Adenylate kinase

Overview
NameAdenylate kinase
Smed IDSMED30018224
Length (bp)959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase (SMED30018224) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase (SMED30018224) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate kinase (SMED30018224) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate kinase (SMED30018224) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018224

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 37

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig33862uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig33862newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018224SMESG000060686.1 Contig27900uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018224SMESG000060686.1 Contig27900newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig45773newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig45773uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000063429.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig6501uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000063429.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig6501newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig33862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig33862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 dd_Smed_v4_1229_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig45773newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig45773uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 SMESG000001468.1 Contig34290newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 SMESG000001468.1 Contig34290uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig12447newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 Contig12447uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000063429.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000011532.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig26968newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000078886.1 SMESG000078780.1 SMESG000078276.1 SMESG000077377.1 SMESG000076900.1 SMESG000070563.1 SMESG000069843.1 SMESG000067323.1 SMESG000067128.1 SMESG000066333.1 SMESG000063482.1 SMESG000063430.1 SMESG000063429.1 SMESG000062535.1 SMESG000060686.1 SMESG000055265.1 SMESG000052056.1 SMESG000051183.1 SMESG000049398.1 SMESG000047988.1 SMESG000045843.1 SMESG000043425.1 SMESG000043019.1 SMESG000041242.1 SMESG000040236.1 SMESG000039783.1 SMESG000034367.1 SMESG000031778.1 SMESG000031308.1 SMESG000028811.1 SMESG000025956.1 SMESG000023833.1 SMESG000023573.1 SMESG000023546.1 SMESG000019820.1 SMESG000018414.1 SMESG000017936.1 SMESG000015191.1 SMESG000014475.1 SMESG000011532.1 SMESG000009011.1 SMESG000008656.1 SMESG000005037.1 SMESG000004638.1 SMESG000003422.1 Contig26968uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000005684.1 Contig116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000005684.1 Contig116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 SMESG000037745.1 Contig43287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018224SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 SMESG000037745.1 Contig43287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30018224SMESG000080770.1 SMESG000072841.1 SMESG000065333.1 SMESG000060686.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000055265.1 SMESG000054970.1 SMESG000052813.1 SMESG000043147.1 SMESG000043019.1 SMESG000041242.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019820.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig20343uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30018224SMESG000080770.1 SMESG000072841.1 SMESG000065333.1 SMESG000060686.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000055265.1 SMESG000054970.1 SMESG000052813.1 SMESG000043147.1 SMESG000043019.1 SMESG000041242.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000031415.1 SMESG000019820.1 SMESG000019663.1 SMESG000010897.1 SMESG000009005.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 Contig20343newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
musculature systemSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000052813.1 SMESG000077377.1 SMESG000076900.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000011532.1 dd_Smed_v6_1229_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30018224SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000019820.1 SMESG000052813.1 SMESG000077377.1 SMESG000076900.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000011532.1 dd_Smed_v6_1229_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 237.269 bits (604), Expect = 1.695e-77
Identity = 116/201 (57.71%), Postives = 148/201 (73.63%), Query Frame = 3
Query:  204 PHKKID-EAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            P ++ D  A+ KLK  K+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGS RG KL EIMEKG+LV L+ VLD++RDAMV K++ S GFLIDGYPRE++QG+ FE  I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  YEK+    +++A G++D +F +V   +D L
Sbjct:    9 PRREDDLRAREKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDAL 209          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 235.343 bits (599), Expect = 4.835e-77
Identity = 113/190 (59.47%), Postives = 142/190 (74.74%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK  K+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGS RG KL EIMEKG+LV L+ VLD++RDAMV K++ S GFLIDGYPRE++QG+ FE  I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  YEK+    +++A G++D +F +V   +D L
Sbjct:    4 KLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDAL 193          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK1 (adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:361])

HSP 1 Score: 235.343 bits (599), Expect = 4.835e-77
Identity = 113/190 (59.47%), Postives = 142/190 (74.74%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK  K+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGS RG KL EIMEKG+LV L+ VLD++RDAMV K++ S GFLIDGYPRE++QG+ FE  I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  YEK+    +++A G++D +F +V   +D L
Sbjct:    4 KLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDAL 193          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK5 (adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:365])

HSP 1 Score: 194.512 bits (493), Expect = 3.264e-57
Identity = 93/189 (49.21%), Postives = 133/189 (70.37%), Query Frame = 3
Query:  237 LKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            L+  K+IF++GGPGSGKGTQCEK+V KYGF HLS+G+LLREE+ S SER   +++IME+G+LV   IVL+L+++AMV  +  + GFLIDGYPRE++QG+ F   I   + VI    S D M  RLL+R  +S  VDD  +TI KRL+ +   + PVI +YE + + H+I+A GT +++F ++   ID +
Sbjct:  347 LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSI 535          

HSP 2 Score: 125.561 bits (314), Expect = 1.009e-31
Identity = 63/186 (33.87%), Postives = 109/186 (58.60%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSE--RGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             K+I V+GGPGSGKGTQ  KI  +YGF ++S G+LLR+++ S S   + + + +I+  GEL   +  +  I+  +++ I    G +IDG+PR++ Q   FE++I   + V+  + +   ++ RLLKR E  GR DDN +   +RL  F +   P++ +++++      DA    DE+F  ++  +D
Sbjct:  106 PKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQ-IPDEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD 290          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK5 (adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:365])

HSP 1 Score: 194.512 bits (493), Expect = 5.509e-57
Identity = 93/189 (49.21%), Postives = 133/189 (70.37%), Query Frame = 3
Query:  237 LKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            L+  K+IF++GGPGSGKGTQCEK+V KYGF HLS+G+LLREE+ S SER   +++IME+G+LV   IVL+L+++AMV  +  + GFLIDGYPRE++QG+ F   I   + VI    S D M  RLL+R  +S  VDD  +TI KRL+ +   + PVI +YE + + H+I+A GT +++F ++   ID +
Sbjct:  373 LRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSI 561          

HSP 2 Score: 125.561 bits (314), Expect = 1.254e-31
Identity = 63/186 (33.87%), Postives = 109/186 (58.60%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSE--RGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             K+I V+GGPGSGKGTQ  KI  +YGF ++S G+LLR+++ S S   + + + +I+  GEL   +  +  I+  +++ I    G +IDG+PR++ Q   FE++I   + V+  + +   ++ RLLKR E  GR DDN +   +RL  F +   P++ +++++      DA    DE+F  ++  +D
Sbjct:  132 PKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQ-IPDEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD 316          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F38B2.4 (Adenylate kinase isoenzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20140])

HSP 1 Score: 224.557 bits (571), Expect = 5.680e-73
Identity = 110/199 (55.28%), Postives = 145/199 (72.86%), Query Frame = 3
Query:  207 HKKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDH-SHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
             K I+ A  K     + F++GGPGSGKGTQC+KIV KYG  HLSSGDLLR+EV+SGS RG +L  IME G LV L++VLDL+++AM+K I+  S GFLIDGYPRE+ QG++FE+EI   + V+ F V+E+ +  RLL R +TSGR DDNA+TI KRL TF   T PV+D+YE + K  +I+A G++D+IF  V   +DK
Sbjct:    7 RKNINLAPLKAAGVPIFFIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPREVAQGQQFESEIQEAKLVLFFDVAEETLVKRLLHRAQTSGRADDNADTIKKRLHTFVTSTAPVVDYYESKGKLVRINAEGSVDDIFAVVVANLDK 205          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: C29F7.3 (UMP-CMP kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17622])

HSP 1 Score: 127.872 bits (320), Expect = 1.076e-35
Identity = 71/186 (38.17%), Postives = 114/186 (61.29%), Query Frame = 3
Query:  249 KVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVI 794
             V+FVLG PGSGKGT C +I    G+ HLS+GDLLR E E +GSE G  ++  ++ G +V ++I   L+ +AM+   D ++GFLIDG+PR  +    +  ++   +  + V+  S   DV   R L RG+  GR DDN E++ KR++T+N+ T P+I+H+EK     ++++   + E+++ V  V 
Sbjct:    3 NVVFVLGPPGSGKGTICTQIHENLGYVHLSAGDLLRAERERAGSEYGALIEGHIKNGSIVPVEITCALLENAMIASKD-ANGFLIDGFPRNEDNWSGWNKQMGGKVNEQFVLFLSCPVDVCIDRCLHRGQ--GRTDDNVESLKKRVETYNQSTFPIIEHFEKVGMVREVNSERPVTEVYEDVVKVF 185          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 119.398 bits (298), Expect = 1.919e-32
Identity = 68/186 (36.56%), Postives = 108/186 (58.06%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            V+FVLG PGSGKGT C KI     + HLS+GDLLR E +  GSE G  ++  ++ G +V ++I   L+ +AM K    + GFL+DG+PR  +  + +  ++      + V+  S    +   R L RG+  GR DDN E++ KR++T+N+ T P+I+H+EK     ++ +   +D ++  V  V D
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAM-KACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQ--GRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 119.398 bits (298), Expect = 1.919e-32
Identity = 68/186 (36.56%), Postives = 108/186 (58.06%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            V+FVLG PGSGKGT C KI     + HLS+GDLLR E +  GSE G  ++  ++ G +V ++I   L+ +AM K    + GFL+DG+PR  +  + +  ++      + V+  S    +   R L RG+  GR DDN E++ KR++T+N+ T P+I+H+EK     ++ +   +D ++  V  V D
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAM-KACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQ--GRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 119.398 bits (298), Expect = 1.919e-32
Identity = 68/186 (36.56%), Postives = 108/186 (58.06%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            V+FVLG PGSGKGT C KI     + HLS+GDLLR E +  GSE G  ++  ++ G +V ++I   L+ +AM K    + GFL+DG+PR  +  + +  ++      + V+  S    +   R L RG+  GR DDN E++ KR++T+N+ T P+I+H+EK     ++ +   +D ++  V  V D
Sbjct:    4 VVFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAM-KACGDAKGFLVDGFPRNEDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNRGQ--GRTDDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076017)

HSP 1 Score: 177.563 bits (449), Expect = 1.131e-54
Identity = 92/184 (50.00%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSG--RVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            +I++LGGPG GKGTQC KIV KYGF HLSSGDLLR EV SGS++G +L+ +M  G LVS D VL L+ DA+ +    S GFLIDGYPR+  QG  FE  I P +  + F  SED M  R++ R   S   R DDN +TI  RL TF + T  +++ YE   K   I+A   +D+IF +V   ID
Sbjct:    6 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAID 187          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk1 (gene:FBgn0022709 transcript:FBtr0076018)

HSP 1 Score: 178.333 bits (451), Expect = 1.600e-54
Identity = 92/184 (50.00%), Postives = 117/184 (63.59%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSG--RVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            +I++LGGPG GKGTQC KIV KYGF HLSSGDLLR EV SGS++G +L+ +M  G LVS D VL L+ DA+ +    S GFLIDGYPR+  QG  FE  I P +  + F  SED M  R++ R   S   R DDN +TI  RL TF + T  +++ YE   K   I+A   +D+IF +V   ID
Sbjct:   34 IIWILGGPGCGKGTQCAKIVEKYGFTHLSSGDLLRNEVASGSDKGRQLQAVMASGGLVSNDEVLSLLNDAITRAKGSSKGFLIDGYPRQKNQGIEFEARIAPADLALYFECSEDTMVQRIMARAAASAVKRDDDNEKTIRARLLTFKQNTNAILELYEP--KTLTINAERDVDDIFLEVVQAID 215          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Dak1 (gene:FBgn0028833 transcript:FBtr0084976)

HSP 1 Score: 143.665 bits (361), Expect = 8.119e-41
Identity = 77/191 (40.31%), Postives = 120/191 (62.83%), Query Frame = 3
Query:  237 LKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPR---ELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGET-SGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVI 794
            ++  K++FVLGGPG+GKGTQC +IV+++ F HLS+GDLLREE    GSE GN +++ +  G++V +++   L+ +AM  K      FLIDG+PR    L+   R  +E +  + V+ F   EDV   R L RG++ SGR DDN +++ KR+ T+N  + P+I  +E   +  +IDAS   +E+F +V  + 
Sbjct:   60 VEKPKIVFVLGGPGAGKGTQCSRIVDRFQFTHLSAGDLLREERSREGSEFGNLIEDYIRNGKIVPVEVTCSLLENAM--KASGKSRFLIDGFPRNQDNLDGWNRQMSEKVDFQFVLFFDCGEDVCVKRCLGRGQSGSGRTDDNLDSLKKRISTYNNDSLPIIKFFEGAGQVKRIDASPDAEEVFGEVEKIF 248          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 117.087 bits (292), Expect = 7.336e-31
Identity = 72/212 (33.96%), Postives = 119/212 (56.13%), Query Frame = 3
Query:  258 FVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI----IPCECVIAFSVSEDVMRARLLKR--GETSG-------------------------RVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDAS-------GTIDEIFDK 779
             +LG PGSGKGTQ   +  K+   HLS+GD+LR E+ SGS+ G +LK++M+ G+LVS D+V+D+I D+ + K +  +GFL+DG+PR + Q ++ +  +       + VI F++ + ++  R+  R   + SG                         R DDNAE + KRL+ +++ TKP++D+Y  +    ++DA+        TID IF +
Sbjct:   22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI-DSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQR 232          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 78.9518 bits (193), Expect = 5.266e-17
Identity = 57/185 (30.81%), Postives = 88/185 (47.57%), Query Frame = 3
Query:  261 VLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDH--SHGFLIDGYPRELEQGKRF-ENEIIPCECVIAFSVSEDVMRARLLKRG--ETSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQ 725
            ++G PGSGKGT  E I   +G  H+S+GD+LR+ +   +E G K K+ + +G+LV   IV       M+ +I    +  +++DG+PR + Q +     E I  + VI   V   V+  R+  R     SGRV                         DD    + KRL+ ++E+  PVI  YEK+
Sbjct:   10 IIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIV----TKTMLARITEVGNRSYILDGFPRNIAQAEALAAREQI--DAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKK 188          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak1 (adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040822-37])

HSP 1 Score: 224.172 bits (570), Expect = 6.672e-73
Identity = 109/190 (57.37%), Postives = 141/190 (74.21%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            K+K+AK++FV+GGPGSGKGTQCEKIV KYG+ HLSSGDLLR EV SGSERG +L+ IM+KGELV LD VLD+I+DAM+ K D S G+LIDGYPRE++QG+ FE +I     ++      + M  RL+KRGETSGR DDN ETI KRL  + + T+PVI  YE++    +I++   +DE+F  V   ID+L
Sbjct:    4 KIKNAKIVFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALLLYIDAKGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVDEVFAIVEKAIDEL 193          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak1 (adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040822-37])

HSP 1 Score: 223.787 bits (569), Expect = 9.448e-73
Identity = 109/190 (57.37%), Postives = 141/190 (74.21%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            K+K+AK++FV+GGPGSGKGTQCEKIV KYG+ HLSSGDLLR EV SGSERG +L+ IM+KGELV LD VLD+I+DAM+ K D S G+LIDGYPRE++QG+ FE +I     ++      + M  RL+KRGETSGR DDN ETI KRL  + + T+PVI  YE++    +I++   +DE+F  V   ID+L
Sbjct:    4 KIKNAKIVFVVGGPGSGKGTQCEKIVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGYLIDGYPREVKQGEEFEKKIGAPALLLYIDAKGETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVIAFYEQRGIVRKINSELPVDEVFAIVEKAIDEL 193          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 156.762 bits (395), Expect = 2.879e-46
Identity = 81/192 (42.19%), Postives = 128/192 (66.67%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAM---VKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
             +V+FVLGGPG+GKGTQC +IV  Y + HLS+GDLLREE   + SE G  +   +++G++V + I ++L+R AM   +K  +    FLIDG+PR  +  + +  E+      + V+ F  S +V   R L+RG++SGR DDN E++ KR++T+ + T+P+I+ YEKQ K  +IDAS ++DE+F  V ++++K
Sbjct:   28 PQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEK 219          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 156.762 bits (395), Expect = 3.337e-46
Identity = 81/192 (42.19%), Postives = 128/192 (66.67%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAM---VKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
             +V+FVLGGPG+GKGTQC +IV  Y + HLS+GDLLREE   + SE G  +   +++G++V + I ++L+R AM   +K  +    FLIDG+PR  +  + +  E+      + V+ F  S +V   R L+RG++SGR DDN E++ KR++T+ + T+P+I+ YEKQ K  +IDAS ++DE+F  V ++++K
Sbjct:   32 PQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEK 223          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: cmpk (cytidylate kinase [Source:NCBI gene;Acc:406383])

HSP 1 Score: 156.377 bits (394), Expect = 4.216e-46
Identity = 81/192 (42.19%), Postives = 128/192 (66.67%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAM---VKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
             +V+FVLGGPG+GKGTQC +IV  Y + HLS+GDLLREE   + SE G  +   +++G++V + I ++L+R AM   +K  +    FLIDG+PR  +  + +  E+      + V+ F  S +V   R L+RG++SGR DDN E++ KR++T+ + T+P+I+ YEKQ K  +IDAS ++DE+F  V ++++K
Sbjct:   26 PQVVFVLGGPGAGKGTQCARIVENYSYTHLSAGDLLREERSRTDSEFGQLIDSYIKEGKIVPVQITINLLRKAMEETMKADEKKFRFLIDGFPRNQDNLQGWNTEMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIELYEKQGKVQRIDASRSVDEVFADVKNILEK 217          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 233.032 bits (593), Expect = 3.464e-76
Identity = 110/190 (57.89%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK++K+IFV+GGPGSGKGTQCEKIV++YG+ HLS+GDLLR EV SGSERG  L  IMEKGELV LD VLD++++AM+ K D S G+LIDGYPRE++QG+ FE +I P   ++      D M  RLLKRGETSGR DDN  TI KRL+T+ + T+PVI  YE +    +I+A G++D++F +V+  +D L
Sbjct:    4 KLKNSKIIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDAL 193          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 233.032 bits (593), Expect = 1.667e-75
Identity = 111/194 (57.22%), Postives = 145/194 (74.74%), Query Frame = 3
Query:  222 EAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            E   KLK++K+IFV+GGPGSGKGTQCEKIV++YG+ HLS+GDLLR EV SGSERG  L  IMEKGELV LD VLD++++AM+ K D S G+LIDGYPRE++QG+ FE +I P   ++      D M  RLLKRGETSGR DDN  TI KRL+T+ + T+PVI  YE +    +I+A G++D++F +V+  +D L
Sbjct:   45 EMADKLKNSKIIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDAL 238          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 216.853 bits (551), Expect = 5.657e-70
Identity = 103/181 (56.91%), Postives = 134/181 (74.03%), Query Frame = 3
Query:  261 VLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            + GGPGSGKGTQCEKIV++YG+ HLS+GDLLR EV SGSERG  L  IMEKGELV LD VLD++++AM+ K D S G+LIDGYPRE++QG+ FE +I P   ++      D M  RLLKRGETSGR DDN  TI KRL+T+ + T+PVI  YE +    +I+A G++D++F +V+  +D L
Sbjct:    4 LCGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDAL 184          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 215.698 bits (548), Expect = 1.641e-69
Identity = 102/178 (57.30%), Postives = 132/178 (74.16%), Query Frame = 3
Query:  270 GPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            GPGSGKGTQCEKIV++YG+ HLS+GDLLR EV SGSERG  L  IMEKGELV LD VLD++++AM+ K D S G+LIDGYPRE++QG+ FE +I P   ++      D M  RLLKRGETSGR DDN  TI KRL+T+ + T+PVI  YE +    +I+A G++D++F +V+  +D L
Sbjct:    8 GPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYEGRGIVRKINAEGSVDDVFKQVSTALDAL 185          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:448536])

HSP 1 Score: 214.927 bits (546), Expect = 3.589e-69
Identity = 103/166 (62.05%), Postives = 127/166 (76.51%), Query Frame = 3
Query:  222 EAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYE 719
            E   KLK++K+IFV+GGPGSGKGTQCEKIV++YG+ HLS+GDLLR EV SGSERG  L  IMEKGELV LD VLD++++AM+ K D S G+LIDGYPRE++QG+ FE +I P   ++      D M  RLLKRGETSGR DDN  TI KRL+T+ + T+PVI  YE
Sbjct:   18 ENSDKLKNSKIIFVVGGPGSGKGTQCEKIVHQYGYTHLSTGDLLRAEVSSGSERGKHLSAIMEKGELVPLDTVLDMLKEAMIAKADTSKGYLIDGYPREVKQGEEFEKKIGPPSLLLYIDAGSDTMVKRLLKRGETSGRADDNEATIKKRLETYYKATEPVIAMYE 183          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 241.891 bits (616), Expect = 8.157e-80
Identity = 116/190 (61.05%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGSERG KL  IMEKGELV LD VLD++RDAM+ K+D S+GFLIDGYPRE++QG+ FE +I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+   T+PVI  Y+K+    +++A GT+D +F +V   +D L
Sbjct:    4 KLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSL 193          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 241.891 bits (616), Expect = 8.157e-80
Identity = 116/190 (61.05%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGSERG KL  IMEKGELV LD VLD++RDAM+ K+D S+GFLIDGYPRE++QG+ FE +I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+   T+PVI  Y+K+    +++A GT+D +F +V   +D L
Sbjct:    4 KLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSL 193          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak1 (adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:87977])

HSP 1 Score: 241.506 bits (615), Expect = 2.367e-79
Identity = 116/190 (61.05%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGSERG KL  IMEKGELV LD VLD++RDAM+ K+D S+GFLIDGYPRE++QG+ FE +I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+   T+PVI  Y+K+    +++A GT+D +F +V   +D L
Sbjct:   20 KLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSL 209          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak5 (adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677491])

HSP 1 Score: 187.963 bits (476), Expect = 1.142e-54
Identity = 86/189 (45.50%), Postives = 135/189 (71.43%), Query Frame = 3
Query:  237 LKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            L+  K+IF++GGPGSGKGTQCEK+  KYGF HLS+G+LLR+E+ S SER   +++IME+G+LV   +VL+L+++AMV  + ++ GFLIDGYPRE++QG+ F   I     VI    S D M  RLL+R ++S R +D A++I KRL+ ++  + PV+ +YE++ +  +++A GT +++F ++   ID +
Sbjct:  373 LRKCKIIFLMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESERSKLIRDIMERGDLVPSGVVLELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQLRKVNAEGTPEQVFLQLCTAIDSV 561          

HSP 2 Score: 119.783 bits (299), Expect = 9.157e-30
Identity = 61/186 (32.80%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSE--RGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             K+I V+GGPGSGKGTQ  KI  +YGF ++S G+LLR+++ S S   + + + +I+  GEL   +  +  I+  +++ I    G +IDG+PR++ Q   FE++I   + V+  + +   ++ RL KR E  GR DDN +   +RL  F +   P++ +++++      DA    D +F  ++  +D
Sbjct:  132 PKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSASSNRKWSLIAKIITNGELAPQETTITEIKQKLMQ-IPDEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLQKRAEQQGRPDDNLKATQRRLVNFKQNAAPLVKYFQEKGLIVTFDADRDEDAVFHDISVAVD 316          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak5 (adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677491])

HSP 1 Score: 172.555 bits (436), Expect = 1.322e-52
Identity = 80/165 (48.48%), Postives = 120/165 (72.73%), Query Frame = 3
Query:  237 LKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHK 731
            L+  K+IF++GGPGSGKGTQCEK+  KYGF HLS+G+LLR+E+ S SER   +++IME+G+LV   +VL+L+++AMV  + ++ GFLIDGYPRE++QG+ F   I     VI    S D M  RLL+R ++S R +D A++I KRL+ ++  + PV+ +YE++ +
Sbjct:   32 LRKCKIIFLMGGPGSGKGTQCEKLAEKYGFTHLSTGELLRQELTSESERSKLIRDIMERGDLVPSGVVLELLKEAMVASLGNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSQSSQRGEDGAKSIAKRLEAYHRASIPVVTYYERKTQ 196          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|P25824|KAD_SCHMA (Adenylate kinase OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.055e-84
Identity = 124/190 (65.26%), Postives = 150/190 (78.95%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KL  AKVIFVLGGPGSGKGTQCEK+V K+ FNHLSSGDLLR EV+SGS +G +LK +ME+GELV L++VL L+++AM+  +      L   YPREL+QG +FE E+ PC CVI F VSE+VMR RLLKR ETS RVDDN ETI+KR +TFNELTKPVI+HY++Q+K   IDASGT+D IFDKV H + K 
Sbjct:    5 KLAKAKVIFVLGGPGSGKGTQCEKLVQKFHFNHLSSGDLLRAEVQSGSPKGKELKAMMERGELVPLEVVLALLKEAMINWLTKIVISLSIRYPRELDQGIKFEKEVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEETIVKRFRTFNELTKPVIEHYKQQNKVITIDASGTVDAIFDKVNHELQKF 194          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|P05081|KAD1_CHICK (Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9031 GN=AK1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.799e-79
Identity = 118/190 (62.11%), Postives = 147/190 (77.37%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK  K+IFV+GGPGSGKGTQCEKIV+KYG+ HLS+GDLLR EV SGSERG KL+ IMEKGELV LD VLD++RDAM+ K D S GFLIDGYPRE++QG+ FE +I P   ++     ++ M  RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  Y+ +    Q++A GT+DE+F +V   +DKL
Sbjct:    5 KLKHHKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRAEVSSGSERGKKLQAIMEKGELVPLDTVLDMLRDAMLAKADTSKGFLIDGYPREVKQGEEFEKKIAPPTLLLYVDAGKETMVKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYKGRGIVRQLNAEGTVDEVFQQVCSYLDKL 194          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q9R0Y5|KAD1_MOUSE (Adenylate kinase isoenzyme 1 OS=Mus musculus OX=10090 GN=Ak1 PE=1 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 5.706e-79
Identity = 116/190 (61.05%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGSERG KL  IMEKGELV LD VLD++RDAM+ K+D S+GFLIDGYPRE++QG+ FE +I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+   T+PVI  Y+K+    +++A GT+D +F +V   +D L
Sbjct:    4 KLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSL 193          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|P00569|KAD1_RABIT (Adenylate kinase isoenzyme 1 OS=Oryctolagus cuniculus OX=9986 GN=AK1 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 3.982e-77
Identity = 114/190 (60.00%), Postives = 144/190 (75.79%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV+KYG+ HLS+GDLLR EV SGS RG KL EIMEKG+LV L+ VLD++RDAMV K D S GFLIDGYPR+++QG+ FE  I     ++      + M+ RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  YEK+    +++A G++D +F +V   +D L
Sbjct:    4 KLKKAKIIFVVGGPGSGKGTQCEKIVHKYGYTHLSTGDLLRAEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKADTSKGFLIDGYPRQVQQGEEFERRIAQPTLLLYVDAGPETMQKRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDNVFSQVCTHLDAL 193          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|P39069|KAD1_RAT (Adenylate kinase isoenzyme 1 OS=Rattus norvegicus OX=10116 GN=Ak1 PE=1 SV=3)

HSP 1 Score: 236.884 bits (603), Expect = 5.957e-77
Identity = 112/190 (58.95%), Postives = 143/190 (75.26%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KLK AK+IFV+GGPGSGKGTQCEKIV KYG+ HLS+GDLLR EV SGS RG  L  IMEKGELV L+ VLD++RDAM+ K+D S+GFLIDGYPRE++QG+ FE +I     ++      + M  RLLKRGETSGRVDDN ETI KRL+T+ + T+PVI  Y+K+    +++A G++D +F +V   +D L
Sbjct:    4 KLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQVCTYLDSL 193          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A0V0J550 (Adenylate kinase OS=Schistocephalus solidus OX=70667 GN=KAD PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 7.988e-93
Identity = 139/190 (73.16%), Postives = 160/190 (84.21%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            KL  AKVIFVLGGPGSGKGTQCE IV KYGFNHLSSGDLLR EV SGS RGN+LK IMEKGELVSLD+VL LI+DAM+K +D +  FLIDGYPRELEQG RFE+EI  C CV+ F VSE+VMR RLLKRGE+SGR DDNAETII RLKTFNELTKPVI+HY+K++K  +IDAS +I+E+F  V   ++K+
Sbjct:    5 KLSGAKVIFVLGGPGSGKGTQCENIVKKYGFNHLSSGDLLRAEVASGSPRGNELKAIMEKGELVSLDVVLQLIKDAMIKLVDKNCHFLIDGYPRELEQGTRFESEICKCLCVLVFDVSEEVMRQRLLKRGESSGRADDNAETIINRLKTFNELTKPVIEHYDKENKVVRIDASPSIEEVFKTVQVELEKV 194          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A267DJU2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009333g1 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 1.700e-90
Identity = 134/193 (69.43%), Postives = 159/193 (82.38%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKK-IDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKLHM 809
            +LK AKVIFVLGGPGSGKGTQCE+IV KYG  HLSSGDLLR EV SGSERGN+LK IME GELVSLDIVL+LIRDAM+ +    + GFLIDGYPRELEQG RFE+E++PC+ V+ F VSE+VM+ RLLKRGETSGRVDDN  TI KR +TF +LTKPVI+HY+ Q K  Q+DASG++DE+F +V   +D L +
Sbjct:    6 QLKDAKVIFVLGGPGSGKGTQCERIVAKYGLAHLSSGDLLRAEVASGSERGNRLKAIMESGELVSLDIVLELIRDAMLARGAAGAKGFLIDGYPRELEQGVRFESELVPCKAVLFFDVSEEVMQQRLLKRGETSGRVDDNEATIRKRFQTFQQLTKPVIEHYKGQGKVIQVDASGSVDEVFGQVQKQLDALKL 198          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A267GXR7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002781g1 PE=3 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 4.345e-90
Identity = 133/193 (68.91%), Postives = 158/193 (81.87%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKK-IDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKLHM 809
            +LK AKVIFVLGGPGSGKGTQCE+IV KYG  HLSSGDLLR EV SGSERGN+LK IME GELVSLDIVL+LIRDAM+ +    + GFLIDGYPRELEQG RFE+E++PC+ V+ F VSE+ M+ RLLKRGETSGRVDDN  TI KR +TF +LTKPVI+HY+ Q K  Q+DASG++DE+F +V   +D L +
Sbjct:    6 QLKDAKVIFVLGGPGSGKGTQCERIVAKYGLAHLSSGDLLRAEVASGSERGNRLKAIMESGELVSLDIVLELIRDAMLARGAAGAKGFLIDGYPRELEQGVRFESELVPCKAVLFFDVSEEAMQQRLLKRGETSGRVDDNEATIRKRFQTFQQLTKPVIEHYKGQGKVIQVDASGSVDEVFGQVQKQLDALKL 198          
BLAST of Adenylate kinase vs. TrEMBL
Match: Q86BY2 (Adenylate kinase OS=Schistosoma japonicum OX=6182 GN=Ak1 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 6.427e-90
Identity = 129/191 (67.54%), Postives = 161/191 (84.29%), Query Frame = 3
Query:  231 SKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
             KL  AKVIFVLGGPGSGKGTQCEK+V+K+ FNHLSSGDLLR EV+SGS++G +LK +ME+GELV L++VL L+++AM+K +D +  FLIDGYPREL+QG +FE E+ PC CVI F VSE+VMR RLLKR ETS RVDDN ETI+KR +TFNELTKPVI++Y+KQ+K   IDASGT+D+IF+K+TH + K 
Sbjct:    4 QKLAKAKVIFVLGGPGSGKGTQCEKLVHKFNFNHLSSGDLLRAEVQSGSQKGKELKAMMERGELVPLEVVLSLLKEAMIKLVDKNCHFLIDGYPRELDQGLKFEKEVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEETIVKRFRTFNELTKPVIEYYKKQNKVITIDASGTVDDIFEKLTHELQKF 194          
BLAST of Adenylate kinase vs. TrEMBL
Match: C1LL44 (Adenylate kinase 1 OS=Schistosoma japonicum OX=6182 GN=Ak1 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 3.196e-89
Identity = 128/191 (67.02%), Postives = 160/191 (83.77%), Query Frame = 3
Query:  231 SKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
             KL  AKVIFVLGGPGSGKGTQCEK+V+K+ FNHLSSGDLLR EV+SGS++G +LK +ME+GELV L++VL L+++ M+K +D +  FLIDGYPREL+QG +FE E+ PC CVI F VSE+VMR RLLKR ETS RVDDN ETI+KR +TFNELTKPVI++Y+KQ+K   IDASGT+D+IF+K+TH + K 
Sbjct:    4 QKLAKAKVIFVLGGPGSGKGTQCEKLVHKFNFNHLSSGDLLRAEVQSGSQKGKELKAMMERGELVPLEVVLSLLKETMIKLVDKNCHFLIDGYPRELDQGLKFEKEVCPCLCVINFDVSEEVMRKRLLKRAETSNRVDDNEETIVKRFRTFNELTKPVIEYYKKQNKVITIDASGTVDDIFEKLTHELQKF 194          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 225.328 bits (573), Expect = 2.475e-73
Identity = 109/190 (57.37%), Postives = 140/190 (73.68%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            K+K AK+IFV+GGPGSGKGTQCEK+V KYG+ HLSSGDLLR EV SGSERG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I     ++      + M  RL+KRGETSGR DDN ETI KRL  + + T+PVI  YE +    +I++   +D++F +V+  ID L
Sbjct:    4 KIKDAKIIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPALLLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYEGRGIVRKINSELAVDDVFAEVSKAIDGL 193          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 225.328 bits (573), Expect = 3.591e-73
Identity = 110/195 (56.41%), Postives = 141/195 (72.31%), Query Frame = 3
Query:  219 DEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            D    K+K AK+IFV+GGPGSGKGTQCEK+V KYG+ HLSSGDLLR EV SGSERG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I     ++      + M  RL+KRGETSGR DDN ETI KRL  + + T+PVI  YE +    +I++   +D++F +V+  ID L
Sbjct:   18 DPQPDKIKDAKIIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPALLLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYEGRGIVRKINSELAVDDVFAEVSKAIDGL 212          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:103035193])

HSP 1 Score: 212.616 bits (540), Expect = 1.507e-68
Identity = 102/162 (62.96%), Postives = 124/162 (76.54%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYE 719
            K+K AK+IFV+GGPGSGKGTQCEK+V KYG+ HLSSGDLLR EV SGSERG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I     ++      + M  RL+KRGETSGR DDN ETI KRL  + + T+PVI  YE
Sbjct:    4 KIKDAKIIFVVGGPGSGKGTQCEKVVAKYGYTHLSSGDLLRAEVASGSERGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGAPALLLYVDAKSETMVKRLMKRGETSGRADDNEETIKKRLDLYYKATEPVITFYE 165          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: cmpk (cytidine/uridine monophosphate kinase 1 [Source:NCBI gene;Acc:103043729])

HSP 1 Score: 157.532 bits (397), Expect = 1.333e-46
Identity = 82/191 (42.93%), Postives = 127/191 (66.49%), Query Frame = 3
Query:  249 KVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAM---VKKIDHSHGFLIDGYPRELEQGKRFENEI---IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
            +V+FVLGGPG+GKGTQC +IV  Y + HLS+GDLLREE   +GSE G  +   +++G++V ++I ++L+R AM   +K  ++   FLIDG+PR  +  + +   +      + V+ F  S +V   R L+RG++SGR DDN E++ KR++T+ + T+P+I+ YE+Q K   IDAS  +DE+F  V  V+DK
Sbjct:   27 QVVFVLGGPGAGKGTQCARIVQNYSYTHLSAGDLLREERSRTGSEFGQLIDSYIKEGKIVPVEITINLLRKAMEETMKADENKFRFLIDGFPRNQDNLQGWTTVMDGKADVKFVLFFDCSNEVCIDRCLERGKSSGRTDDNRESLEKRIQTYLQSTRPIIEQYEQQGKVRCIDASRDVDEVFADVKKVLDK 217          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:103029093])

HSP 1 Score: 138.658 bits (348), Expect = 1.430e-36
Identity = 73/188 (38.83%), Postives = 111/188 (59.04%), Query Frame = 3
Query:  240 KSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI-IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETII-KRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            K  KVIFV+GGPGSGK  QCEKI  +YG   L   D+L  E++S SERG   ++++E+GE +  D +LDL+ ++M   + H  GFL+ G+PR+L Q + +E ++  PC  V+      D M  RL +R  +S R  +  +    +R+ +F     PVI HYE +   H+IDA    DE+F+++   +D
Sbjct:  374 KKPKVIFVIGGPGSGKALQCEKIEEQYGLKRLCPRDILCSELQSHSERGRFFRDVLERGEQLPEDTLLDLLCESMESTVRHGKGFLVSGFPRDLRQAEEYEAKMGKPC-VVLLLECCSDTMSRRLQQRTCSSLRSREARDRDAHRRVDSFCSTITPVIHHYEHKGVLHKIDAEQPPDEVFEQICLALD 560          

HSP 2 Score: 118.242 bits (295), Expect = 2.598e-29
Identity = 61/187 (32.62%), Postives = 110/187 (58.82%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEV---ESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             KVI ++GGPGSGKGTQ  KI  +YGF ++S G+LLR+ +    + + + + + +I+  GEL   +  +  I+  ++K I  ++G +IDG+PR++ Q   FE++I   + V+  + S   ++ RL KR E  GR DDN +   +RL  F +   P++ +++++     +DA    +E+F  ++  +D
Sbjct:  132 PKVILIIGGPGSGKGTQSLKIAERYGFEYVSVGELLRKRMIHNATSNRKWSLIAKIITNGELAPQETTITEIKQKIMK-IPDANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACSNQRLKERLEKRAEQQGRPDDNPKATERRLANFKQNAVPLVKYFQEKGLIVTLDADRDEEEVFYDISMTVD 317          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 110.538 bits (275), Expect = 1.427e-29
Identity = 61/180 (33.89%), Postives = 101/180 (56.11%), Query Frame = 3
Query:  267 GGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEV--ESGSERGNKL-KEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            GGPGSGKGTQ  K+   YG   +S G++LR+ V   + S R  +L  +I+ KGEL   +  +  ++   ++  D + GF+IDG+PRE+ Q   FE ++   + VI  + + + +R RL +R +  GR DDN   + +RL TF + T P++ HY+++      DA     E+F  +   ++
Sbjct:    1 GGPGSGKGTQSRKLSESYGLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPD-APGFVIDGFPREISQALAFEEQVGAPDAVILLACASERLRQRLGERADRHGRPDDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELFGDIGAAVE 179          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004823.1 (pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 gene:ENSPMAG00000004380.1 transcript:ENSPMAT00000004823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.301e-6
Identity = 34/131 (25.95%), Postives = 69/131 (52.67%), Query Frame = 3
Query:  219 DEAKSKLKSAK--VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIP--CECVIAFSVSEDVM 599
            DEA+ ++  +K   + VLG PG GK T   ++   +    +    ++++ +++ +E G  L+E + KGE++S + V  L+ + +       +G+++ G+P   E     EN  IP   E + ++S+  DV+
Sbjct:    4 DEAEMQMLLSKPLCLLVLGKPGVGKATLARRLTKVWRCVLVEGVAVIQQHIDAQTETGIMLQERLVKGEVISEETVTRLLLEKLASPQVAHYGYVLCGFPSLSE-----ENLTIPQQIELIKSWSLKPDVI 129          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 169.474 bits (428), Expect = 2.705e-52
Identity = 82/183 (44.81%), Postives = 126/183 (68.85%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLR-EEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKID-HSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVI 794
            VIFVLGGPG+GKGTQCEK+V  Y F HLS+GDLLR E+  +GS+ G  +K  +++G++V  +I L L+R+A+   +  + H FLIDG+PR+++Q   FE +I+  + ++ F   ED+M  RLL+RG+TSGR DDN E+I KR  TF E + PVI+++E + K  ++    ++++++  V   I
Sbjct:   18 VIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIVESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDVQDAI 200          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 108.612 bits (270), Expect = 9.684e-29
Identity = 60/213 (28.17%), Postives = 112/213 (52.58%), Query Frame = 3
Query:  255 IFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI----IPCECVIAFSVSEDVMRARLLKR--GETSG-------------------------RVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK 800
            + ++G PG+GKGTQ   +  ++   HL++GD+LR ++  G++ G + K+IM++G LVS DI++++I+D +       +GF++DG+PR + Q ++ +  +     P E  I   V ++++ AR+  R     SG                         R DDNA+ + KRL  ++  T+P++D Y+K      +DAS     ++  + + + K
Sbjct:    9 MVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGK 221          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 74.7146 bits (182), Expect = 2.607e-16
Identity = 53/186 (28.49%), Postives = 90/186 (48.39%), Query Frame = 3
Query:  267 GGPGSGKGTQCEKIVNKYG-FNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLI--RDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGET------SGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEK 722
            G PGSGKGTQ  +++ +    + +SSGD+LR+E++S S  G +    + +G+L+  D++  LI  R + +  +  S  +L+DG+PR   Q    +  +   +  +   V  DV  + +L+R E       SGRV                         DD AE   KRL+ + +  +P+ D+Y+K
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKK 206          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 223.016 bits (567), Expect = 4.593e-73
Identity = 109/180 (60.56%), Postives = 138/180 (76.67%), Query Frame = 3
Query:  264 LGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            LGGPGSGKGTQC +IV K+G+ H S+GDLLREEV SGSERG  +  +MEKGELV   I+L+L+R AMVK+  ++ GFLIDG+PRELEQG  FE E+  CE ++ F  S D M+ARLLKRGETSGRVDDN ETI+ RL+TF   T PVI+HY+++ K  +I A G  DE+F KV+ V+++L
Sbjct:    1 LGGPGSGKGTQCARIVEKFGYTHFSTGDLLREEVNSGSERGKNIVAMMEKGELVPNGIILELLRLAMVKQ-PNTTGFLIDGFPRELEQGLEFEKELALCELLLYFECSPDTMKARLLKRGETSGRVDDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVFKKVSRVLEEL 179          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 192.971 bits (489), Expect = 3.975e-61
Identity = 94/183 (51.37%), Postives = 132/183 (72.13%), Query Frame = 3
Query:  255 IFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            I  LGGPG+GKGT C+ +V KY + HLS+GDLLREEV  G+ERG  + E+M +G+LV  +I + L++DAM +  D   GFLIDG+PR+++QG  FE ++   + V+    +E+VM+ RLLKR ETSGR DDN ETI KR  TF E T PV++HYEKQ KAH+IDAS  ++E+++ ++ +  +L
Sbjct:    4 IITLGGPGAGKGTICDSVVKKYNYCHLSAGDLLREEVTRGNERGQMITEMMREGKLVPKEITIGLLQDAMREHKDMP-GFLIDGFPRDIDQGITFEEQVTDSDFVLYLECTEEVMQERLLKRAETSGRPDDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISSLFAEL 185          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 157.532 bits (397), Expect = 2.175e-47
Identity = 81/187 (43.32%), Postives = 120/187 (64.17%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFE---NEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            VIFVLGGPG+GKGTQCE+IV +YG+ HLS+G+LLREE  SGS+ G+ ++  M +G++V + I + L++ AM K       FLIDG+PR  +  + +E   N+ +  + V+ F   ED+   R++ RG++SGR DDN E++ KR  T    T P+I+HY +Q     I  + T DE+F +V  V + L
Sbjct:    9 VIFVLGGPGAGKGTQCERIVKEYGYVHLSAGELLREERRSGSKDGDLIENCMTEGKIVPVAITVSLLQKAMAK--SDVQKFLIDGFPRNEDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSRGQSSGRPDDNIESLRKRFHTHENSTMPIIEHYRRQGLVKPISGAPTPDEVFLQVKRVFESL 193          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 103.99 bits (258), Expect = 1.735e-26
Identity = 70/215 (32.56%), Postives = 111/215 (51.63%), Query Frame = 3
Query:  258 FVLGGPGSGKGTQCEK----IVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRF----ENEIIPCECVIAFSVSEDVMRARLLKR--GETSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             +LG PGSGKGTQ ++    IV    F      D+LR  V SGS  G K+K +M+ G+LVS D+V++LI D + K  +  +G+L+DG+PR + Q ++     E      + V+ F++++ ++  R+  R   ++SGR                          DDN  T+ KRL+ ++  T P+ID+Y K+   H+IDAS   D ++  V    D
Sbjct:   18 ILLGPPGSGKGTQVKRRRISIVVCLLF-----CDMLRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTKP-ECQNGWLLDGFPRTVAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDITGEPLERRSDDNEATLTKRLQAYHSQTTPLIDYYTKRGIHHKIDASKPPDTVYSSVLKAFD 226          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 90.8929 bits (224), Expect = 7.834e-22
Identity = 61/182 (33.52%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  264 LGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHG-FLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRG--ETSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQ 725
            +G PGSGKGT  E+IV  +G  HLSSG+LLR  V++ ++ G + +  + KGELV  ++++DLI    + ++D   G +L+DG+PR + Q +   +E    + V+   V    +  R+ +R     SGRV                         DD  ET++ RLK + E TKP+I++Y K+
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNHTDLGEEAQAYILKGELVPDELMVDLI----LHELDAKKGNWLLDGFPRTVGQAETL-SEKHKIDVVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETVMARLKKYEEQTKPLIEYYNKK 177          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 226.483 bits (576), Expect = 9.063e-74
Identity = 113/195 (57.95%), Postives = 148/195 (75.90%), Query Frame = 3
Query:  222 EAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI-IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            +++ K+K AK+IFV+GGPGSGKGTQCE+IV KYG+ HLSSGDLLR EV SGS+RG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I  PC  +   + SE +++ RLLKRGETSGR DDN ETI KRL  + + T+PVI  YE +    ++D+   +DE+F +V+  ID L
Sbjct:    6 DSQDKIKDAKIIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIK-RLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 199          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 226.098 bits (575), Expect = 1.254e-73
Identity = 113/191 (59.16%), Postives = 145/191 (75.92%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI-IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            K+K AK+IFV+GGPGSGKGTQCE+IV KYG+ HLSSGDLLR EV SGS+RG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I  PC  +   + SE +++ RLLKRGETSGR DDN ETI KRL  + + T+PVI  YE +    ++D+   +DE+F +V+  ID L
Sbjct:    4 KIKDAKIIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIK-RLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 193          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 226.098 bits (575), Expect = 1.353e-73
Identity = 113/191 (59.16%), Postives = 145/191 (75.92%), Query Frame = 3
Query:  234 KLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEI-IPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKL 803
            K+K AK+IFV+GGPGSGKGTQCE+IV KYG+ HLSSGDLLR EV SGS+RG +L+ IM+KGELV LD VLD+I+DAM+ K D S GFLIDGYPRE++QG+ FE +I  PC  +   + SE +++ RLLKRGETSGR DDN ETI KRL  + + T+PVI  YE +    ++D+   +DE+F +V+  ID L
Sbjct:    4 KIKDAKIIFVVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEEFEKKIGKPCLLLYVDAKSETMIK-RLLKRGETSGRSDDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSL 193          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:101172192])

HSP 1 Score: 122.479 bits (306), Expect = 7.538e-31
Identity = 63/187 (33.69%), Postives = 113/187 (60.43%), Query Frame = 3
Query:  246 AKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEV---ESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
             KVI V+GGPGSGKGTQ  KI  +YGF ++S G+LLR+++    + + + + + +I+  GEL   +  +  I+  ++K I  ++G +IDG+PR++ Q   FE++I   + V+  + +   ++ RL KR E  GR DDN + I +RL  F + T P++ +++++     +DA    +E+F  ++  +D
Sbjct:  132 PKVILVIGGPGSGKGTQSLKIAERYGFQYVSVGELLRKKMIHNATSNRKWSLIAKIITNGELAPQETTITEIKQKIMK-IPEANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLD 317          

HSP 2 Score: 115.931 bits (289), Expect = 1.647e-28
Identity = 60/188 (31.91%), Postives = 112/188 (59.57%), Query Frame = 3
Query:  240 KSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAET---IIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVI 794
            K  KVIF++GGPGSGK  QCE++  ++G   ++ GDLL  E++S S+RG  L +I+E+GE +    +L+L+ DA+        G ++  +PR+L Q + +E ++     VI  + S + M +R L RG +S  +  +++T   + +R ++F   ++ V  +YE++   + +DA  + DE+F ++  ++
Sbjct:  375 KKPKVIFMMGGPGSGKTLQCERMEERFGLRRVALGDLLCSELQSHSDRGRHLLDILERGEKLPEVALLELLCDAVASSARQGKGLVVSSFPRDLSQAQEYEAKMGDPSAVILLTCSPETMSSRSLHRGRSSSSLLASSDTEGSLSRRSESFCSDSQEVTAYYERKKLLYTVDAETSPDEVFLQICQMM 562          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak5 (adenylate kinase 5 [Source:NCBI gene;Acc:101172192])

HSP 1 Score: 122.479 bits (306), Expect = 9.667e-31
Identity = 63/186 (33.87%), Postives = 113/186 (60.75%), Query Frame = 3
Query:  249 KVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEV---ESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVID 797
            KVI V+GGPGSGKGTQ  KI  +YGF ++S G+LLR+++    + + + + + +I+  GEL   +  +  I+  ++K I  ++G +IDG+PR++ Q   FE++I   + V+  + +   ++ RL KR E  GR DDN + I +RL  F + T P++ +++++     +DA    +E+F  ++  +D
Sbjct:  178 KVILVIGGPGSGKGTQSLKIAERYGFQYVSVGELLRKKMIHNATSNRKWSLIAKIITNGELAPQETTITEIKQKIMK-IPEANGIVIDGFPRDVGQALSFEDQICTPDLVVFLACANHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTLDADRNEEEVFCDISMTLD 362          

HSP 2 Score: 116.316 bits (290), Expect = 1.565e-28
Identity = 60/188 (31.91%), Postives = 112/188 (59.57%), Query Frame = 3
Query:  240 KSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAET---IIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVI 794
            K  KVIF++GGPGSGK  QCE++  ++G   ++ GDLL  E++S S+RG  L +I+E+GE +    +L+L+ DA+        G ++  +PR+L Q + +E ++     VI  + S + M +R L RG +S  +  +++T   + +R ++F   ++ V  +YE++   + +DA  + DE+F ++  ++
Sbjct:  420 KKPKVIFMMGGPGSGKTLQCERMEERFGLRRVALGDLLCSELQSHSDRGRHLLDILERGEKLPEVALLELLCDAVASSARQGKGLVVSSFPRDLSQAQEYEAKMGDPSAVILLTCSPETMSSRSLHRGRSSSSLLASSDTEGSLSRRSESFCSDSQEVTAYYERKKLLYTVDAETSPDEVFLQICQMM 607          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 409.838 bits (1052), Expect = 4.090e-146
Identity = 202/204 (99.02%), Postives = 203/204 (99.51%), Query Frame = 3
Query:  201 MPHKKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKLHMS 812
            MP KKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIF+KVTHVIDKLHMS
Sbjct:    1 MPQKKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFEKVTHVIDKLHMS 204          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000043019.1 (SMESG000043019.1)

HSP 1 Score: 110.538 bits (275), Expect = 2.592e-30
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 3
Query:  267 GGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSL 431
            GGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSL
Sbjct:   30 GGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSL 84          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 103.99 bits (258), Expect = 3.186e-26
Identity = 68/224 (30.36%), Postives = 117/224 (52.23%), Query Frame = 3
Query:  231 SKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKR----FENEIIPCECVIAFSVSEDVMRARLLKR--GETSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDKLHM 809
            S+ KS+    +LG  GSGKGTQ  K+  K+   HLS+GD+LR  V SGS  G ++ EIM+KG L+S +IV  LI + +    +  +GF++DG+PR + Q ++     E      + VI  S  + ++  R+  R    TSGR                          DDN +T+   L+++    +P++ +YEK++  H+++A+   D++F  +  + + +H+
Sbjct:    7 SQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENL-NHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLRSYRTEMEPLVCYYEKRNLYHRVEAAQPPDKVFHDILKIFENIHL 229          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000031498.1 (SMESG000031498.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.864e-25
Identity = 62/144 (43.06%), Postives = 86/144 (59.72%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVE-SGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPR---ELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKR 671
            VIFVLGGPGSGKGTQC  I  ++G+ HLS+GDLLR E +   S+ G  + + +++G +V + I   LI +AM  K    + FLIDG+PR    L+   +     +  E ++    SE+V   R L RG  +GR DDN ET+ KR
Sbjct:   15 VIFVLGGPGSGKGTQCANISKRFGYVHLSAGDLLRAEKDKPNSKFGELIIKNIKEGTIVPVAITCSLIENAM--KESGKYKFLIDGFPRNKDNLDGWNKAMTGKVIIESILYIDCSEEVCVKRCLGRG--TGRADDNEETLKKR 154          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000031478.1 (SMESG000031478.1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.151e-23
Identity = 61/159 (38.36%), Postives = 88/159 (55.35%), Query Frame = 3
Query:  252 VIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREE-VESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQ---GKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDNAETIIKRLKTFNELTKPVIDHY 716
            VI VLG PGSGKGTQC KI  +Y ++H+S+G LL++E +    + G  +K    KG +V  +I   LI   M K    S  F+IDG+PR  +     K F  +    +CV+    SE+V R R L+R   S    D+ + + KRLK FN+ T+ V+  +
Sbjct:    9 VIIVLGYPGSGKGTQCNKIEKEYNYHHISAGYLLQKETLNPQMKYGEIIKSHRSKGTIVPHEITCKLILQEM-KSSQKSKKFVIDGFPRNEDNFIGWKSFLVKHCSLQCVLFIDCSEEVCRKRCLQRNRDSA---DSVDVVDKRLKQFNDETRLVLQQF 163          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK11.695e-7757.71adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK14.835e-7759.47adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK14.835e-7759.47adenylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK53.264e-5749.21adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK55.509e-5749.21adenylate kinase 5 [Source:HGNC Symbol;Acc:HGNC:36... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F38B2.45.680e-7355.28Adenylate kinase isoenzyme 1 [Source:UniProtKB/Sw... [more]
C29F7.31.076e-3538.17UMP-CMP kinase 1 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.11.919e-3236.56UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.11.919e-3236.56UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
F40F8.11.919e-3236.56UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk11.131e-5450.00gene:FBgn0022709 transcript:FBtr0076017[more]
Adk11.600e-5450.00gene:FBgn0022709 transcript:FBtr0076018[more]
Dak18.119e-4140.31gene:FBgn0028833 transcript:FBtr0084976[more]
Adk27.336e-3133.96gene:FBgn0283494 transcript:FBtr0072163[more]
Adk35.266e-1730.81gene:FBgn0042094 transcript:FBtr0082331[more]
back to top
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak16.672e-7357.37adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04082... [more]
ak19.448e-7357.37adenylate kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04082... [more]
cmpk2.879e-4642.19cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk3.337e-4642.19cytidylate kinase [Source:NCBI gene;Acc:406383][more]
cmpk4.216e-4642.19cytidylate kinase [Source:NCBI gene;Acc:406383][more]
back to top
BLAST of Adenylate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak13.464e-7657.89adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak11.667e-7557.22adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak15.657e-7056.91adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak11.641e-6957.30adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
ak13.589e-6962.05adenylate kinase 1 [Source:NCBI gene;Acc:448536][more]
back to top
BLAST of Adenylate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak18.157e-8061.05adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak18.157e-8061.05adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak12.367e-7961.05adenylate kinase 1 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak51.142e-5445.50adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677... [more]
Ak51.322e-5248.48adenylate kinase 5 [Source:MGI Symbol;Acc:MGI:2677... [more]
back to top
BLAST of Adenylate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25824|KAD_SCHMA1.055e-8465.26Adenylate kinase OS=Schistosoma mansoni OX=6183 PE... [more]
sp|P05081|KAD1_CHICK1.799e-7962.11Adenylate kinase isoenzyme 1 OS=Gallus gallus OX=9... [more]
sp|Q9R0Y5|KAD1_MOUSE5.706e-7961.05Adenylate kinase isoenzyme 1 OS=Mus musculus OX=10... [more]
sp|P00569|KAD1_RABIT3.982e-7760.00Adenylate kinase isoenzyme 1 OS=Oryctolagus cunicu... [more]
sp|P39069|KAD1_RAT5.957e-7758.95Adenylate kinase isoenzyme 1 OS=Rattus norvegicus ... [more]
back to top
BLAST of Adenylate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J5507.988e-9373.16Adenylate kinase OS=Schistocephalus solidus OX=706... [more]
A0A267DJU21.700e-9069.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GXR74.345e-9068.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
Q86BY26.427e-9067.54Adenylate kinase OS=Schistosoma japonicum OX=6182 ... [more]
C1LL443.196e-8967.02Adenylate kinase 1 OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak12.475e-7357.37adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
ak13.591e-7356.41adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
ak11.507e-6862.96adenylate kinase 1 [Source:NCBI gene;Acc:103035193... [more]
cmpk1.333e-4642.93cytidine/uridine monophosphate kinase 1 [Source:NC... [more]
ak51.430e-3638.83adenylate kinase 5 [Source:NCBI gene;Acc:103029093... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ak5l1.427e-2933.89adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000004823.11.301e-625.95pep scaffold:Pmarinus_7.0:GL476574:21704:35297:-1 ... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
URA62.705e-5244.81Uridylate kinase; catalyzes the seventh enzymatic ... [more]
ADK19.684e-2928.17Adenylate kinase, required for purine metabolism; ... [more]
ADK22.607e-1628.49Mitochondrial adenylate kinase; catalyzes the reve... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388644.593e-7360.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388633.975e-6151.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361602.175e-4743.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305501.735e-2632.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425837.834e-2233.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak19.063e-7457.95adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak11.254e-7359.16adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak11.353e-7359.16adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak57.538e-3133.69adenylate kinase 5 [Source:NCBI gene;Acc:101172192... [more]
ak59.667e-3133.87adenylate kinase 5 [Source:NCBI gene;Acc:101172192... [more]
back to top
BLAST of Adenylate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060686.14.090e-14699.02SMESG000060686.1[more]
SMESG000043019.12.592e-30100.00SMESG000043019.1[more]
SMESG000037481.13.186e-2630.36SMESG000037481.1[more]
SMESG000031498.12.864e-2543.06SMESG000031498.1[more]
SMESG000031478.13.151e-2338.36SMESG000031478.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018224 ID=SMED30018224|Name=Adenylate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=959bp
TCCATTCTCATCTCTGTTCGATTAATTACCAGACTTTGGGGTAATAATAA
AATGTAAATATTGAAAGCGGGATAGAAAAATCATTTTATTAAATCTTACA
TCCAAAGTTAGAAATTATTTTGTGGCAAGTAAACACTATATAAGCAAGTG
TACTGAATCGAAATATTAGTTCATTAACAAATTTGATCGAATTTTAAATC
ATGCCTCACAAGAAAATAGATGAAGCCAAATCGAAACTAAAGTCAGCCAA
AGTTATTTTCGTTTTGGGTGGTCCAGGAAGTGGAAAAGGAACCCAATGTG
AAAAAATAGTTAATAAATATGGTTTTAATCATTTGTCCAGCGGTGACTTA
TTACGAGAAGAAGTAGAATCAGGCTCAGAAAGAGGAAATAAACTTAAAGA
AATAATGGAAAAAGGAGAACTTGTTTCATTAGACATTGTTCTCGATCTGA
TTCGAGATGCCATGGTAAAAAAAATTGACCACAGTCACGGCTTTCTAATT
GATGGTTACCCAAGAGAACTAGAACAAGGAAAGCGATTTGAAAACGAAAT
AATTCCATGTGAATGTGTCATAGCCTTTTCTGTGTCCGAAGATGTGATGA
GGGCAAGACTATTGAAACGTGGTGAAACCAGTGGCCGAGTTGATGACAAT
GCTGAAACAATAATTAAACGATTAAAAACCTTTAATGAACTAACCAAGCC
AGTTATTGATCACTACGAAAAACAACATAAAGCTCACCAAATTGACGCAT
CTGGCACTATTGATGAGATATTCGACAAAGTCACACATGTGATCGACAAA
TTACACATGTCTTAGATTTTATTCACTATCATAGAAGCTTTTTTCAAATA
TAGATTTAGAATAATTGACCTACGACTACACAATCCAGTGATAACCAACT
CTACTTTCAATATAATATTGTGCATGATGTGATATTGAAATACAATCGAT
CTAACCAGC
back to top

protein sequence of SMED30018224-orf-1

>SMED30018224-orf-1 ID=SMED30018224-orf-1|Name=SMED30018224-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=205bp
MPHKKIDEAKSKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDL
LREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLI
DGYPRELEQGKRFENEIIPCECVIAFSVSEDVMRARLLKRGETSGRVDDN
AETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFDKVTHVIDK
LHMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000850Adenylat/UMP-CMP_kin
IPR027417P-loop_NTPase
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0006516glycoprotein catabolic process
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0019205nucleobase-containing compound kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm