT
TCATCCCCGGTATACAGTCGTAGTAATTCGTCTAATCCAGGTCGAGGTAG
AGGTCGACCACCTAAATCTCTAGGATCAAGATCTAGTCTGTCATTTCCTG
AAGCAAAGAATGAATCCCTAAATTATCTTAATGTATTCGAAAAACCTTAC
CAAGCGTCTGGATCAACGCCAATAACTAGCTGTTATTTACTCGGAGAATC
TACATCTCGTTCATCACCTTCTTCCAACATCAGTGTTGCAAAATCTAGTA
TTCCAGTCACCTCACATGTATCGAGTAAACTAGTCATACCTCCAACAATT
ACATCAATGCCTAGAGGCAAAATATCACCAGAAGTCCAAGATGATTGCAA
AGTGTACAATACACCAACAAAAAAAGTGAAAGAGGAACTTATTCCAAAAT
TTAATCCAAAGAAATCAACGTCGTCGACAAGTAGTATTGAAGGAACAATT
GATGACGTTTTGAAAAGTTTTCAAAACCCGAGCATAATGCCAACCAATTC
CACATCTCCCCTATCAAATTGTGCATTGAAACCATCAACGTATGACATTA
TGTATCCCGAAGATTTGACAAATGGGAAAAAATGGATGTCTAAAAATCAA
GCAACTATGGAAGGTAACAAACGAGATCGGATTGCTGAGCCAATATTACC
CAATTATCAAAAGCCTCTAAAAAATGGATGGAAAAGAGAAACATATCTTA
AATCACTTAACGAATTGGTCGGTGATGTTATTTATGAAACTCCATCTGGT
ACAAAGGTTAATGGAATACCACAATTACGAGAAGTAATCTCCCGAGAGAA
AATATCAAATGTGTCTACAGAAAATTTTTCATTTGAAATTTCTTTACAAT
TAGGAGACTATTTAAAGCCCAGTTTTGATCACATTTTGGGATTCGAGAAA
TTATCAATAGAGGAAGTTGATTTAATCTTTAATAAATATTTAAACAACAA
TATCGAGGATAACATTCTTGTAAGTTCTGACCAATGTCAATATTTGCAAA
TGGAGAATGATTTCCAGAGCAACAGCTTTAGTAATCGTTCGAACAAACTA
CTTAATAACCACAAAAAAATCGACGGAAAACCTTTGAAACCATCGATAAA
GACAGACAAATACAAACACAAGAAAGAACAGAAGTTGATTGAGGCACACA
TATCAAAAGAATTGAAGAAACCTGTGGAAGATCTAAGATTGTTAAATAGC
CAGACATTGCCCACTTTTGAATATATCGAAGGAAATAAGCTATCAAAATC
TGCATTTAACCACTGTTTAGTGGTCTCAGAATTCCTCTATTCATTCTCCG
ATGTGCTGGGAATAGATTTAGACACGATTCCAACAATGCAAGATTATCAA
ATGGCGTTTGTTAACAGAGATCCGGAAAGCTTGCATACAATTTGCTGGCT
TTTGATGGAGCTCCTCAAATTTGCTGTTTGTGATCCAGGAATAACTAATA
CCAAACTAATAACTCAAGTGATTGGAGTAAAATTTTCTGAGTTGGAAGTC
AATCTCAATACGTTATCAGGAGTTCTTCGAGCTTTTATTCTAGCAAGAGC
AGTCGGTAATGAATCAGAAATGGAGGCTTGGCTGATTAATACGGAATATA
AAGATTTATCAGAAGACAAACAAGCTGAATTACTTGGATTTGTGATCAAC
GAAATGCTTACCAGTCGACTTATTTCTAGTGAAGTCGACAAAATCTTAGA
ACAGCAATCAATAATCAGAAGAGACAAGTGGATTCTTGATGGGAAATTAA
GGAGATTAAAGCTTTTTCAAAGTCGAAAATTGTATTGTGCAAATGGTACG
ATCTCGAACAACATTAACAGCATCAGCAACAATAATTTATCCGCTAGCAA
TATAACGGATTCCCAAATAATTCCAGATCCTGACTGCAATATATCTGTAG
CGGACGTTGATTCCGATTTGGATAGTGTCGACTCCAATGAGAACATGACA
AATAGCCAACTAAATTGGTCCGGTGAAGAGGACGAAACTGCTTCATCTTC
ATCTTTAGATGATTTGGAAAAACGCATTGAAAGACTGACTAATCAAGTTC
TTCAGAAAAAGAATGATCTCAATCAATGCGATCATAAATTGCGAGGAATA
CACTTGGGTCAAGATCGATATCATAGAAACTTCTATCTTTTAAAGCATCT
TGGAGGCATATTTATCGAGCCGGCACCCAGCTCACTCGAAATGAGCATTG
ATCCCGATTATATCTTAAAGGCAATTAATCAGTCTCAAAATGAAAAACTG
ATCAAACATGAGAATTTCGAGGATAATAAAGATGTAATTCAGCATTCATT
CTCCATTCAACCGATTTCAAATATATCTAGTGAAAAATCGAGAAAAACCG
ACTTGAAAATCGAATTGTTTACACCTGCCGATTCTGGAAATGTATTCTAT
CAAATTGAACCGTTGGATCTTAGAAAATCTTCGAAATCGTGTGATTTAAA
GCTGGAAATCAAAAACGAATTAACTGCTTGTCATGCCAATGTCAGTGAGA
ATGGAAAAGGGAAAACTCCAAAAATCGAATGGGATCTCAATGTCATCAAT
AATGCAACAGTTCTTTATGCTAATCGTGCAAGACTTATTTATCCGGAAAT
TGAATTCGAACAGTTAAAAAATTATTATCGTCAACAAATTGAAGATTATC
TTAGAGATTGCAATCAAAGCAATGCCATGGAGCATTTGAAATCATGGATT
GACTTTTATCAGCTGGTGTTAAAGACCGATCAGCTCAATGGAGAGACAAA
CAATTACGTAAATATACAGCATTCTAAAAGTGATAGAATCAAAGAGTTAG
CTGACAAAGAACTGGAAAGAATGGGTAAACAATCTCCGAAAAAATTGCAA
ACTATTCCAAATTCAATCAAAGACAAATGGTGCTGGATTAGAGATGAAGA
ACAAATAAAAAAATTATTAATTTCTTTACATCGTCGAGGAATAAGAGAAA
GAAGTTTATATAGATCAATAGAAAGGCATTACAAACTAATTGTGAATTGT
TTTAGATTTAATTATTCATCAGCTTTTAACTATGACTGTCATAGAAATTC
TACAAAATTGAGAGTAACATCAAAAAGAGGTAAAGGGCGAGGTAGTAGTC
ATAATCAAATCGGAGCAAAAATAAGCTTAGCGCAGTCGTTAATAAATGAT
ATTAAATCTGAACCCGGAGAACAGCATAGTAAATATCTATCAGAAATAAC
TGCTTTGGAGAAAGTAGAGGATCTTATATCAATGGTTGTGACTGCCAGCT
TACACAAAAAAGGCTGGAAGTTTCCTGAAAAAGCCGTCTTCGATGACACC
ATCAAAGTTATTCCATCAGACACATTAAAACGTTTTAATTTCGAGATGTA
TCCTCTTGATTTAGCCAAAGAGAGACTGCTGGAATTAGAAGATCAATTAG
AACGTCGTTATTTACTGCCACCACTAAATTGGGAATTCAAACCAAAAGTG
TTGTCAACTACAAAAGAAAGCCACCTGAGGAAAACCCTCAATTACGTCGT
GTCGTCTTCATGCGGTTTCGAAGACGGTGCAGAATCGACTTCGTCGTTTA
TCGACGATACAAGATCAATTAATACAGATCAATCACCGTCCGCTCAAATG
TCACAAGATACAGATAATAAGAAATCATCGACATTGGCATCAAAATTGGA
ATCTGTCAATTCGTCTGTGACACCTCCAGAATTAGCAGATTGGAGGAAAT
CCATTCTTGAGGCAAATAATGACAAACAACTTTTGGCTTGCATGAGAACC
CTTACAAATGCCATAGCTTGGGACAAATCCATCATGAAAGTGCTCTGTCA
AATTTGTCGAAAAGACTGCAATGAAGCTCAACTTTTGTTATGTGATTCAT
GTGACCAAGGATATCATACTTATTGCTTCCGTCCCCCGTTGTCTGGTATT
CCTGAAGGTCAGTGGTTTTGTCATGACTGTGTTTCGAAGGCTACTGATCA
GAAACTTTGCTATGTGTGCGGTCAACCAAAAACCGCTCGAACCACAGTAT
GTATGGTATGCAAACGTATGTTGCATGCAATTTGTGCTAAGCCAACTATG
ACTCGGGTTCCTCGAAAGTGGACTTGTCACAACTGTTCCGGTCGAATGAG
CAAGGACGTTTCTTCGGAAAATGATACAAATTTACTTCCATCTTTAACAG
TTAGTCTAAGCAATTGTTCGGAACTTTCTGTCAGTTGTCCGAATTCCAAT
AGTAGTACCACTACTTCCGATTTTAATGCAGCTTATTCGAGCGTCAAACA
GTCACTTTGTAGCAATATCGCATTCAGCAATATTCTGTATAAAAAGCGAT
CTTGCAAAAGGGTATTGGACTCTCAAAATGCCGGTGCTATTAATAAGAAA
CGCATCAAGCGAATCAGTACTGACACCAAGTCTAACAAATCAATCTCATC
TGATTGTTCTAAAAGTAAGAATGACTGGCAGTTCAAAGAATCCTCGTCAG
GAAAAGAGGAGAAATCTCCATCGATGGACGCAGTTGAAATTGAAATTATT
AAGACTTTATTAACAAATCATTCATCAGTCCCTTCCAATTCTACCCTTTC
TGAAACAGAATTTGAAAATTGCCGTAAATTTCTCTTGGAAATTTTAGACC
TTAATTTAGTATATCCGTTTCTAAGACCAGTCGATGTAAAGAAAGTGCCA
ATTTACAAAAAGGTTATTAAAACTCCAATGGACTTCAGCACTTTGGCCAG
AAAGTTATCAGATTTTGTATATAAAAGCACGAATGAATTTCTCAATGATT
TGCGATTAATTTTCAACAATTGCGAACAATTCAATGAAGATGATTCGGAT
ATTGGCAAGGCCGGTCATGCTCTTAGAGCTTTCTTTGAGAAGCATTGGAT
GTCTTCGAGTAAAGAGCAGGAGAATATTGGTGAAATGAATCAGAAAAATT
TTGTTAGAATATAAATAACGGGGATTACTTTCTGAAGATTTGATCTCGTT
TTGATGCTGAACAATCATTCCCTATTTATTTAGGAAATAATAATAAGTTA
TAAATATATATATCTATGCTCCG
back to top

protein sequence of SMED30018236-orf-1

>SMED30018236-orf-1 ID=SMED30018236-orf-1|Name=SMED30018236-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1902bp
MSDPSRTAPSHPADPSITNSLYGSGLALNPTMTAMGFANNLNPNYQFLMR
LSELSSKIQPSNQSLGFGSVPHNNFLQPTLPNITQTLPSAANGNDLMSNF
NWLQYAQLLSCGSLNNLDPTSSWNPSNNGDQMWKAIQSLYSDLYNPMGAT
SINANHNFQSPLNNLNMPQFFHCESQESFNDVLAKLGHGLNASKRREEVR
IPDLLRDPVIQSAMNNRIGEVSNDRLSNTGNSFDANQTDMLRDIPLSLQN
SFYSKSQSKEFSRNSSPVYSRSNSSNPGRGRGRPPKSLGSRSSLSFPEAK
NESLNYLNVFEKPYQASGSTPITSCYLLGESTSRSSPSSNISVAKSSIPV
TSHVSSKLVIPPTITSMPRGKISPEVQDDCKVYNTPTKKVKEELIPKFNP
KKSTSSTSSIEGTIDDVLKSFQNPSIMPTNSTSPLSNCALKPSTYDIMYP
EDLTNGKKWMSKNQATMEGNKRDRIAEPILPNYQKPLKNGWKRETYLKSL
NELVGDVIYETPSGTKVNGIPQLREVISREKISNVSTENFSFEISLQLGD
YLKPSFDHILGFEKLSIEEVDLIFNKYLNNNIEDNILVSSDQCQYLQMEN
DFQSNSFSNRSNKLLNNHKKIDGKPLKPSIKTDKYKHKKEQKLIEAHISK
ELKKPVEDLRLLNSQTLPTFEYIEGNKLSKSAFNHCLVVSEFLYSFSDVL
GIDLDTIPTMQDYQMAFVNRDPESLHTICWLLMELLKFAVCDPGITNTKL
ITQVIGVKFSELEVNLNTLSGVLRAFILARAVGNESEMEAWLINTEYKDL
SEDKQAELLGFVINEMLTSRLISSEVDKILEQQSIIRRDKWILDGKLRRL
KLFQSRKLYCANGTISNNINSISNNNLSASNITDSQIIPDPDCNISVADV
DSDLDSVDSNENMTNSQLNWSGEEDETASSSSLDDLEKRIERLTNQVLQK
KNDLNQCDHKLRGIHLGQDRYHRNFYLLKHLGGIFIEPAPSSLEMSIDPD
YILKAINQSQNEKLIKHENFEDNKDVIQHSFSIQPISNISSEKSRKTDLK
IELFTPADSGNVFYQIEPLDLRKSSKSCDLKLEIKNELTACHANVSENGK
GKTPKIEWDLNVINNATVLYANRARLIYPEIEFEQLKNYYRQQIEDYLRD
CNQSNAMEHLKSWIDFYQLVLKTDQLNGETNNYVNIQHSKSDRIKELADK
ELERMGKQSPKKLQTIPNSIKDKWCWIRDEEQIKKLLISLHRRGIRERSL
YRSIERHYKLIVNCFRFNYSSAFNYDCHRNSTKLRVTSKRGKGRGSSHNQ
IGAKISLAQSLINDIKSEPGEQHSKYLSEITALEKVEDLISMVVTASLHK
KGWKFPEKAVFDDTIKVIPSDTLKRFNFEMYPLDLAKERLLELEDQLERR
YLLPPLNWEFKPKVLSTTKESHLRKTLNYVVSSSCGFEDGAESTSSFIDD
TRSINTDQSPSAQMSQDTDNKKSSTLASKLESVNSSVTPPELADWRKSIL
EANNDKQLLACMRTLTNAIAWDKSIMKVLCQICRKDCNEAQLLLCDSCDQ
GYHTYCFRPPLSGIPEGQWFCHDCVSKATDQKLCYVCGQPKTARTTVCMV
CKRMLHAICAKPTMTRVPRKWTCHNCSGRMSKDVSSENDTNLLPSLTVSL
SNCSELSVSCPNSNSSTTTSDFNAAYSSVKQSLCSNIAFSNILYKKRSCK
RVLDSQNAGAINKKRIKRISTDTKSNKSISSDCSKSKNDWQFKESSSGKE
EKSPSMDAVEIEIIKTLLTNHSSVPSNSTLSETEFENCRKFLLEILDLNL
VYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRL
IFNNCEQFNEDDSDIGKAGHALRAFFEKHWMSSSKEQENIGEMNQKNFVR
I*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR001487Bromodomain
IPR001965Znf_PHD
IPR001739Methyl_CpG_DNA-bd
IPR019787Znf_PHD-finger
IPR013083Znf_RING/FYVE/PHD
IPR028941WHIM2_dom
IPR019786Zinc_finger_PHD-type_CS
IPR018501DDT_dom
IPR011011Znf_FYVE_PHD
IPR016177DNA-bd_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0003677DNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 926..960
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 914..934
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..297
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1442..1483
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..280
NoneNo IPR availablePANTHERPTHR45915FAMILY NOT NAMEDcoord: 1596..1885
NoneNo IPR availablePANTHERPTHR45915:SF2TOUTATIS, ISOFORM Ecoord: 637..1029
NoneNo IPR availablePANTHERPTHR45915:SF2TOUTATIS, ISOFORM Ecoord: 1596..1885
NoneNo IPR availablePANTHERPTHR45915FAMILY NOT NAMEDcoord: 1206..1591
coord: 637..1029
NoneNo IPR availablePANTHERPTHR45915:SF2TOUTATIS, ISOFORM Ecoord: 1206..1591
coord: 480..554
NoneNo IPR availablePANTHERPTHR45915FAMILY NOT NAMEDcoord: 480..554
NoneNo IPR availableCDDcd15545PHD_BAZ2A_likecoord: 1529..1574
e-value: 3.59936E-27
score: 103.16
NoneNo IPR availableCDDcd15489PHD_SFcoord: 1584..1626
e-value: 1.7469E-4
score: 38.8374
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 1829..1847
score: 25.86
coord: 1813..1829
score: 46.8
coord: 1847..1866
score: 37.07
coord: 1799..1812
score: 37.11
IPR001487BromodomainSMARTSM00297bromo_6coord: 1781..1885
e-value: 3.5E-31
score: 119.6
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 1788..1868
e-value: 5.2E-18
score: 64.9
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 1796..1866
score: 19.275
IPR001739Methyl-CpG DNA bindingSMARTSM00391TAM_2coord: 480..554
e-value: 6.2E-5
score: 31.3
IPR001739Methyl-CpG DNA bindingPFAMPF01429MBDcoord: 484..543
e-value: 2.8E-7
score: 30.1
IPR001739Methyl-CpG DNA bindingPROSITEPS50982MBDcoord: 477..547
score: 11.262
IPR001965Zinc finger, PHD-typeSMARTSM00249PHD_3coord: 1529..1575
e-value: 1.0E-10
score: 51.6
coord: 1583..1627
e-value: 0.021
score: 24.0
IPR028941WHIM2 domainPFAMPF15613WSDcoord: 1183..1257
e-value: 3.7E-7
score: 30.5
IPR019787Zinc finger, PHD-fingerPFAMPF00628PHDcoord: 1530..1576
e-value: 1.5E-10
score: 40.8
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1527..1577
score: 10.22
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 1581..1629
score: 8.618
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1580..1647
e-value: 1.6E-7
score: 32.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1461..1579
e-value: 1.2E-18
score: 69.3
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 1763..1897
e-value: 2.6E-31
score: 110.3
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 1776..1881
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 1530..1574
IPR018501DDT domainPROSITEPS50827DDTcoord: 680..745
score: 10.043
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1517..1577
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 1580..1632
IPR016177DNA-binding domain superfamilySUPERFAMILYSSF54171DNA-binding domaincoord: 484..550