Tyrosinase-like protein

Overview
NameTyrosinase-like protein
Smed IDSMED30018211
Length (bp)1718
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Tyrosinase-like protein vs. Ensembl Human
Match: TYR (tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442])

HSP 1 Score: 211.46 bits (537), Expect = 1.069e-60
Identity = 132/454 (29.07%), Postives = 209/454 (46.04%), Query Frame = 3
Query:  105 TINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP----PMGNSKCVGC--HFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHL--ALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            +  + +G  P+ CV + +   K CCP   G   PCG + GRG C  +     P+   F     DDR  WP+ F+ R C C GNF G  C +C +G+ G NC  R + +RRNIF  S  E+ +F   L ++    S   V+   +         P+F      +   ++H Y S   L    ++   +  +D+ H   +F  WHR  +L WE+E+ K+   E    +F IPYWDW DA+KC++C + Y+G      +     L+   S F +W   CS         S C G      +R P  + +  +   P + D+ F L  + Y     +  +MD    F     LEGF       ++++   MHN +H  + G+M     ++NDP+F+LHH+ +D I E W + + P     P      G+ RE  +V  +P  ++ + F   ++LG  Y
Sbjct:   12 SFQTSAGHFPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQFPFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLVRRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFNDINIYDLFVWMHYYVSMDALLGGSEI---WRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDE----NFTIPYWDWRDAEKCDICTDEYMGG----QHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVEFCLSLTQY-----ESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLQEVYPEANAPIGHNRESYMVPFIPLYRNGDFFISSKDLGYDY 449          
BLAST of Tyrosinase-like protein vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 186.808 bits (473), Expect = 8.935e-52
Identity = 136/462 (29.44%), Postives = 212/462 (45.89%), Query Frame = 3
Query:   78 LLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIK-IRRNIFSFSELERMRFLRILEISNKM--PSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYL---STEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
             L+  +G   +    G  P+VC+   S   K CCP +       CG   GRG C +V     P +  +     DDR  WP +FF R C C GNF G  C  C +GW G NC+R+    IR+NI S S  ER +FL  L+++ K   P   +  +            P F   +  +F  ++H Y+ R TL    +   A   +D++H   +F TWHR  +L  ER+L ++   E     FA+PYW++   + +C+VC ++  GA    D      LI   S+F +W   C      +  V          L R  +   S + P  +D+   L    +   D      ++  +F  ALEGF   + + +S  + +HN VH+ + G+     +A+NDP+F++ HS  D I + W + ++P     P      G+ R  N+V   PPV + E+F   + LG +Y
Sbjct:    8 FLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRA---IDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE----SFALPYWNFATGRNECDVCTDQLFGAARPDDPT----LISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKF---DNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 455          
BLAST of Tyrosinase-like protein vs. Ensembl Human
Match: TYRP1 (tyrosinase related protein 1 [Source:HGNC Symbol;Acc:HGNC:12450])

HSP 1 Score: 177.563 bits (449), Expect = 3.040e-48
Identity = 130/458 (28.38%), Postives = 210/458 (45.85%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQP----CGGV-GRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSE-FLVLEESSPEHSDPLVN-PVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKK-CEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVG--CHFR-----KRFPPLN-RRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLY------MHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            P+ C    +     CCP       P    CG   GRG C+ V     P +  + +D   DR  WP RFF R C+C GNF G  C +C  GW G  CD+RV+ +RRN+   S+ E+  F+R L+++ +     F++    S E   P  N P F   +   +  + H Y+ + T     Q   +FG +D++H   +F TWHR  +L  E+++ ++     Q   F++PYW++   K  C++C +  +G+   +D      LI   S F  W   C   + +   +G  C+       +R P  N  R +    P  +D+   L    +       N+ +   +F   +EG+     S+ T  Y      +HN  H  + G+      + NDP+F+L H+  D + + W + Y+   +  P      G+ R+ N+V   PPV + EMF T  +NLG TY+
Sbjct:   27 PRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQ--ESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEM----LQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDST----LISPNSVFSQWRVVCD-SLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSNSTN---SFRNTVEGY-----SDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYE 465          
BLAST of Tyrosinase-like protein vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 170.244 bits (430), Expect = 1.937e-45
Identity = 138/495 (27.88%), Postives = 213/495 (43.03%), Query Frame = 3
Query:   78 LLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIK-IRRNIFSFSELERMRFLRILEISNKM--PSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYL---STEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFI-----------------------------LH----HSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
             L+  +G   +    G  P+VC+   S   K CCP +       CG   GRG C +V     P +  +     DDR  WP +FF R C C GNF G  C  C +GW G NC+R+    IR+NI S S  ER +FL  L+++ K   P   +  +            P F   +  +F  ++H Y+ R TL    +   A   +D++H   +F TWHR  +L  ER+L ++   E     FA+PYW++   + +C+VC ++  GA    D      LI   S+F +W   C      +  V          L R  +   S + P  +D+   L    +   D      ++  +F  ALEGF   + + +S  + +HN VH+ + G+     +A+NDP+F+                             LH    HS  D I + W + ++P     P      G+ R  N+V   PPV + E+F   + LG +Y
Sbjct:    8 FLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRA---IDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE----SFALPYWNFATGRNECDVCTDQLFGAARPDDPT----LISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKF---DNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVISNRLLYNATTNILEHVRKEKATKELPSLHVLVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQLGYSY 488          
BLAST of Tyrosinase-like protein vs. Ensembl Human
Match: DCT (dopachrome tautomerase [Source:HGNC Symbol;Acc:HGNC:2709])

HSP 1 Score: 72.0182 bits (175), Expect = 1.426e-13
Identity = 60/221 (27.15%), Postives = 101/221 (45.70%), Query Frame = 3
Query:  603 YASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYL---STEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHS 1250
            Y+ R TL    +   A   +D++H   +F TWHR  +L  ER+L ++   E     FA+PYW++   + +C+VC ++  GA    D      LI   S+F +W   C      +  V          L R  +   S + P  +D+   L    +   D      ++  +F  ALEGF   + + +S  + +HN VH+ + G+     +A+NDP+F+   S
Sbjct:    1 YSVRDTLLGPGRPYRA---IDFSHQGPAFVTWHRYHLLCLERDLQRLIGNE----SFALPYWNFATGRNECDVCTDQLFGAARPDDPT----LISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKF---DNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVKRES 207          
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Match: tyr (tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3])

HSP 1 Score: 209.534 bits (532), Expect = 3.338e-60
Identity = 135/443 (30.47%), Postives = 201/443 (45.37%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCG-GVGRGVCDKVYTHWEPIARVFKN---DDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPP----MGNSKCVGCHFRK--RFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTS--LYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+VC        K CCP+  G    CG   GRG C  V     P    + +   DDR  WP  F+ + C C GN+ G  C  C +G+ G NC  R   +RRNIF  S  ER RF+  L ++    S   ++   +    +    P+F   +  +   ++H Y SR  L       + +  +D+ H + +F  WHR  +L WE E+ K+   +F   +F IPYWDW DA+ C+VC +  +GA    +      LI   S F +W   CS P    +  + C G       R P  + R      P + D+  VLR + Y     +M+   N  +F  ALEGF       + +    MHN +H  + GSM     ++NDP+FI+HH+ ID I E W + + P  T  P      G+     +V  +P  ++ + F   + LG  Y
Sbjct:   22 PRVCTSPEVLQSKRCCPVWPGDGSVCGVQSGRGFCQDVLVSDLPNGPQYPHSGVDDRERWPLVFYNQTCQCAGNYMGFDCGECKFGFFGANCAERRESVRRNIFQLSTTERQRFISYLNLAKTTISPDYMIVTGTYAQMNNGSTPMFANISVYDLFVWMHYYVSRDALLGGPG--NVWADIDFAHESAAFLPWHRVYLLFWEHEIRKLT-GDF---NFTIPYWDWRDAQDCQVCTDELMGARSSLNRS----LISPSSVFSSWKVICSQPESYNLREALCDGSPEGPLLRNPGDHDRIRVPRLPTSADVESVLRLTDYETG--QMDRRANL-SFRNALEGFANPETGLAVTGRSLMHNSLHVFMNGSMSSVQGSANDPIFIIHHAFIDSIFEQWLRRHQPPRTHYPTANAPIGHNDGYFMVPFIPLYRNGDYFLSTKALGYEY 451          
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Match: tyrp1b (tyrosinase-related protein 1b [Source:ZFIN;Acc:ZDB-GENE-040718-249])

HSP 1 Score: 179.489 bits (454), Expect = 3.755e-49
Identity = 125/454 (27.53%), Postives = 199/454 (43.83%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGF-HQPCGGV-GRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVL------EESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNR-------RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG-RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTT-QLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKL-ENLGVTYD 1427
            P+ C+        TCCP P G  +  CG + GRG C  +     P    + +D   DR  WP RFF R C C GNF G  C  C +G  G NCD+R+  +RRNI   S  E+  F+  L+ + +     LV+      E  SP+ +   V  +    T   +  + H Y+   T     Q   +FG +D++H    F TWHR  +L  ER++  +         FA+PYW++ +   +C++C +  +GA   +D       I   S F  W   C                   P+ R       R +    P  +D++  L  +++   D       + ++F   +EG+   + + +     +HN  H  + G+      + NDP+F+L H+  D I + W Q ++   T   P      G+ RE N+V   PP+++ EMF    +NLG TY+
Sbjct:   20 PRQCMTPEGLRSGTCCPSPTGLANDECGSISGRGQCVSITADRRPHGPQYPHDGRDDRERWPLRFFNRTCQCNGNFTGFNCGRCRHGLTGPNCDQRITVVRRNIMQMSADEKRAFVNALDQAKRTVHPDLVICTRRFQEILSPDGASVQVENI----TIYNYFVWTHYYSVSKTYMGPGQQ--SFGGVDFSHEGPGFVTWHRYHLLQLERDMQDMLGD----PSFALPYWNFAIGGSECDICTDDLIGARSSFDTNG----ISSNSVFSQWRVICESVEEYETLGTICNNTESSPIRRNPAGNVARPMVQRLPEPQDVIDCLELNTF---DTPPYYSTSSQSFRNTIEGYSAPQGNYDPVVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAIFDEWLQRHTAAGTLAYPEENAPIGHNREFNMVPFWPPIRNAEMFVSAPDNLGYTYE 456          
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 172.555 bits (436), Expect = 9.803e-47
Identity = 130/444 (29.28%), Postives = 199/444 (44.82%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRILEISNKM--PSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVG-CHFRKRFPPLNRRYLSTE--FPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLY-MHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+VC        K CCP +       CG + GRG C  V+   +P    +     DDR  WPT+FF R C C GNF G  C  C +GW G NCD+R   + R++I S S  E   FL  L++S     P   +  +            P F   +  +F  + H Y+ R TL    +    F  +D++H   +F TWHR  +L  EREL K+   E    +FA+PYW++   + +C+VC +  +G     D       I   S+F  W   C      ++ V  C+            +ST    P   D+   L    +   D      ++  +F  ALEG+   +    TS+  +HN VH  + G+   + +A+NDP+F++ H+  D I + W + +    T  P+     G+ R  N+V   PPV + E++   E LG +Y
Sbjct:   22 PRVCCTVEGIVSKECCPALGSDPANVCGLLAGRGNCSDVHVDSKPWGGPYSLRNVDDRERWPTKFFNRTCRCFGNFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGPNGTEPQFSNISIYDFFVWQHYYSVRDTLLGPGR---PFKAIDFSHKGPAFITWHRYHLLSLERELQKLTGNE----NFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSR----ISPRSRFARWGVVCDSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDF---DSPPYFTNSTFSFRNALEGYDKPDGELDTSVSNLHNLVHQFLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFRENET-FPDEMAPIGHNRHYNMVPFFPPVTNEEIYIASEQLGYSY 450          
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Match: tyrp1a (tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB-GENE-070718-2])

HSP 1 Score: 166.007 bits (419), Expect = 2.720e-44
Identity = 117/453 (25.83%), Postives = 197/453 (43.49%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGF-HQPCGG-VGRGVCDKVYTHWE---PIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVL------EESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNR-------RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG-RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            P+VCV         CCP P+G    PCG  +GRG C  V        P       DDR  WP RFF R C C GN+ G  C  C +   G  C +RV  +RRN+ + S  ++  F+  L+ + +     +V+      E   P++S    N    ++ +  F+ + H Y+   T   + +   +F  +D++H    F TWHR  +L  ER++  +     +   FA+P+WD+     +C++C +  +GA  ++D       I   S F +W   C                   P+ R       R +    P  +D+   L   ++        + D   +F  ++EG+       +     +HN  H  + G+      + NDP+F+L H+  D I + W + ++   +  P      G+ RE N+V   PPV++ EMF +  ++LG +Y+
Sbjct:   23 PRVCVTAEGLRSAQCCPSPNGLGDDPCGASLGRGQCVDVSADTRAHGPQYPYTGRDDRESWPRRFFTRACRCNGNYSGFDCGRCKHAHTGEECQQRVPVVRRNVLTLSAEQKRVFVSALDQAKRTTHPDIVIATRHYSEIFGPDNSTQFQN----ISIYNLFV-WTHYYSVSKTFLGDGE--PSFSAVDFSHEGPGFLTWHRYHLLQLERDMQDM----LRDPSFALPFWDFSTGGSECDICTDDLMGARSRFDST----AISSNSIFSSWRVICESVEDYDTLGTICNSTESSPIRRNPAGNVARPMVQRLPEAQDVAACLEIDAFDTPPFYSTSSD---SFRNSIEGYSAPEGPYDPVVRSLHNLAHLFLNGTGGQTHLSPNDPIFLLLHTFTDAIFDEWLRRHTADVSSYPLENAPIGHNREFNMVPFWPPVRNAEMFVSAADSLGYSYE 457          
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 132.109 bits (331), Expect = 4.636e-33
Identity = 103/370 (27.84%), Postives = 165/370 (44.59%), Query Frame = 3
Query:  339 NFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRILEISNKM--PSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVG-CHFRKRFPPLNRRYLSTE--FPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLY-MHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            NF G  C  C +GW G NCD+R   + R++I S S  E   FL  L++S     P   +  +            P F   +  +F  + H Y+ R TL    +    F  +D++H   +F TWHR  +L  EREL K+   E    +FA+PYW++   + +C+VC +  +G     D       I   S+F  W   C      ++ V  C+            +ST    P   D+   L    +   D      ++  +F  ALEG+   +    TS+  +HN VH  + G+   + +A+NDP+F++ H+  D I + W + +    T  P+     G+ R  N+V   PPV + E++   E LG +Y
Sbjct:    2 NFAGYNCGECKFGWTGLNCDQRKAPVLRKDIHSLSPEELQEFLNALDLSKTTVHPDYMIATQHWLGLLGPNGTEPQFSNISIYDFFVWQHYYSVRDTLLGPGR---PFKAIDFSHKGPAFITWHRYHLLSLERELQKLTGNE----NFAVPYWNFATGQSECDVCTDSLLGGRDPSDPSR----ISPRSRFARWGVVCDSLDEYNRLVTLCNGTNEGSLRRGAAMSTNVTLPTMNDVRSCLNLRDF---DSPPYFTNSTFSFRNALEGYDKPDGELDTSVSNLHNLVHQFLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFRENET-FPDEMAPIGHNRHYNMVPFFPPVTNEEIYIASEQLGYSY 356          
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100125152])

HSP 1 Score: 213.772 bits (543), Expect = 1.218e-61
Identity = 138/452 (30.53%), Postives = 202/452 (44.69%), Query Frame = 3
Query:  123 GLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPP--------MGNSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG-----RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYD 1427
            G  P+ C    S   K CCP+  G    CG + GRGVC  V          F     DDR +WPT F+ R C C GNF G  C  C +G+ G NC  R   IR+ IF  S  E+ +F+  L ++    S   V+   +    +   NP+F      +   ++H YASR        +   +  +D+ H   +F  WHR  +LHWE E+ K+   E    +F IP+WDW DA+ C++C +  +G      +     L+   S F +W   CS P        + N    G  FR   P  + R  +   P T ++   L  ++Y  + E M+   N  +F   LEGF        N S+S    MHN +H  + GSM     ++NDP+F+LHH+ +D I E W + +       P      G+ R   +V  +P   + E F    +LG  YD
Sbjct:   22 GQFPRACSTAESLLSKECCPVWSGDGSSCGQLSGRGVCQDVVLTSSATGPQFPFTGVDDRENWPTVFYNRTCQCLGNFMGYNCADCKFGFRGPNCTERRTMIRKEIFRMSSAEKSKFVAYLNLAKHTTSRDYVIVTGTYAQMNNGSNPMFADINVYDLFVWMHYYASRDVFIGEDAL---WRDIDFAHEAPAFVPWHRYFLLHWEHEIQKLTGDE----NFTIPFWDWRDAQGCDICTDELLGGV----HPTTTNLLSPASFFASWQIVCSRPEEYNAQRILCNGTGEGPLFRN--PGGHDRSRTPRLPTTAEVELCLSLTNY--ETEPMDRSANF-SFRNTLEGFADPRTGIANRSQSN---MHNSLHVFLNGSMSSVQGSANDPVFVLHHAFVDSIFEQWLRRHGASVDIYPEANAPIGHNRGYYMVPFIPLYTNGEFFAASRDLGYDYD 454          
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Match: tyrp1 (tyrosinase-related protein 1 [Source:NCBI gene;Acc:549230])

HSP 1 Score: 190.66 bits (483), Expect = 4.418e-53
Identity = 135/476 (28.36%), Postives = 216/476 (45.38%), Query Frame = 3
Query:   66 NLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP------IPDGFHQPCG-GVGRGVCDKVYTHWEPIA---RVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEESSPEHSDPLVNPVFFL-ATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNR-------RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRN-HSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            N S+ ++  +     + +S   P+ C    +     CCP       PD   Q CG  +GRG C  V     P     R+   DDR  WP RFF R C C G F+G  C SC  GW G NCD+ V  +RRNI    E E+ RF+  L+++ N M  ++++      E  DP+ N   F   +  +F  + H Y+   T     Q   + G +D++H   +F TWHR  ++  ER++ ++ +++     FA+PYW++ +   +C++C +  +GA   +D      L+   S F  W   C                R  P+ R       R +    P  +D+   L  + +   D      D+  +F   LEG+   N     T   +HN  H  + G+      + NDP+F+L H+  D + + W + ++  ++Q P      G+ R+ N+V   PPV + EMF T  ENLG +Y+
Sbjct:    6 NCSLYIVVILFLHHYDQVSAQFPRQCATAQALLSGECCPGLFPGQSPDPNDQ-CGLSLGRGQCGPVTVDTRPHGPQYRLDGLDDREQWPIRFFNRACRCNGRFYGHNCGSCKPGWTGDNCDQPVAVVRRNILELREEEKRRFVNALDLAKNTMHPDYVIATRRYAELIDPVQNTTNFENISIYDFFVWNHYYSVSKTFLGPGQ--GSEGGIDFSHEGPAFLTWHRYHLMQLERDM-QVMLRD---PSFALPYWNFAIGGNQCDICTDDLLGARSNFDAN----LLSTNSVFSQWQVVCEYVEDYESLGTICNSTRNSPIRRNPAGNVARPMVQRLPEPQDVALCLEVNMF---DTPPFFSDSSESFRNTLEGYSEPNGQYNPTVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWIRRHNADSSQYPLENAPIGHNRQYNMVPFWPPVTNNEMFLTAPENLGYSYE 467          
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:549915])

HSP 1 Score: 187.193 bits (474), Expect = 6.894e-52
Identity = 136/473 (28.75%), Postives = 221/473 (46.72%), Query Frame = 3
Query:   57 KGMNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRIL-EISNKMPSEFLVLEES-----SPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYLST---EFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            KG+   +LL     +  + ++    P+ CV   + T K CCP +    +  CG + GRG C  V     P +  +     DDR  WP +FF  +C C GNF G  C  C +GW G  C++R   + R+NI S +  ER +FL  L +  N +  ++++  +       P  ++P V       +   +  ++H Y+ R TL    +    F  +D++H   +F TWHR  +L  ER+L ++   E     FA+PYW++   + +C+VC +   GA  + D  N   LI  GS+F  W   C+     ++ V          L R  L       P  ED+   L  + +   D      ++  +F  ALEGF   + +  ST++ +HN VH+ + G+   + +++NDP+F++ HS  D I + W + + P     P      G+ R  N+V   PPV + E+F   E LG  Y
Sbjct:    4 KGVRAVLLL-----ACCLQAVRAQFPRSCVTVEALTSKRCCPALGSDLNNVCGSLEGRGQCTPVVVDERPWSGPYTLRNVDDRERWPLKFFNSICRCTGNFAGFNCGECKFGWTGPTCEQRKPPVVRKNIHSLTAQERTQFLDALDQAKNTIHPDYVIATQHWLSILGPNGTEPQVANT----SIYNYFVWLHYYSVRDTLLGPGR---PFTAIDFSHQGPAFVTWHRYHLLLLERDLQRMTGNE----SFALPYWNFATGRNECDVCTDELFGAP-RLDDPN---LISAGSRFSRWGIVCNSLNDYNRLVTLCNGTNEGFLQRNPLGGAEGRLPSMEDVQKCLSLNEF---DNPPFFRNSTFSFRNALEGFDEPDGTLNSTAMSLHNLVHSFLNGTSAQSHSSANDPIFVVLHSFTDAIFDEWMKRFQPSDVAWPQELAPIGHNRMYNMVPFFPPVTNEELFLPAEQLGYVY 453          
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:549915])

HSP 1 Score: 186.037 bits (471), Expect = 1.329e-51
Identity = 133/456 (29.17%), Postives = 214/456 (46.93%), Query Frame = 3
Query:  108 INSISGLVPKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRIL-EISNKMPSEFLV-----LEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYLST---EFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            + ++    P+ CV   + T K CCP +    +  CG + GRG C  V     P +  +     DDR  WP +FF  +C C GNF G  C  C +GW G  C++R   + R+NI S +  ER +FL  L +  N +  ++++     L    P  ++P V       +   +  ++H Y+ R TL    +    F  +D++H   +F TWHR  +L  ER+L ++   E     FA+PYW++   + +C+VC +   GA  + D  N   LI  GS+F  W   C+     ++ V          L R  L       P  ED+   L  + +   D      ++  +F  ALEGF   + +  ST++ +HN VH+ + G+   + +++NDP+F++ HS  D I + W + + P     P      G+ R  N+V   PPV + E+F   E LG  Y
Sbjct:   11 LQAVRAQFPRSCVTVEALTSKRCCPALGSDLNNVCGSLEGRGQCTPVVVDERPWSGPYTLRNVDDRERWPLKFFNSICRCTGNFAGFNCGECKFGWTGPTCEQRKPPVVRKNIHSLTAQERTQFLDALDQAKNTIHPDYVIATQHWLSILGPNGTEPQVANT----SIYNYFVWLHYYSVRDTLLGPGR---PFTAIDFSHQGPAFVTWHRYHLLLLERDLQRMTGNE----SFALPYWNFATGRNECDVCTDELFGAP-RLDDPN---LISAGSRFSRWGIVCNSLNDYNRLVTLCNGTNEGFLQRNPLGGAEGRLPSMEDVQKCLSLNEF---DNPPFFRNSTFSFRNALEGFDEPDGTLNSTAMSLHNLVHSFLNGTSAQSHSSANDPIFVVLHSFTDAIFDEWMKRFQPSDVAWPQELAPIGHNRMYNMVPFFPPVTNEELFLPAEQLGYVY 448          
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Match: ENSXETT00000000791.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460737.1:129497:133089:1 gene:ENSXETG00000006077.1 transcript:ENSXETT00000000791.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 1.766e-50
Identity = 130/442 (29.41%), Postives = 204/442 (46.15%), Query Frame = 3
Query:  105 TINSISGLVPKVCVHNVSSTLKTCCPI-PDGFHQPCGG-VGRGVCDK--VYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPS-EFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP-PMGNSKCVGC--HFRKRFPPLNRR----YLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNV---VGHLPPVKHV 1385
            +++ +    P+VC    +   K CCP   DG    CG   GRG C     ++ +        NDDR+ WP  ++   C C GN+ G  C  C YG+ G+ CD++  ++R+ I   S  ER RF   L ++    S +++VL      H D      F  A+  E  ++IH Y+ +  +  N  +       +Y H   +F  WHR  ++ +ERE+  +   E    DFA+PY+DW   + C +C N Y+G      Y      +D  S F+NW   CS     ++ C G    +++R   L+R+     L+   P  +D+   L+   +   D    +    R+F   LEGF       +  L +HN VH  + G+M     +S+DP+F+LHH+ ID+I E W Q Y       P +  EPG   + NV   + H PPV  +
Sbjct:    3 SLDGVQSQFPRVCTTKEAFQTKVCCPTWTDG--SACGSRSGRGQCRNWVAFSSFAKGQLPIYNDDRLDWPRHYYDSTCECFGNYGGFNCGYCKYGYTGKKCDQKKTRVRKEIRQLSFTERKRFFGYLALAKTTFSKDYVVLTTGDRHHRDTY---RFVDASIYEVFSWIHYYSIKP-IMVNSTLDPR---RNYAHRGPAFPGWHRLGLMFFEREVQHMTGDE----DFALPYYDWRGEQNCSICTNDYMGDNDVQGY------LDPYSHFYNWRSICSGYNYPDAYCPGATDGYQER---LHRKPGADPLANTLPSFQDVENTLKWRDF---DTPPYDSTATRSFRNILEGFMNPQDGVTDDLNIHNLVHLYMGGTMSQVPISSSDPMFLLHHNFIDKIYEVWIQKYKGSPKVYPENN-EPGQG-QMNVHPLLSHSPPVSEL 417          
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Match: Tyr (tyrosinase [Source:MGI Symbol;Acc:MGI:98880])

HSP 1 Score: 211.075 bits (536), Expect = 1.089e-60
Identity = 133/467 (28.48%), Postives = 212/467 (45.40%), Query Frame = 3
Query:  123 GLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS-PPMGNSKCVGCHFRKRFPPL-----NRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRK 1487
            G  P+ C  + +   K CCP   G   PCG + GRG C  +     P    F     DDR  WP+ F+ R C C GNF G  C +C +G+ G NC  + + IRRNIF  S  E+ +F   L ++    S   V+   +    +    P+F      +   ++H Y SR TL    ++      +D+ H    F  WHR  +L WE+E+ ++   E    +F +PYWDW DA+ C++C + Y+G      +     L+   S F +W   CS     NS  V C      P L     + +  +   P + D+ F L  + Y  +   M+   N  +F   LEGF       ++ +   MHN +H  + G+M     ++NDP+F+LHH+ +D I E W + + P     P      G+ R+  +V  +P  ++ + F   ++LG  Y   +    GF  + +  Y+ +
Sbjct:   18 GHFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILLSSAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMHYYVSRDTLLGGSEIWRD---IDFAHEAPGFLPWHRLFLLLWEQEIRELTGDE----NFTVPYWDWRDAENCDICTDEYLGGR----HPENPNLLSPASFFSSWQIICSRSEEYNSHQVLCDGTPEGPLLRNPGNHDKAKTPRLPSSADVEFCLSLTQY--ESGSMDRTANF-SFRNTLEGFASPLTGIADPSQSSMHNALHIFMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHRPLLEVYPEANAPIGHNRDSYMVPFIPLYRNGDFFITSKDLGYDYSYLQESDPGFYRNYIEPYLEQ 470          
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Match: Dct (dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:102563])

HSP 1 Score: 185.652 bits (470), Expect = 1.614e-51
Identity = 137/447 (30.65%), Postives = 211/447 (47.20%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQP--CGGV-GRGVCDKVYTHWEPIARVF---KNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRILEISNKM--PSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYC-SPPMGNSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNN----MDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+VC+       K CCP P G      CG + GRG C +V T   P +  +     DDR  WP +FF R C C GNF G  C  C +GW G +C+R+   I RRNI S +  ER +FL  L+++ K   P   +  +            P     +  +F  ++H Y+ R TL    +   A   +D++H   +F TWHR  +L  EREL ++   E     FA+PYW++   K +C+VC +  +GA      Q+   LI   S+F  W   C S    N +   C+    +  L RR    +     + L  L++    +  +K ++     ++  +F  ALEGF   + + +S  + +HN  H+ + G+     +A+NDP+F++ HS  D I + W +  +P T   P      G+ R  N+V   PPV + E+F   E LG  Y
Sbjct:   26 PRVCMTLDGVLNKECCP-PLGPEATNICGFLEGRGQCAEVQTDTRPWSGPYILRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNRKKPAILRRNIHSLTAQEREQFLGALDLAKKSIHPDYVITTQHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKA---IDFSHQGPAFVTWHRYHLLWLERELQRLTGNE----SFALPYWNFATGKNECDVCTDELLGAA----RQDDPTLISRNSRFSTWEIVCDSLDDYNRRVTLCN--GTYEGLLRR---NKVGRNNEKLPTLKNVQDCLSLQKFDSPPFFQNSTFSFRNALEGFDKADGTLDSQVMNLHNLAHSFLNGTNALPHSAANDPVFVVLHSFTDAIFDEWLKRNNPSTDAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTAEQLGYNY 455          
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 176.022 bits (445), Expect = 8.593e-48
Identity = 126/477 (26.42%), Postives = 210/477 (44.03%), Query Frame = 3
Query:   57 KGMNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP--IPDGF--HQPCGGV-GRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMP-SEFLVLEESSPEHSDPLVN-PVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKK-CEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP-----PMGN--SKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSL-YMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            K  N+  L   ++  +    +    P+ C +  +     CCP  +P       PCG   GRG C  V     P +R + +D   DR  WP RFF R C C  NF G  C +C  GW G  C+++++ +RRN+   S  E+  F+R L+++ +    +F++      +   P  N P F   +   +  + H Y+ + T     Q   +FG +D++H   +F TWHR  +L  ER++ ++     Q   F++PYW++   K  C+VC +  +G+   +D      LI   S F  W   C        +G   +   G   R+       R      P  +D+   L    +       N+ D   +F   +EG+         ++  +HN  H  + G+      + NDP+F+L H+  D + + W + Y+   +  P      G+ R+ N+V   PPV + EMF T  +NLG  Y+
Sbjct:    2 KSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILTVRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGPDGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQ--ESFGDVDFSHEGPAFLTWHRYHLLQLERDMQEM----LQEPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDST----LISPNSVFSQWRVVCESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPPFYSNSTD---SFRNTVEGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYE 465          
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 176.022 bits (445), Expect = 8.593e-48
Identity = 126/477 (26.42%), Postives = 210/477 (44.03%), Query Frame = 3
Query:   57 KGMNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP--IPDGF--HQPCGGV-GRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMP-SEFLVLEESSPEHSDPLVN-PVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKK-CEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP-----PMGN--SKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSL-YMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            K  N+  L   ++  +    +    P+ C +  +     CCP  +P       PCG   GRG C  V     P +R + +D   DR  WP RFF R C C  NF G  C +C  GW G  C+++++ +RRN+   S  E+  F+R L+++ +    +F++      +   P  N P F   +   +  + H Y+ + T     Q   +FG +D++H   +F TWHR  +L  ER++ ++     Q   F++PYW++   K  C+VC +  +G+   +D      LI   S F  W   C        +G   +   G   R+       R      P  +D+   L    +       N+ D   +F   +EG+         ++  +HN  H  + G+      + NDP+F+L H+  D + + W + Y+   +  P      G+ R+ N+V   PPV + EMF T  +NLG  Y+
Sbjct:    2 KSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILTVRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGPDGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQ--ESFGDVDFSHEGPAFLTWHRYHLLQLERDMQEM----LQEPSFSLPYWNFATGKNVCDVCTDDLMGSRSNFDST----LISPNSVFSQWRVVCESLEEYDTLGTLCNSTEGGPIRRNPAGNVGRPAVQRLPEPQDVTQCLEVRVFDTPPFYSNSTD---SFRNTVEGYSAPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYAYE 465          
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Match: Tyrp1 (tyrosinase-related protein 1 [Source:MGI Symbol;Acc:MGI:98881])

HSP 1 Score: 105.531 bits (262), Expect = 2.826e-25
Identity = 66/230 (28.70%), Postives = 107/230 (46.52%), Query Frame = 3
Query:   57 KGMNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP--IPDGF--HQPCGGV-GRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMP-SEFLVLEESSPEHSDPLVN-PVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALML 716
            K  N+  L   ++  +    +    P+ C +  +     CCP  +P       PCG   GRG C  V     P +R + +D   DR  WP RFF R C C  NF G  C +C  GW G  C+++++ +RRN+   S  E+  F+R L+++ +    +F++      +   P  N P F   +   +  + H Y+ + T     Q   +FG +D++H   +F TWHR  +L
Sbjct:    2 KSYNVLPLAYISLFLMLFYQVWAQFPRECANIEALRRGVCCPDLLPSSGPGTDPCGSSSGRGRCVAVIADSRPHSRHYPHDGKDDREAWPLRFFNRTCQCNDNFSGHNCGTCRPGWRGAACNQKILTVRRNLLDLSPEEKSHFVRALDMAKRTTHPQFVIATRRLEDILGPDGNTPQFENISVYNYFVWTHYYSVKKTFLGTGQ--ESFGDVDFSHEGPAFLTWHRYHLL 229          
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Match: sp|P55024|TYRO_CHICK (Tyrosinase OS=Gallus gallus OX=9031 GN=TYR PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 2.219e-69
Identity = 145/464 (31.25%), Postives = 221/464 (47.63%), Query Frame = 3
Query:   78 LLIFTVGS--ITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGG-VGRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMG-NSKCVGCHFRKRFPPL-----NRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSES--TSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYD 1427
            + +F +G   + +   +G  P+VC +  S   K CCP  DG   PCG    RG C ++     P+   F     DDR  WP+ F+ R C C GNF G  C  C +G+ G+NC  R ++ RRNIF  +  E+ +FL  L ++  +PS+  V+   +    +   NP+F      +   ++H YASR TL     +      +D+ H    F  WHRA +L WERE+ KI   E    +F IPYWDW DA+ C +C + Y+G      +     L+   S F +W   C+     NS+   C+     P L     N +  +   P + ++ F L  + Y  +   M+ M N  +F   LEGF   + + S  +   +HN +H  + GSM     ++NDP+FILHH+ +D I E W + + P     P      G+ RE  +V  +P  ++ E F     LG  Y+
Sbjct:    1 MFLFAMGLLLVILQPSTGQFPRVCANTQSLLRKECCPPWDGDGTPCGERSNRGTCQRILLSQAPLGPQFPFSGVDDREDWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLRTRRNIFQLTISEKDKFLAYLNLAKNIPSKDYVIATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTLLGGSNVWRD---IDFAHEAPGFLPWHRAFLLLWEREIQKITGDE----NFTIPYWDWRDAEDCVICTDEYMGG----QHPTNPNLLSPASFFSSWQVICTQSEEYNSQQALCNATSEGPILRNPGNNDKSRTPRLPSSSEVEFCLTLTQY--ESGSMDKMAN-YSFRNTLEGFADPHTAISNISQSGLHNALHIYMNGSMSQVQGSANDPIFILHHAFVDSIFERWLRRHRPMLEVYPAANAPIGHNRENYMVPFIPLYRNGEFFISSRELGYDYE 450          
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Match: sp|Q0MVP0|TYRO_PELES (Tyrosinase OS=Pelophylax esculentus OX=8401 GN=Tyr PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.313e-66
Identity = 142/469 (30.28%), Postives = 222/469 (47.33%), Query Frame = 3
Query:   72 SILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSK----CVGCHFRK--RFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHL--ALEGFCG-----RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYD 1427
            ++LL  +   + +++  G  P+ C        K CCP+  G +  CG V GRGVC  V     P+   F     DDR +WP  F+ R C C+GNF G  C  C +G+ G NC  R   IR+ IF  +  E+ +F+  L ++ +  S+  V+   + E  +   NP+F      +   ++H YASR     +    S +  +D+ H    F  WHR  +L WERE+ K+A  +    +F IP+WDW DA++C++C + + G  G +   N   L+   S F +W   CS P   ++    C G +     R P  + R  +   P + D+      +  S+ D +   MD    F     LEG+        N S+S    MHN +H  + GSM     ++NDP+F+LHH+ +D + E W + + P     P      G+ RE N+V  +P   + E F +  +LG  YD
Sbjct:    5 TVLLAASTLLLVLHASYGQFPRACSTAQVLLSKECCPVWPGDNSSCGEVSGRGVCQDVVPSNSPVGAQFPFSGIDDRENWPIVFYNRTCQCQGNFMGYNCGECRFGYTGPNCTVRRNMIRKEIFRMTTAEKDKFIAYLNLAKRTISQDYVISTGTYEQMNNGSNPMFADINVYDLFVWLHYYASRDAFLEDG---SVWANIDFAHEAPGFPPWHRFFLLLWEREIQKVAADD----NFTIPFWDWRDAQQCDLCTDEFFG--GTHPTSNN--LLSPASFFSSWQVICSQPEEYNRLRIICNGTNEGPLLRSPGRHDRNRTPRLPTSADV-----EACLSLTDYETGAMDRFANFSFRNTLEGYAVPASGIANRSQSN---MHNSLHVFMNGSMSNVQGSANDPIFVLHHAFVDSLFEQWLRRHQPSLDVYPEANAPVGHNREYNMVPFIPLFTNGEFFVQSRDLGYDYD 454          
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Match: sp|Q04604|TYRO_PELNI (Tyrosinase OS=Pelophylax nigromaculatus OX=8409 GN=TYR PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.259e-66
Identity = 144/469 (30.70%), Postives = 221/469 (47.12%), Query Frame = 3
Query:   72 SILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMG-NSKCVGCHFRK-----RFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHL--ALEGFCG-----RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYD 1427
            ++LL  +   + +++  G  P+ C        K CCP+  G +  CG V GRGVC  V     P+   F     DDR +WP  F+ R C C+GNF G  C  C +G+ G NC  R   IR++IF  +  E+ + +  L ++    S   V+   + E  +   NP+F   +  +   +IH YASR     +    S +  +D+ H    F  WHR  +L WERE+ K+   +    +F IP+WDW DA++CE+C + + G  G +   N   L+   S F +W   CS P   NS  + C+        R P  + R  +   P + D+      +  S+ D +   MD    F     LEGF        N S+S+   MHN +H  + GSM     ++NDP+F+LHH+ +D + E W + + P     P      G+ RE N+V  +P   + E F +  +LG  YD
Sbjct:    5 TVLLATSTLLLVLHASYGQFPRACSTAQVLLSKECCPVWPGDNSSCGEVSGRGVCQDVVPSNSPVGAQFPFSGIDDRENWPIVFYNRTCQCQGNFMGYNCGECRFGYTGPNCTVRRNMIRKDIFRMTTAEKDKLIAYLNLAKHTISPDYVIATGTYEQMNNGSNPMFADISAYDLFVWIHYYASRDAFLEDG---SVWADIDFAHEAPGFLPWHRFYLLLWEREIQKVTGDD----NFTIPFWDWRDAQQCELCTDEFFG--GTHPTSNN--LLSPASFFSSWQIICSRPEEYNSLRIICNGTNEGPLLRSPGRHDRNRTPRLPTSADV-----EACLSLTDYETGAMDRSANFSFRNTLEGFAVPTSGIANRSQSS---MHNSLHVFLNGSMSSVQGSANDPIFVLHHAFVDSLFEQWLRRHQPSLDVYPEANAPVGHNREYNMVPFIPLFTNGEFFVQSRDLGYDYD 454          
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Match: sp|P54834|TYRO_CANLF (Tyrosinase OS=Canis lupus familiaris OX=9615 GN=TYR PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 2.690e-62
Identity = 134/473 (28.33%), Postives = 219/473 (46.30%), Query Frame = 3
Query:  105 TINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP-PMGNSKCVGCHFRKRFPPLNR-----RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRK 1487
            +  + +G  P+ C  + S   K CCP   G   PCG + GRG C  +     P    F     DDR  WP+ F+ R C C GNF G  C +C +G+ G+NC  + + +R+NIF  S  E+ +FL  L ++    S   V+   +    +    P+F      +   ++H Y SR TL    ++   +  +D+ H    F  WHR  +L WE+E+ K+   E    +F IPYWDW DAK C++C + Y+G     +      L+   S F +W   C+     NS+   C      P L       +  +   P + D+ F L  + Y  + + M+   N  +F   LEGF       ++++   MHN +H  + G+M     ++NDP+F+LHH+ +D I E W + + P     P      G+ RE  +V  +P  ++ ++F    +LG  Y N +  ++      +  Y+ +
Sbjct:   12 SFRTSTGHFPRACASSKSLMEKECCPPWSGDGSPCGQLSGRGACQDIILSNAPFGPQFPFTGVDDRESWPSVFYNRTCQCFGNFMGFNCGNCKFGFWGQNCTEKRLLVRKNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMHYYVSRDTLLGGSEI---WKDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDE----NFTIPYWDWRDAKSCDICTDEYMGGRNPANPN----LLSPASFFSSWQIVCTRLEEYNSRQALCDGTPEGPLLRNPGNHDKARTPRLPSSADVEFCLSLTQY--ESDSMDKAANF-SFRNTLEGFASPLTGIADASQSSMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRRHHPLREVYPEANAPIGHNRESYMVPFIPLYRNGDLFISSRDLGYDYSNLQESERDIFQDYIKPYLEQ 470          
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Match: sp|Q8MIU0|TYRO_BOVIN (Tyrosinase OS=Bos taurus OX=9913 GN=TYR PE=2 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 2.804e-62
Identity = 136/454 (29.96%), Postives = 209/454 (46.04%), Query Frame = 3
Query:  105 TINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSP-PMGNSKCVGCHFRKRFPPLNR-----RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHL--ALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            +  + +G  P+ C  + S T K CCP   G   PCG + GRG C  V     P+   F     DDR  WP+ F+ R C C  NF G  C SC +G+ G  C  R + +RRNIF  S  E+ +FL  L ++    S   V+   +    +    P+F   +  +   ++H Y SR TL  + ++      +D+ H    F  WHR  +L WE+E+ K+   E    +F IPYWDW DA+ C+VC + Y+G     +      L+   S F +W   CS     NS+   C+     P L       +  +   P + D+ F L  + Y     +  +MD    F     LEGF       ++++   MHN +H  + G+M     ++NDP+F+LHH+ +D I E W + Y P     P      G+ RE  +V  +P  ++ + F   ++ G  Y
Sbjct:   12 SFRTSAGHFPRACASSKSLTEKECCPPWAGDGSPCGRLSGRGSCQDVILSTAPLGPQFPFTGVDDRESWPSIFYNRTCQCFSNFMGFNCGSCKFGFRGPRCTERRLLVRRNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNHGTTPLFNDVSVYDLFVWMHYYVSRDTLLGDSEVWRD---IDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDE----NFTIPYWDWRDAENCDVCTDEYMGGRNPANPN----LLSPASFFSSWQIVCSRLEEYNSRQALCNGTSEGPLLRNPGNHDKARTPRLPSSADVEFCLSLTQY-----ESGSMDKAANFSFRNTLEGFADPVTGIADASQSSMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRKYHPLQDVYPEANAPIGHNRESYMVPFIPLYRNGDFFISSKDXGYDY 449          
BLAST of Tyrosinase-like protein vs. TrEMBL
Match: A0A1W6I192 (Tyrosinase-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 268/268 (100.00%), Postives = 268/268 (100.00%), Query Frame = 3
Query:   63 MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQN 866
            MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQN
Sbjct:    1 MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQN 268          
BLAST of Tyrosinase-like protein vs. TrEMBL
Match: A0A504YN21 (Tyrosinase OS=Fasciola gigantica OX=46835 GN=FGIG_05898 PE=4 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 1.056e-171
Identity = 242/456 (53.07%), Postives = 298/456 (65.35%), Query Frame = 3
Query:  120 SGLVPKVCVHNVSSTLKT--CCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFR-KRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANY 1478
               VPK CV N++ T  +  CCPIP G  +PCGG G G C+  +   EP+ +  + DDRMHWP+ FFK  C CEGNFFG+AC+ CWYGWEG  C++R   +RRNIFS++  ER  F+ I+  + ++ S++L++ E  P HSDPL  P F    +Q  IA+ H YASR TL+ + + C A   +D NHN V FATWHR LML WER L KIA   + W DFAIPYWDW+D   CEVC N  VGA G   + N I LI EGS F  W E CSPP     C GCH     F PL+R Y  TEFP T++L F L   ++ + D  + ++  CR FH ALEGFCG   S STS YMHNKVHNMV GS CCASTA+NDP+FILHHS +DRI + WFQ Y P+ T  PNHGVEP NCRECN+V  +P V+HVEMF  + +LG+ YDNY FGK GF+  K   Y
Sbjct:   23 DAFVPKACVSNITVTGGSGVCCPIPKGGSEPCGGNGVGSCEPSFVQLEPLPKHMRQDDRMHWPSHFFKHTCKCEGNFFGVACDECWYGWEGPLCNKRHKVVRRNIFSYTPKEREMFVNIVAKTTQLKSDYLIIYEKEPIHSDPLWRPKFLDVDYQYLIAYWHEYASRGTLYHSPETCDAVRKIDNNHNVVGFATWHRYLMLLWERALRKIATDLYGWHDFAIPYWDWVDNTVCEVCRNDMVGAMGP--WVNGIRLIHEGSPFSEWPENCSPPEKGFGCYGCHTSWPHFKPLHRHYKLTEFPTTDELQFALSRKTFYLSD-LVEDLRKCRGFHQALEGFCGPPGSNSTSGYMHNKVHNMVAGSFCCASTAANDPIFILHHSQVDRIFQIWFQRYRPRPTDFPNHGVEPTNCRECNMVAFIPAVRHVEMFVDMRDLGIHYDNYDFGKHGFKGDKFIKY 475          
BLAST of Tyrosinase-like protein vs. TrEMBL
Match: A0A4E0S2V2 (Tyrosinase OS=Fasciola hepatica OX=6192 GN=D915_002718 PE=4 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 5.120e-171
Identity = 240/454 (52.86%), Postives = 297/454 (65.42%), Query Frame = 3
Query:  126 LVPKVCVHNVSSTLKT--CCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFR-KRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANY 1478
             VPK CV N++ T  +  CCPIP G  +PCGG G G C+  +   EP+ +  + DDRMHWP+ FFK  C CEGNFFG+AC+ CWYGWEG  C++R   +RRNIFS++  ER  F+ I+  + ++ S++L++ E  P HSDPL  P F    +Q  IA+ H YASR TL+ + + C A   +D NHN V FATWHR LML WER L KIA   + W DFAIPYWDW+D   CEVC N  VGA G   + N I LI EGS F  W E CSPP     C GCH     F PL+R Y  TEFP T++L F L   ++ + D  + ++  CR FH ALEGFCG   S  TS YMHNKVHNMV GS CCASTA+NDP+FILHHS +DR+ + WFQ Y P+ T  PNHGVEP NCRECN+V  +P V+HVEMF  + +LG+ YDNY FGK GF+  K   Y
Sbjct:   25 FVPKACVSNITVTGGSGVCCPIPKGRSEPCGGNGVGSCEPSFVQLEPLPKHMRQDDRMHWPSHFFKHTCRCEGNFFGVACDECWYGWEGPLCNKRHKVVRRNIFSYTPKEREMFVNIVAKTTQLKSDYLIIYEKEPIHSDPLWKPKFLDVDYQYLIAYWHEYASRGTLYHSPETCDAVQKIDNNHNVVGFATWHRYLMLLWERALRKIATDLYGWHDFAIPYWDWVDNTVCEVCRNDMVGAMGP--WVNGIRLIHEGSPFSEWPENCSPPEKGFGCYGCHTSWPHFKPLHRHYKLTEFPTTDELQFALSRKTFYLSD-PVEDLRKCRGFHQALEGFCGPPGSNGTSGYMHNKVHNMVAGSFCCASTAANDPIFILHHSQVDRVFQIWFQRYRPRPTDFPNHGVEPTNCRECNMVAFIPAVRHVEMFVDMRDLGIHYDNYDFGKHGFKGDKFIKY 475          
BLAST of Tyrosinase-like protein vs. TrEMBL
Match: A0A5J4NCT4 (Tyrosinase OS=Paragonimus westermani OX=34504 GN=DEA37_0005858 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 3.969e-170
Identity = 239/474 (50.42%), Postives = 307/474 (64.77%), Query Frame = 3
Query:   66 NLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKT--CCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFR-KRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANY 1478
            N   L +  + S+ + S + L+PKVCV NV++   +  CCPIP G +Q CGG G G C++ +   EP+ +    DDRMHWP+RFFK  C CEG +FG+AC+ CWYGW GR C++R   +RR+I S+S  ER  F+ I+  + + P+++++L E  P HSDPL  P F     Q  IAFIH YASR T++ +++ C  +  LD NHN V FATWHR  ML WE EL KIA K++ W DFA PYWDW+DAKKC+VC N  VGA G   Y N I LI   S F NWTE C+ P     C GCH     F PL+R Y+S  FP T+DL F L    + +  +K  ++  CR FH  LEGFCG   ++   +YMHNKVHNMV GS CCA TA+NDPLFILHHS IDR+++ WF+ Y P  T  PNHGVE GNCRECN++G +P V+H +MF  +  LGV YDNYKFGK GF+  +   Y
Sbjct:    4 NWLFLSVVLISSLQLWSSTALIPKVCVQNVTALGGSGICCPIPKGSNQACGGPGIGTCERQFIQLEPLPKHRLFDDRMHWPSRFFKYTCKCEGRYFGLACDECWYGWSGRLCNKRKKYVRRDIMSYSPKERQMFVDIVAETTRTPTDYVILFEKDPIHSDPLWKPKFMEVDLQYLIAFIHDYASRGTMYKDEKSCKRYKKLDNNHNVVGFATWHRYFMLVWENELRKIASKKYGWYDFAAPYWDWVDAKKCDVCVNSLVGAPGP--YVNGIRLIHPASPFSNWTEQCTMPKTGMPCKGCHTTWPYFKPLHRDYVSNAFPTTKDLHFTLSRPKFYLP-QKHEDLRLCRGFHQTLEGFCGEAGTDGQYMYMHNKVHNMVRGSFCCAPTAANDPLFILHHSQIDRVMQIWFEHYRPSPTDFPNHGVEYGNCRECNLIGFIPTVRHNQMFVDMRQLGVYYDNYKFGKFGFDGDEFIKY 474          
BLAST of Tyrosinase-like protein vs. TrEMBL
Match: A0A183B2C3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13358 PE=4 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 3.010e-169
Identity = 242/470 (51.49%), Postives = 308/470 (65.53%), Query Frame = 3
Query:   78 LLIFTVGSITINSISGLVPKVCVHNVSSTLKT--CCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFR-KRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANY 1478
            L +F +  I I++   L+PK C  NV++T  +  CCPIP G   PCGG G G C+ V+   EP+      DDRMHWP RFFK +C CEGN+FG+AC+ CWYGWEG  C+RR   +RRNI S++  ER  F+ I+  + KM SE++V+ E    HSDPL  P F    +Q  IA+ H YASR+TL+ + ++CSA   ++ NHN V F TWHR LML WER L KIA + + W DFAIPYWDW+D+ +C+VC N  VGA G   + N I LI  GS F  W E CSPP  +S C GCH     F PL+R Y ST FP T++L F L   ++ +  E   ++  CR FH ALEGFCG     ST L+MHNKVHNMV GS CCA+TA+NDPLFILHHS IDRI + WFQ + P+ T  PNHGV+P NCRECN+V  +P V+HV+MF  + +LG+ YDNY FGK G++  K   Y
Sbjct:   12 LFVFCLYLIRIHA---LIPKACAGNVTATGGSGVCCPIPRGGFHPCGGKGIGSCEPVFVQLEPLPLDRLQDDRMHWPKRFFKYLCKCEGNYFGVACDQCWYGWEGPLCNRRQKVVRRNILSYTPKEREMFVNIVAQTTKMNSEYVVIYEKDRVHSDPLWRPKFLDVNYQYLIAYWHEYASRNTLYRSSKVCSAHLPMNNNHNVVGFVTWHRYLMLMWERALRKIASEMYGWHDFAIPYWDWVDSTECDVCRNDIVGAPGP--WANGIRLIHPGSPFSKWPENCSPPEDDSDCYGCHTSWPNFRPLHRHYRSTAFPTTKELQFALSRKTFYLT-EPEEDLKKCRGFHQALEGFCGPPGLNSTFLFMHNKVHNMVAGSFCCAATAANDPLFILHHSQIDRIFQVWFQFFRPRPTDFPNHGVQPTNCRECNIVAFIPAVRHVQMFVDMRDLGIHYDNYNFGKHGYQGDKFIQY 475          
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Match: tyr (tyrosinase-like [Source:NCBI gene;Acc:103040843])

HSP 1 Score: 211.46 bits (537), Expect = 5.848e-61
Identity = 139/447 (31.10%), Postives = 205/447 (45.86%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGG-VGRGVCDKVYTHWEPIARVFKN---DDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEESSPEHS--DPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS-PPMGNSKCVGCHFRKRFP----PLNRRYLST-EFPLTEDLLFVLRHSSYSVKD-EKMNNMDNCRAFHLALEGFCGRNHSEST--SLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+ C    + T ++CCP   G    CG   GRG C  V     P    + +   DDR  WP  FF R C C GNF G  C  C +G+ G  C  R   +RRNIFS S  E+  F+  L ++ N +  E+++   +  + +  +  VNP+F   +  +   ++H Y SR TL       + +  +D+ H   +F  WHR  +L WE E+ K+   +F   +F IPYWDW DA+ C+VC +  +G     D       I   S F +W   C+ P + N++   C      P    P N         P + D+ FVL  S Y     ++  NM    +F  ALEGF       +      MHN +H  + GSM     ++NDP+F+LHH+ ID I E W + + P  +  P      G+     +V  +P  K+ E F   + LG  Y
Sbjct:   22 PRFCATPEALTSRSCCPPWPGDGSACGANSGRGFCQDVVVSDLPDGPQYPHSGLDDREQWPLAFFNRTCQCAGNFMGYNCNECKFGYYGPTCAERRESVRRNIFSLSAAEKQTFISYLNLAKNTISPEYVIATSTRAQMNGINGTVNPLFANVSIYDLFVWMHYYVSRDTLLGGPG--NIWQDVDFAHEASAFLPWHRFFLLFWEHEIRKLT-GDF---NFTIPYWDWRDARDCQVCTDELMGGQSSLDPN----FISPASIFSSWKVICTLPEIYNAEETLCDGVGEGPLFRNPGNHDPNRVRRLPTSADVEFVLGLSDYETGSLDRRANM----SFRNALEGFASPETGMAVLGQSTMHNAIHVFMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRKHQPPRSHYPTSNAPIGHNDGYYMVPFIPLNKNGEYFLGTKALGYEY 454          
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Match: TYR (tyrosinase-like [Source:NCBI gene;Acc:103041136])

HSP 1 Score: 207.223 bits (526), Expect = 2.063e-59
Identity = 136/467 (29.12%), Postives = 212/467 (45.40%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGG-VGRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS-PPMGNSKCVGCHFRKRFPPLNR-----RYLSTEFPLTEDLLFVLRHSSYSVKD-EKMNNMDNCRAFHLALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRKHK 1493
            P+ C    +   K CCP+ +G    CG   GRGVC  V    EP    +     DDR  WP  F+ R C C  N+ G  C  C +G  G NC  R   +R+ +F  S  ER + +  L ++    S+  V+   +    +   NP+F   +  +   ++H Y SR  +       + +  +D+ H    F  WHR  +L WE E+ K+   +F    F IPYWDW DA++CEVC +  VG+  + +      LI   S F +W   CS  P  +   V C  R+  P L       R L++  P + ++ F L  S Y     ++  NM    +F   LEGF         S  L MH  +H  + GSM     ++NDP+F+LHH+ +D I E W + + P+ +  P      G+  E  +   LP  ++ + F   +++G  Y   +   + F    +A+Y+ + K
Sbjct:   22 PRQCATTEALLSKECCPVWEGDGSACGARSGRGVCQDVVVSEEPNGPQYPFEGLDDRERWPLVFYNRTCRCLQNYMGHNCGDCRFGHFGPNCAERRESVRKEVFQLSTTERQKLISYLNLAKNTISQDYVIATGTYLEMNNGTNPLFRNVSVYDLFVWMHYYVSRHAMLGGTN--NVWRGVDFGHWAPGFLPWHRVFLLRWEHEIRKLT-GDFT---FTIPYWDWRDAQECEVCTDDLVGSQSRLNPN----LISPASVFSSWKVICSRAPEYSLNGVLCDGREEGPLLRNPGKHDRNLASGLPTSAEVDFTLGLSQYDTGPMDRTANM----SFRNTLEGFGDPRTGLGNSPKLGMHAALHVFMNGSMTSVQGSANDPVFLLHHAFVDSIYEQWLRRHQPERSHYPTANAPIGHNSEYYMAPFLPLYRNGDYFLSSKDMGYEYSYLRDPGQQF-VDNVASYLEQVK 473          
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Match: TYR (tyrosinase-like [Source:NCBI gene;Acc:103041136])

HSP 1 Score: 207.223 bits (526), Expect = 2.063e-59
Identity = 136/467 (29.12%), Postives = 212/467 (45.40%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGG-VGRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS-PPMGNSKCVGCHFRKRFPPLNR-----RYLSTEFPLTEDLLFVLRHSSYSVKD-EKMNNMDNCRAFHLALEGFCG--RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRKHK 1493
            P+ C    +   K CCP+ +G    CG   GRGVC  V    EP    +     DDR  WP  F+ R C C  N+ G  C  C +G  G NC  R   +R+ +F  S  ER + +  L ++    S+  V+   +    +   NP+F   +  +   ++H Y SR  +       + +  +D+ H    F  WHR  +L WE E+ K+   +F    F IPYWDW DA++CEVC +  VG+  + +      LI   S F +W   CS  P  +   V C  R+  P L       R L++  P + ++ F L  S Y     ++  NM    +F   LEGF         S  L MH  +H  + GSM     ++NDP+F+LHH+ +D I E W + + P+ +  P      G+  E  +   LP  ++ + F   +++G  Y   +   + F    +A+Y+ + K
Sbjct:   22 PRQCATTEALLSKECCPVWEGDGSACGARSGRGVCQDVVVSEEPNGPQYPFEGLDDRERWPLVFYNRTCRCLQNYMGHNCGDCRFGHFGPNCAERRESVRKEVFQLSTTERQKLISYLNLAKNTISQDYVIATGTYLEMNNGTNPLFRNVSVYDLFVWMHYYVSRHAMLGGTN--NVWRGVDFGHWAPGFLPWHRVFLLRWEHEIRKLT-GDFT---FTIPYWDWRDAQECEVCTDDLVGSQSRLNPN----LISPASVFSSWKVICSRAPEYSLNGVLCDGREEGPLLRNPGKHDRNLASGLPTSAEVDFTLGLSQYDTGPMDRTANM----SFRNTLEGFGDPRTGLGNSPKLGMHAALHVFMNGSMTSVQGSANDPVFLLHHAFVDSIYEQWLRRHQPERSHYPTANAPIGHNSEYYMAPFLPLYRNGDYFLSSKDMGYEYSYLRDPGQQF-VDNVASYLEQVK 473          
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:103044028])

HSP 1 Score: 177.948 bits (450), Expect = 9.348e-49
Identity = 134/450 (29.78%), Postives = 210/450 (46.67%), Query Frame = 3
Query:  132 PKVC--VHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCD-RRVIKIRRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEES-----SPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRY---LSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLY-MHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+VC  V N+ S  K CCP +       CG + GRG C  V    +P    +     DDR  WPT+FF + C C GNF G  C  C +GW G NCD R+   +R+NI S + +E   FL  L+ S N +  ++++  E       P  ++P V+ +    +  +F  + H Y+ R TL    +    F  +D++H   +F TWHR  +L  ER+L K+   E    +FA+PYW++     +C+VC +  +G     D       I  GS+F +W   C      ++ V      R  PL R      S   P   D+   L    +   D      ++  +F  ALEG+   +    +S+  +HN VH  + G+   + +A+NDP+F++ H+  D I E W + +       P+     G+ R  N+V   PPV + E++     LG +Y
Sbjct:   28 PRVCCTVENILS--KRCCPQLGPNPADVCGVLSGRGNCTVVRVDTKPWGGPYSLRNVDDRERWPTKFFNQTCRCFGNFAGYNCGECKFGWTGPNCDQRKAPAVRKNILSLTPVELQEFLDALDQSKNTIHPDYVIATEHWLGLLGPNGTNPQVSNI----SIYDFFVWQHYYSVRDTLLGPGR---PFKAIDFSHKGPAFITWHRYHLLSLERDLQKMTGNE----NFAVPYWNFATGGSECDVCTDSLLGGRDPADPTR----ISPGSRFTSWGVVCESLDEYNRLVTLCNGTREGPLRRGVGDSSSPRLPTINDVRSCLNLRDF---DSPPYFTNSTFSFRNALEGYDKPDGEMDSSMTNLHNLVHIFLNGTSGMSHSAANDPIFLVLHAFTDAIFEEWLRRFD-GNGSFPDEMAPIGHNRHYNMVPFFPPVTNEEIYITSSQLGYSY 456          
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Match: tyrp1b (5,6-dihydroxyindole-2-carboxylic acid oxidase-like [Source:NCBI gene;Acc:103027103])

HSP 1 Score: 169.088 bits (427), Expect = 1.860e-45
Identity = 129/466 (27.68%), Postives = 196/466 (42.06%), Query Frame = 3
Query:   81 LIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDG-FHQPCGG-VGRGVCDKVYTHWEPIARVFKN---DDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEH--SDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS-----PPMGN--SKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG-RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKL-ENLGVTYD 1427
            ++   GSI +    G  P+ CV        TCCP P G  +  CG   GRG C  V     P    + +   DDR  WP RFF R C C  NF G  C  C +G  G +C+++V  +RRNI   S  E+  F+  L+ + +     LV+     E        +P F   T   F  + H Y+   T     Q    FG +D++H    F TWHR  +L  ER++  +         FA+PYW + +   +C++C +   GA   +        I   S F  W   C        +G   +   G   R+       R +  + P  +D++  L   ++   D       + R+F   +EG+   +   +     +HN  H  + G+      + NDP+F+L H+  D I + W Q +SP T   P      G+ R  N+V   PP+ + EMF    E LG  Y+
Sbjct:    5 VLLLCGSILMTQ--GQFPRQCVTPEGLRSGTCCPSPTGRTNDECGSSTGRGRCVTVTADERPHGPQYPHSGRDDRERWPLRFFNRTCQCNENFSGHHCGRCKHGLTGPSCNQKVNVVRRNILQMSSEEQKAFINALDQAKRTVHPDLVICTRRYEEIFGADGNSPQFENITIYNFFVWTHYYSVGKTYMGPGQ--DGFGGVDFSHEGPGFVTWHRFHLLQLERDMQDMLGD----PTFALPYWYFAIGGSECDICTDNLFGARSNFGNGR---TISANSVFSQWRVICDHLEEYEKLGTICNSTEGGTLRRHAGGNVDRPMVQKLPEPQDIIDCLDLDTF---DTPPYYSTSTRSFRNTIEGYSAPQGDYDPVVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAIFDEWLQRHSPGTVGYPEANAPIGHNRHFNMVPFWPPITNAEMFVAAPEGLGYNYE 456          
BLAST of Tyrosinase-like protein vs. Ensembl Sea Lamprey
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 75.8702 bits (185), Expect = 7.648e-16
Identity = 59/230 (25.65%), Postives = 105/230 (45.65%), Query Frame = 3
Query:  651 FGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWL-DAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYC-SPPMGNSKCVGCHFRKRFPPLNRRYLSTEF--------PLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQ 1307
            F  +D++H   SF TWHR  +L  ER++ ++         FA+P+WD+   +  C+VC +   G     +      L+   S F  W   C S    N +   C+     P   RR    +         P  +D+   L  + +   D +    ++ R+F  ALEG+   + S E   L +HN VH  + G+   + +++NDP+F++ H+ +D + + W + + P  T+
Sbjct:    6 FTAIDFSHQGPSFITWHRYHLLLLERDIQRLTGD----PSFALPFWDFATGSAACDVCVDDLFGGPDPAEPT----LLSPVSPFSQWQIVCNSLDEYNLRVTLCNGSAEGP--IRRNPGGDLSHPGAGRLPTRDDVAQCLGVARF---DGEPFWTNSSRSFRNALEGYDHPDGSYEPGVLSLHNLVHRFLNGTGGASFSSANDPVFVVLHTFVDAVFDEWMRRFRPNVTE 222          
BLAST of Tyrosinase-like protein vs. Ensembl Sea Lamprey
Match: dct (dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-000508-1])

HSP 1 Score: 71.633 bits (174), Expect = 2.040e-14
Identity = 61/231 (26.41%), Postives = 102/231 (44.16%), Query Frame = 3
Query:  771 FAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYC-SPPMGNSKCVGCHFRKRFPPLNRRYLSTEF--------PLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHS-ESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQL-PNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYD 1427
            FA+P+WD+   +  C+VC +   G     +      L+   S F  W   C S    N +   C+     P   RR    +         P  +D+   L  + +   D +    ++ R+F  ALEG+   + S E   L +HN VH  + G+   + +++NDP+F++ H+ +D + + W + + P  T+  P      G+    N+V   PPV +  MF   E LG  YD
Sbjct:   10 FALPFWDFATGSAACDVCVDDLFGGPDPAEPT----LLSPVSPFSQWQIVCNSLDEYNLRVTLCNGSAEGP--IRRNPGGDLSHPGAGRLPTRDDVAQCLGVARF---DGEPFWTNSSRSFRNALEGYDHPDGSYEPGVLSLHNLVHRFLNGTGGASFSSANDPVFVVLHTFVDAVFDEWMRRFRPNVTEAWPEQLAPIGHNLHYNMVPFFPPVPNQLMFVPAEELGYGYD 231          
BLAST of Tyrosinase-like protein vs. Ensembl Nematostella
Match: EDO33361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF6])

HSP 1 Score: 50.447 bits (119), Expect = 1.869e-6
Identity = 65/283 (22.97%), Postives = 101/283 (35.69%), Query Frame = 3
Query:  552 PVFFLATFQEFIAFIHRYASRSTLFANKQMCSAF--GYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDA-------KKCEVCNNRYVG-------ATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECW--------FQIYSPKTTQLPNHGVE 1328
            P   L   + FI+ + R ++           +     + D  HN  +F  WHR  +L++E  + KI  +        +PYWDW  A       ++  + +  Y G         GK+ Y     +ID   +   W      P    K  G    + F P N  YL     +   +L     + +  +DE        RA                    +H++ HN V G+M  A + SN P F  HH  +D++   W        FQ Y    T+LP   V 
Sbjct:  275 PSMSLEERRRFISALIRVSTDQAFIKTYDKLTHLHPKFFDMVHNKKNFFPWHRWFILNFENFIRKIDCR------VTVPYWDWSQAVSGNRIFRRSHIRDVWYPGNHGLGSNGVGKFKY-----VIDGPFRKGKW----PIPKRAIKEAGIWLSRDFNPCNSMYLPKASHVYGKMLHYPFKNFFKFEDE-------VRA--------------------IHDEFHNAVGGTMMLACS-SNAPEFWFHHGFLDKLWSDWQNRGAKFKFQYYHTIKTKLPGANVR 514          
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Match: TYR (tyrosinase [Source:NCBI gene;Acc:101171514])

HSP 1 Score: 218.394 bits (555), Expect = 1.518e-63
Identity = 136/443 (30.70%), Postives = 206/443 (46.50%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGG-VGRGVCDKVYTHWEPIARVFK---NDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMG-NSKCVGCHFR-----KRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNH--SESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P++C    +   + CCP   G    CG   GRG C+ V    +P    +     DDR  WP  FF R C C GNF G  C  C +G+ G  C  R   +RRN+F  +  ER RF+  L ++ +  S   V+   +        NP+F   T  +   ++H Y SR+ L       + +  +D+ H   +F+ WHR  +LHWE E+ K+         F+IPYWDW DA+ C+VC +  +G+    D      LI   S F +W   CS     N++ V C  R     +R P  + R L    P + ++ F L   +Y    E M+   N  +F   LEGF         S+ L MH  +H  + GSM     ++NDP+F+LHH+ +D I E W + ++P  +Q P      G+  +  +   +P  ++ E F   ++LG  Y
Sbjct:   21 PRLCATQEALQSRECCPPWQGDGSACGARSGRGSCEDVSVSDQPDGPQYPFSGLDDREKWPLVFFNRTCQCTGNFMGFNCADCKFGYFGERCSERRESLRRNVFHLTRAERNRFVSYLNLAKQTLSSDYVVATGTYREMQNGSNPLFANVTIYDVFVWMHYYVSRNALLGGPG--NVWANVDFAHWAPAFSPWHRVYLLHWEHEIRKLTGD----TTFSIPYWDWRDAQGCDVCTDELMGSRSPLDPN----LISPSSVFSSWKVLCSQAEEYNNRGVLCDAREEGPVQRNPGNHDRNLVARIPTSAEVEFTLSLPNYDT--EPMDRTANM-SFRNTLEGFGDPQTGLGSSSRLGMHAALHVFMNGSMSSVQGSANDPIFLLHHAFVDSIYEQWLRRHNPDPSQYPQANAPIGHNGDYYMAPFIPLHQNKEYFISSKDLGYEY 450          
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100049427])

HSP 1 Score: 207.994 bits (528), Expect = 1.188e-59
Identity = 138/450 (30.67%), Postives = 206/450 (45.78%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFKN---DDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMG-NSKCVGCHFRKRFPPL--------NRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRN-----HSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+ C ++     K CCP+  G   PCG + GRG C  V    EP    + +   DDR  WP  FF R C C GN+ G  C  C +G+ G NC      +RRNI S S  E+ +F+  L ++ N +  ++++   +  E  +   +P+F      +   +IH Y SR T        + +  +D+ H + +F  WHR  +LHWE+E+ KIA  +F   +F IPYWDW DA+ CEVC +  +G     +      LI   S F +W   C+     N++   C+     P L        NR       P T D+ F +    Y      M+   N  +F   LEGF           +ST   MHN +H  + GSM     ++NDP+F+LHH+ ID I E W + + P  +  P      G+     +V  LP  ++ +     + LG  Y
Sbjct:   22 PRPCANSEGLRTKECCPVWSGDGSPCGALSGRGFCADVSVSDEPNGPQYPHSGIDDRERWPLAFFNRTCRCAGNYGGFNCGECRFGYWGSNCAEYRESVRRNIMSMSTTEQQKFISYLNLAKNTINPDYVITTGTRAEMGENGESPMFSDINTYDLFVWIHYYVSRDTFLGGPG--NVWRDIDFAHESAAFLPWHRVYLLHWEQEIRKIA-GDF---NFTIPYWDWRDAQSCEVCTDNLMGGRNALNPN----LISPASVFSSWKVICTQQEEYNNQEALCNATAEGPLLRNPGNHDPNR---VPRIPTTADVEFTISLPEYETG--SMDRFAN-NSFRNVLEGFASPETGMAVQGQST---MHNALHVFMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRTHQPPRSIYPRTNAPIGHNDGYYMVPFLPLYRNGDYLLSNKALGYEY 452          
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Match: tyr (tyrosinase [Source:NCBI gene;Acc:100049427])

HSP 1 Score: 207.608 bits (527), Expect = 1.845e-59
Identity = 138/450 (30.67%), Postives = 206/450 (45.78%), Query Frame = 3
Query:  132 PKVCVHNVSSTLKTCCPIPDGFHQPCGGV-GRGVCDKVYTHWEPIARVFKN---DDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMG-NSKCVGCHFRKRFPPL--------NRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRN-----HSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            P+ C ++     K CCP+  G   PCG + GRG C  V    EP    + +   DDR  WP  FF R C C GN+ G  C  C +G+ G NC      +RRNI S S  E+ +F+  L ++ N +  ++++   +  E  +   +P+F      +   +IH Y SR T        + +  +D+ H + +F  WHR  +LHWE+E+ KIA  +F   +F IPYWDW DA+ CEVC +  +G     +      LI   S F +W   C+     N++   C+     P L        NR       P T D+ F +    Y      M+   N  +F   LEGF           +ST   MHN +H  + GSM     ++NDP+F+LHH+ ID I E W + + P  +  P      G+     +V  LP  ++ +     + LG  Y
Sbjct:   29 PRPCANSEGLRTKECCPVWSGDGSPCGALSGRGFCADVSVSDEPNGPQYPHSGIDDRERWPLAFFNRTCRCAGNYGGFNCGECRFGYWGSNCAEYRESVRRNIMSMSTTEQQKFISYLNLAKNTINPDYVITTGTRAEMGENGESPMFSDINTYDLFVWIHYYVSRDTFLGGPG--NVWRDIDFAHESAAFLPWHRVYLLHWEQEIRKIA-GDF---NFTIPYWDWRDAQSCEVCTDNLMGGRNALNPN----LISPASVFSSWKVICTQQEEYNNQEALCNATAEGPLLRNPGNHDPNR---VPRIPTTADVEFTISLPEYETG--SMDRFAN-NSFRNVLEGFASPETGMAVQGQST---MHNALHVFMNGSMSSVQGSANDPIFLLHHAFIDSIFERWLRTHQPPRSIYPRTNAPIGHNDGYYMVPFLPLYRNGDYLLSNKALGYEY 459          
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Match: dct (dopachrome tautomerase [Source:NCBI gene;Acc:101166914])

HSP 1 Score: 181.8 bits (460), Expect = 2.857e-50
Identity = 128/467 (27.41%), Postives = 219/467 (46.90%), Query Frame = 3
Query:   75 ILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCP-IPDGFHQPCGGV-GRGVCDKVYTH---WEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKI-RRNIFSFSELERMRFLRILEIS-NKMPSEFLVLEES-----SPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAK-KCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYL---STEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSL-YMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTY 1424
            +++ FT+  + +  +    P+VC        K CCP +       CG + GRG C  V      W    R+   DDR  WPT+FF + C C GNF G  C  C +GW G NCD++   + R+NI S ++ E   FL +L+++ N +  ++++  +       P  +D    P F   +  +F  + H Y+ R TL    +    F  +D++H   +F TWHR  +L  EREL +++  E    +FAIPYW++   + +C+VC +  +G        +   LI   S+F  W   C+     ++ V          + R  +   +   P   D+   L    +   D      ++  +F  ALEG+   +     ++  +HN VH M+ G+   + +A+NDP+F++ H+  D I + W + + P     P+     G+ R+ N+V   PP+ + E++   E LG +Y
Sbjct:    1 MMIAFTLLFLLV-PVEAQFPRVCCTVEGIQSKRCCPALGSDPADICGSLSGRGSCTAVRVDNKPWGGPYRLRNVDDRERWPTKFFNQTCRCTGNFAGFDCGQCKFGWTGPNCDQKKAPVLRKNIHSLTQEELNEFLNVLDLAKNTIHPDYVIATQHWLGLLGPNGTD----PQFANISIYDFFVWQHYYSVRDTLLGPGR---PFKAIDFSHKGPAFITWHRYHLLSLERELQRLSGDE----NFAIPYWNFATGQSECDVCTDSMLGGRNP----DNPSLISNQSRFSRWGVVCNSLDDYNRLVTLCNGTNEGLIQRGIMERSNGTLPSMNDVRSCLGLRDF---DSPPYFTNSSFSFRNALEGYEKPDGELDDAVNNLHNLVHAMLNGTSALSHSAANDPIFLVLHAFTDAIFDEWMRRFVPSNATFPDEMAPIGHNRDYNMVPFFPPITNEEIYIPSEQLGYSY 448          
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Match: tyrp1a (tyrosinase related protein 1 [Source:NCBI gene;Acc:101166337])

HSP 1 Score: 180.644 bits (457), Expect = 1.013e-49
Identity = 126/457 (27.57%), Postives = 202/457 (44.20%), Query Frame = 3
Query:  114 SISGLVPKVCVHNVSSTLKTCCPIPDGF-HQPCG-GVGRGVCDKVYTHWEPIARVFKND---DRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLV----NPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDW-LDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNR-------RYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCG-RNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMF-TKLENLGVTYD 1427
            ++S   P+ CV         CCP P GF   PCG   GRG C  +     P    + +D   DR  WP RFF R C C GNF G  C  C +G  G NCD+RV  +RR++   S  E+  F+  L+ + +     LV+  ++  +SD       +P F   T   +  + H Y+   T     Q  ++FG +D++H    F TWHR  +L  ER++  +     Q   FA+PYW++ +    C++C +  +GA   +D  +    +   S F  W   C                   P+ R       R +    P  +D+   L+ +++   D       +  +F   +EG+   + + +     +HN  H  + G+      + NDP+F+L H+  D I + W + + P     P+     G+ R  N+V   PPV + EMF T  +NLG +Y+
Sbjct:   16 AVSAQFPRECVTVEGLRSGQCCPSPPGFVDDPCGFSAGRGQCVSLTVDARPHGPQYPHDGRDDRERWPVRFFNRTCQCNGNFSGFNCGRCRHGLTGPNCDQRVSVVRRDVMRLSADEKRAFVSALDQAKRTVHPDLVI--ATRHYSDVFGPGGDSPQFENVTIYNYFVWTHYYSVSKTFLGAGQ--ASFGGVDFSHEGPGFVTWHRYHLLQLERDMQDM----LQDPSFALPYWNFAIGGNTCDICTDDLMGARSTFDSNS----LSSNSIFSQWRVVCESVEDYDTLGTICNSTETSPIRRNPAGNVNRPMVQRLPEPQDVADCLQVNTF---DTPPYYSTSSESFRNTVEGYSAPKGNYDPVVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTYTDAIFDEWLRRHGPAA--YPDENAPIGHNRGYNMVPFWPPVTNSEMFVTAPDNLGYSYE 455          
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Match: SMESG000049779.1 (SMESG000049779.1)

HSP 1 Score: 1003.82 bits (2594), Expect = 0.000e+0
Identity = 477/478 (99.79%), Postives = 478/478 (100.00%), Query Frame = 3
Query:   63 MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRKHKF 1496
            MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRY+STEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRKHKF
Sbjct:    1 MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYISTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGFECSKMANYIRKHKF 478          
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Match: SMESG000080469.1 (SMESG000080469.1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.513e-130
Identity = 190/461 (41.21%), Postives = 272/461 (59.00%), Query Frame = 3
Query:   75 ILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFL-ATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPP--MGNSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKK 1448
            I + F++ S+  N    L+P VCV+N ++T   CCP     H+ CGG  RG+C  +    E I  +F+ DDR+ WP RFF  +C+C  N+FGIAC  CWYGWEG +CD+R + IRRNI   S+ ++     +++ S  +PSE+ V  +    ++DPL  P  ++ A+ Q  I F+HR+ SR+T+F +   C  FG L++NH  + FATWHR  M+ WER L  IA KEF  K+FA+PYWDW D   C++C +   GA G +  ++ +  I   S F NWTE+C  P     S C GCH    +  + R + S EFP + D+ FVL    + V+ E++ ++  C +FH ALEG CG++   S   YMHNK+HNM++GSMCC+ TA +DPLFI HH+  DRI E +   Y PK  + P     PG+ R   +   LP + H  +F   + LG  YDN+ FG +
Sbjct:    6 IFVTFSILSVFFNVSLCLIPTVCVYNATTT-GVCCPRSKQNHEVCGGHERGICGHIDYFHEKIPEIFRYDDRVQWPKRFFHSVCHCRDNYFGIACNECWYGWEGHHCDKRTMIIRRNIKHLSKRDKYITKTVIDRSLYVPSEYSVYVDQLNANNDPLTKPTKWIPASIQYMIVFVHRFGSRATMFEDYLDCQNFGILNFNHEAIGFATWHRYYMMFWERLLQNIARKEFGIKNFALPYWDWTDQTSCDICTDDMAGAPG-FRGKDGV-RISLRSPFGNWTEFCQEPDNADESPCYGCHVTGNYGKITREWNSFEFPTSADVEFVLSKPQFHVQGERITDL-ACESFHRALEGMCGQSEKASDLFYMHNKIHNMIDGSMCCSGTAPSDPLFIFHHTQTDRIFEEYLNRYKPKLDEYPETNARPGHSRHSYLPAILPLITHAHLFKPSKKLGYKYDNFIFGSR 462          
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Match: SMESG000009335.1 (SMESG000009335.1)

HSP 1 Score: 283.878 bits (725), Expect = 1.852e-89
Identity = 155/462 (33.55%), Postives = 238/462 (51.52%), Query Frame = 3
Query:   78 LLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCS---PPMG--NSKCVGCHFRKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKK 1448
            + IF +  + I+  +  +PK C  N +    TCCP  +    PCG   +G C  V  +  P       D RM WP  +FK++C C+ NF+G +C  C+YG++G NC  + +  RRNI S++  E+   + +L    +   ++L++EE+     + L      L    E I  IH  A+R  + +N++ C      + NH  + F TWHR  ML WE+   KIA K F  +DF+ PYWDW+D   CE+C +  +G+ G+    +  +L +  S+F+ W  YC+   P  G   + C  C   K+   L RR+++  FP  + + F L    +  +  K      C  F + LEG+C        S  +HN VH+ V GS   ++T++NDPLFI HH  IDRI + W++  S +    PN    PG+C +CN VG +P + H   F   ENLG  YD++ FGK+
Sbjct:    1 MKIFLIEILIISICNSQIPKECGQNFTLKTGTCCPKGENDLNPCGFPSKGECLTVTINESPSGWDNYKDSRMLWPKYWFKKLCRCKKNFYGPSCTDCFYGYKGENCSEKYLITRRNIMSYNSREKEILVDVLVAMRQEYLDYLIVEEAYRNKPESLR-----LGNVHEMIVNIHFLAARFLIISNRRECKDSPVFNLNHKNIGFLTWHRHFMLLWEKWARKIAKKLFNIEDFSFPYWDWVDKTSCEICTDDLIGSEGEISDDDSFYL-NTKSKFNKWKVYCNLFDPKNGILENSCSPCSSSKQSQRLKRRFITDTFPTKDHVRFALSRKRFGSEFWKSKQF--CEDFSVVLEGYCSPPEWH-LSRSLHNSVHDNVIGSFAESTTSTNDPLFIFHHIQIDRIFQAWWEKTSDEDKVYPNIS-HPGHCFKCNQVGFIPAITHERFFVDSENLGYQYDSFLFGKE 452          
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Match: SMESG000002576.1 (SMESG000002576.1)

HSP 1 Score: 261.151 bits (666), Expect = 4.081e-80
Identity = 160/473 (33.83%), Postives = 240/473 (50.74%), Query Frame = 3
Query:  102 ITINSISGLVPKVCVHNVSS-TLKTCCPIPDGFHQPCGGVGRGVCD----KVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFG----YLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFP-PLNRRYLSTEFPLTEDL------------LFVLRHS---SYSVKDEKMNNMDNCRAFHLALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTT-QLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFG 1442
            ++I  I+ L+P  C  N++S     CCPIP+GF   CG   RG C     + ++   P+  + +ND R  WP + FK  C C  NF G+ C  C +G+ G NC ++ + +R+N+ + ++ E   F  ++ +S    S ++VL E+S   +   + P    AT  E + FIH++A+R  L  +  +C+       Y D+NHN   F TWHR  ML WER    IA + F   DFA PYWDW     C+VC +  VG  G         ++   S F NWTE CS    N  C  C         + R ++S +FP T ++            ++V  H+   SY V   +M     C++F  +LEG C           MHNKVHN+V G+     ++ NDPLFILHH+ IDRI E W +        + P   ++ G+C  C++VG +PP++H+++F    N G  YD++KFG
Sbjct:   57 LSIYFINALIPNQCEQNLTSYGSNVCCPIPEGFTNACGFPFRGKCSFFPLETHSILAPLPEI-ENDIRFEWPFKLFKYFCRCYKNFSGVDCGYCGFGFAGINCLKKRVIVRKNVMNLNQTELKYFRTVVNLSRFKRSSYMVLSETSGNKNLQKMLP----ATIYEVLVFIHQFAARPIL-EDDILCATRKTFSEYTDHNHNGPGFLTWHRHFMLEWERLSGLIAKEYFDIDDFAFPYWDWTGKSHCDVCTDDIVGGFGP--SIGNFKMLSPKSLFSNWTEICSHDDQNP-CKPCDILNSSKIKITRFWMSNKFPTTFEVNRVLMLPDYYKTVYVRSHNPIKSYLVPTHEM--FKPCKSFESSLEGSC----KVENDFTMHNKVHNIVFGTFYSTRSSVNDPLFILHHTQIDRIFEFWLRRNEGNLYFKFPKAVIQHGHCYFCHMVGFIPPLRHIDVFKPSNNFGYDYDSFKFG 514          
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Match: SMESG000065741.1 (SMESG000065741.1)

HSP 1 Score: 217.238 bits (552), Expect = 5.648e-63
Identity = 152/506 (30.04%), Postives = 240/506 (47.43%), Query Frame = 3
Query:   78 LLIFTVGSITINSI---SGLVPKVCVHNVSSTLKTCCPIPDGFHQPCGGVGRGVCDKVY------THWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACESCWYGWEGRNCD-RRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVLEESSPEHSDPL--VNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSA----FGYLDYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKCEVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHFRKRFPPLNRRYLSTEFPL-----TEDLLFVLRHSS--------------------YSV----KDEKMNNMDNCRAFH-LALEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDRIIECWFQIYSPKTTQLPNHGVEP-GNCRECNVVGHLPPVKHVEMFTKLENLGVTYDNYKFGKKGF 1454
            +L+ T+G +  + +     L+P++C  NV+ +  TCCPI + F   CGG  RG C+          H + I    +NDDR++WP+RFFK +C+C+ N+ GIAC+ C  GW+G NC+     KIR+NI +    +   FL IL IS    ++FL+   SS  H DP+   N     A+  + + ++H YASRST+  +K++  +       LD+ H   +F TWHR  +L +E  L  IA+++F + +F +PYWDW +   C +C N  +G     D ++        S F  W   C     +  C  C   +  P L R+Y ST   L      ++L  + ++ S                    Y V     D KM ++        + +      N S   S     +VH+ + G+    +T+ NDPLF+LHH+ +D+I E W  +   + +  P     P G   +  +V  LP +++  +FT     G  YDN   G K F
Sbjct:    1 MLVITIGIVFASFLPLSDCLIPRICSRNVTLSNSTCCPIYNDF--VCGGPFRGSCEVSILFQNHTEHSDVITGKLENDDRLNWPSRFFKFLCSCKSNYDGIACDKCKSGWQGENCEVVSPRKIRQNILNMRSYDVFIFLSILNISKYQLADFLITNSSSNLHCDPVNEDNIQLVNASIYDTMVYLHFYASRSTM--SKELMESCTDKDNKLDFAHKGPAFFTWHRHYLLMFEDLLRSIAVEQFGYYNFTLPYWDWTNQITCNICTNDLLGDIPTEDQES-------NSTFFKWKPICPQKPNDFDCHICDPSQEEPFLWRKYSSTVDRLPNQNEIDELFSINQYDSEPFNSSSFSRKSFRNFAEGYYRVHPNSDDMKMKDIGKGLPHQNIMMHNMVKENLSFFLSKIQFFEVHSFINGTWMDFTTSPNDPLFLLHHTFMDKIFEIW--LLRNRRSTYPGKSSTPIGQHADDFIVPFLPLIRNRNLFTSANEFGYAYDNNIVGNKLF 493          
The following BLAST results are available for this feature:
BLAST of Tyrosinase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYR1.069e-6029.07tyrosinase [Source:HGNC Symbol;Acc:HGNC:12442][more]
DCT8.935e-5229.44dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
TYRP13.040e-4828.38tyrosinase related protein 1 [Source:HGNC Symbol;A... [more]
DCT1.937e-4527.88dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
DCT1.426e-1327.15dopachrome tautomerase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr3.338e-6030.47tyrosinase [Source:ZFIN;Acc:ZDB-GENE-991026-3][more]
tyrp1b3.755e-4927.53tyrosinase-related protein 1b [Source:ZFIN;Acc:ZDB... [more]
dct9.803e-4729.28dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
tyrp1a2.720e-4425.83tyrosinase-related protein 1a [Source:ZFIN;Acc:ZDB... [more]
dct4.636e-3327.84dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr1.218e-6130.53tyrosinase [Source:NCBI gene;Acc:100125152][more]
tyrp14.418e-5328.36tyrosinase-related protein 1 [Source:NCBI gene;Acc... [more]
dct6.894e-5228.75dopachrome tautomerase [Source:NCBI gene;Acc:54991... [more]
dct1.329e-5129.17dopachrome tautomerase [Source:NCBI gene;Acc:54991... [more]
ENSXETT00000000791.11.766e-5029.41pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tyr1.089e-6028.48tyrosinase [Source:MGI Symbol;Acc:MGI:98880][more]
Dct1.614e-5130.65dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:... [more]
Tyrp18.593e-4826.42tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp18.593e-4826.42tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
Tyrp12.826e-2528.70tyrosinase-related protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Tyrosinase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55024|TYRO_CHICK2.219e-6931.25Tyrosinase OS=Gallus gallus OX=9031 GN=TYR PE=2 SV... [more]
sp|Q0MVP0|TYRO_PELES1.313e-6630.28Tyrosinase OS=Pelophylax esculentus OX=8401 GN=Tyr... [more]
sp|Q04604|TYRO_PELNI4.259e-6630.70Tyrosinase OS=Pelophylax nigromaculatus OX=8409 GN... [more]
sp|P54834|TYRO_CANLF2.690e-6228.33Tyrosinase OS=Canis lupus familiaris OX=9615 GN=TY... [more]
sp|Q8MIU0|TYRO_BOVIN2.804e-6229.96Tyrosinase OS=Bos taurus OX=9913 GN=TYR PE=2 SV=2[more]
back to top
BLAST of Tyrosinase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W6I1920.000e+0100.00Tyrosinase-like protein OS=Schmidtea mediterranea ... [more]
A0A504YN211.056e-17153.07Tyrosinase OS=Fasciola gigantica OX=46835 GN=FGIG_... [more]
A0A4E0S2V25.120e-17152.86Tyrosinase OS=Fasciola hepatica OX=6192 GN=D915_00... [more]
A0A5J4NCT43.969e-17050.42Tyrosinase OS=Paragonimus westermani OX=34504 GN=D... [more]
A0A183B2C33.010e-16951.49Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyr5.848e-6131.10tyrosinase-like [Source:NCBI gene;Acc:103040843][more]
TYR2.063e-5929.12tyrosinase-like [Source:NCBI gene;Acc:103041136][more]
TYR2.063e-5929.12tyrosinase-like [Source:NCBI gene;Acc:103041136][more]
dct9.348e-4929.78dopachrome tautomerase [Source:NCBI gene;Acc:10304... [more]
tyrp1b1.860e-4527.685,6-dihydroxyindole-2-carboxylic acid oxidase-like... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dct7.648e-1625.65dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dct2.040e-1426.41dopachrome tautomerase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO333611.869e-622.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosinase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYR1.518e-6330.70tyrosinase [Source:NCBI gene;Acc:101171514][more]
tyr1.188e-5930.67tyrosinase [Source:NCBI gene;Acc:100049427][more]
tyr1.845e-5930.67tyrosinase [Source:NCBI gene;Acc:100049427][more]
dct2.857e-5027.41dopachrome tautomerase [Source:NCBI gene;Acc:10116... [more]
tyrp1a1.013e-4927.57tyrosinase related protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Tyrosinase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049779.10.000e+099.79SMESG000049779.1[more]
SMESG000080469.11.513e-13041.21SMESG000080469.1[more]
SMESG000009335.11.852e-8933.55SMESG000009335.1[more]
SMESG000002576.14.081e-8033.83SMESG000002576.1[more]
SMESG000065741.15.648e-6330.04SMESG000065741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018211 ID=SMED30018211|Name=Tyrosinase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1718bp
GTGTTATTGAACGTCTAAAGGTCACAATAATTCTGTACTAGTTTCATGCG
TTTTCAAAAGGAATGAATCTCTCTATTCTATTAATCTTCACGGTCGGATC
CATTACCATCAATTCAATCTCAGGATTAGTTCCGAAAGTATGCGTTCATA
ACGTCTCGTCAACTCTAAAAACTTGTTGTCCAATACCGGATGGATTTCAT
CAGCCTTGCGGGGGTGTAGGTCGAGGAGTTTGCGACAAAGTCTATACTCA
CTGGGAACCAATTGCAAGGGTGTTCAAAAATGATGATAGGATGCACTGGC
CAACGCGTTTCTTTAAACGAATGTGCAATTGCGAAGGAAATTTCTTTGGA
ATCGCATGTGAAAGTTGTTGGTATGGTTGGGAAGGACGAAATTGCGACAG
ACGAGTTATTAAAATACGAAGAAATATTTTCTCATTTTCAGAGCTTGAAC
GAATGAGATTTTTGCGCATTCTTGAAATAAGTAATAAAATGCCAAGTGAA
TTTCTGGTTTTGGAAGAATCGAGCCCTGAACATTCTGATCCCCTTGTTAA
CCCGGTCTTTTTTTTAGCAACATTCCAGGAATTTATTGCTTTTATTCATC
GGTATGCGAGCCGATCTACTTTGTTTGCTAACAAGCAAATGTGTTCGGCT
TTCGGATATCTCGATTACAATCACAACACGGTCTCCTTTGCTACTTGGCA
CCGAGCTTTGATGTTGCACTGGGAAAGAGAACTAGCAAAAATCGCAATGA
AAGAATTTCAATGGAAGGACTTTGCAATTCCTTATTGGGACTGGCTTGAT
GCTAAAAAATGCGAAGTGTGCAATAACCGATATGTCGGTGCAACAGGGAA
ATATGACTATCAAAATCAAATCTGGTTGATCGACGAAGGAAGTCAGTTTC
ACAACTGGACTGAATACTGCTCTCCGCCGATGGGTAATTCCAAATGTGTT
GGGTGTCACTTCAGAAAAAGGTTTCCACCTCTTAACCGTCGATATTTATC
CACGGAATTTCCTTTGACAGAAGATCTGTTATTTGTTCTCCGACACAGCT
CGTATTCTGTGAAAGATGAAAAGATGAATAATATGGATAACTGTAGGGCT
TTTCATTTAGCGTTAGAAGGGTTTTGTGGCAGAAATCACAGTGAAAGTAC
TTCTCTTTATATGCACAACAAAGTACACAATATGGTTGAAGGATCCATGT
GTTGTGCGTCAACGGCATCAAATGATCCTCTGTTCATACTCCATCATAGT
AGCATAGATAGGATAATAGAGTGCTGGTTCCAGATCTATTCACCAAAAAC
TACCCAACTGCCGAATCACGGAGTTGAGCCGGGAAATTGTCGTGAGTGCA
ACGTTGTGGGCCATTTACCCCCCGTAAAACACGTTGAAATGTTCACTAAA
TTGGAAAATCTGGGAGTGACATATGACAACTACAAATTTGGGAAAAAGGG
CTTCGAATGTTCAAAAATGGCAAATTACATTAGAAAGCATAAATTTTGAA
TTTAAAACGATAAAATTTAAAAATTCTACAATAAAATTTATGTGATTATG
TATATAATTTATTATTAATTATAGTATTAATTACATTTTAGTAAATTGAT
ATGCTGTTAAGAAAAGATATCACAATTAGCCACTGATTTTGTTTGTACAT
GTCGAGCAAAAAAAACAATTTCACGCCAGTTTTGTTTGTTTTAATATACC
ATCAGTAAAACAAAGAAC
back to top

protein sequence of SMED30018211-orf-1

>SMED30018211-orf-1 ID=SMED30018211-orf-1|Name=SMED30018211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=479bp
MNLSILLIFTVGSITINSISGLVPKVCVHNVSSTLKTCCPIPDGFHQPCG
GVGRGVCDKVYTHWEPIARVFKNDDRMHWPTRFFKRMCNCEGNFFGIACE
SCWYGWEGRNCDRRVIKIRRNIFSFSELERMRFLRILEISNKMPSEFLVL
EESSPEHSDPLVNPVFFLATFQEFIAFIHRYASRSTLFANKQMCSAFGYL
DYNHNTVSFATWHRALMLHWERELAKIAMKEFQWKDFAIPYWDWLDAKKC
EVCNNRYVGATGKYDYQNQIWLIDEGSQFHNWTEYCSPPMGNSKCVGCHF
RKRFPPLNRRYLSTEFPLTEDLLFVLRHSSYSVKDEKMNNMDNCRAFHLA
LEGFCGRNHSESTSLYMHNKVHNMVEGSMCCASTASNDPLFILHHSSIDR
IIECWFQIYSPKTTQLPNHGVEPGNCRECNVVGHLPPVKHVEMFTKLENL
GVTYDNYKFGKKGFECSKMANYIRKHKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000232copulatory apparatus
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002227Tyrosinase_Cu-bd
IPR008922Unchr_di-copper_centre
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002227Tyrosinase copper-binding domainPRINTSPR00092TYROSINASEcoord: 367..378
score: 35.2
coord: 387..405
score: 49.52
coord: 204..221
score: 37.98
coord: 239..244
score: 68.37
IPR002227Tyrosinase copper-binding domainPFAMPF00264Tyrosinasecoord: 174..406
e-value: 7.4E-33
score: 114.7
IPR002227Tyrosinase copper-binding domainPROSITEPS00498TYROSINASE_2coord: 388..399
IPR008922Uncharacterised domain, di-copper centreGENE3DG3DSA:1.10.1280.10coord: 114..465
e-value: 1.5E-43
score: 151.8
IPR008922Uncharacterised domain, di-copper centreSUPERFAMILYSSF48056Di-copper centre-containing domaincoord: 75..460
NoneNo IPR availablePANTHERPTHR11474:SF93TYROSINASEcoord: 15..465
NoneNo IPR availablePANTHERPTHR11474TYROSINASE FAMILY MEMBERcoord: 15..465
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.691