neurexin-1 isoform X16

Overview
Nameneurexin-1 isoform X16
Smed IDSMED30018208
Length (bp)4755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of neurexin-1 isoform X16 (SMED30018208) t-SNE clustered cells

Violin plots show distribution of expression levels for neurexin-1 isoform X16 (SMED30018208) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of neurexin-1 isoform X16 (SMED30018208) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for neurexin-1 isoform X16 (SMED30018208) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018208

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018208SMESG000066308.1 SmedASXL_018030SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018208SMESG000066308.1 dd_Smed_v4_11832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018208SMESG000066308.1 dd_Smed_v4_11832_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30018208SMESG000066308.1 dd_Smed_v6_11832_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30018208SMESG000066308.1 dd_Smed_v4_11832_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 329.331 bits (843), Expect = 1.691e-91
Identity = 347/1542 (22.50%), Postives = 608/1542 (39.43%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSE--------------------EEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                    + P     +Q  + I+VA  +CP  ++ E     +    G+  P  A  +                     +P+                      P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECP--SDDEDIDPCEPSSGGLANPTRAGGR---------------------EPY----------------------PGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1439          

HSP 2 Score: 53.1434 bits (126), Expect = 4.963e-6
Identity = 61/242 (25.21%), Postives = 94/242 (38.84%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  F  +V+ K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  ++ E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QVLPVDSGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 329.717 bits (844), Expect = 1.805e-91
Identity = 349/1543 (22.62%), Postives = 608/1543 (39.40%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                  K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS--------------------IMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1457          

HSP 2 Score: 53.5286 bits (127), Expect = 4.131e-6
Identity = 57/240 (23.75%), Postives = 93/240 (38.75%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKE----NYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  F  +V+ K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S           +L   + +  +D+  P++                C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS----------QVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 328.176 bits (840), Expect = 4.789e-91
Identity = 351/1544 (22.73%), Postives = 607/1544 (39.31%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEF-ASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   AS       E + P    + +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV-AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1458          

HSP 2 Score: 53.5286 bits (127), Expect = 4.309e-6
Identity = 61/242 (25.21%), Postives = 94/242 (38.84%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  F  +V+ K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  ++ E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QVLPVDSGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 327.405 bits (838), Expect = 9.721e-91
Identity = 349/1547 (22.56%), Postives = 609/1547 (39.37%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV-AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1461          

HSP 2 Score: 53.5286 bits (127), Expect = 4.769e-6
Identity = 61/242 (25.21%), Postives = 94/242 (38.84%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  F  +V+ K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  ++ E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QVLPVDSGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Match: NRXN1 (neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008])

HSP 1 Score: 321.242 bits (822), Expect = 8.560e-89
Identity = 350/1555 (22.51%), Postives = 611/1555 (39.29%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV-AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS--------------------IMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1469          

HSP 2 Score: 53.5286 bits (127), Expect = 4.694e-6
Identity = 57/240 (23.75%), Postives = 93/240 (38.75%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKE----NYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  F  +V+ K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S           +L   + +  +D+  P++                C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS----------QVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 235.343 bits (599), Expect = 3.732e-62
Identity = 266/1132 (23.50%), Postives = 478/1132 (42.23%), Query Frame = 2
Query:  701 CYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEIN---RSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSI-YKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQ-----FRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPV-SFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTID--DSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAK-KLSPLNIELTASLQPA---NVMRQFA-INFHSTKSYLVIPKVNI---FGDFRLEFQMKTLQPSGLLLFL--QGESNDYLILEMVNGLLHIIYNWGSGYK-----RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDY-------GFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSS----EVSSK------------NSFQGFISGLTINEIAILDTLKENFNSYILLI 3934
            C F  +  R C   K   +   LTF  +  +GY   +++ + +     ++   FKT    S LFY G            +  ++ V ++DG   II S+      +   R F  NS   +   DD WH + ++     + + +D  + E +  + +    +    F  +           +P++ P  +     FRGCMK++    +   + +V +  +      S  K   DI   C        V SFT  S YL      S+     S  F+T  SD LI Y    +   H  TD+ + E+ D  L+  I L S V     ++  VS+G  H++ L        +++D      +      ++  +  ++IG++ +  ++  S  VWS  L   ++GCI ++ ++   + I  +     ++ I  GC  S E   L++C   PC N G C    +   CDC+ TNF G  C  E    E NG +       +T  S+VE+  + F++    G++  T    +G  DK+ +F+ +  + + L     N  F   ++  D+ WH ++++R  + L +++D  ++  + +L+     I ++   +G+AF                  +H        ++ F G++   ++NG +Y  LAK K++   +  ++S +     NV  + A I+F ++  Y+      I    G FR++F+ +TL  S LL F   + + +    L+M+NG L   Y   SG +      K+     L+D  WH+V I +   KTH     VD   + S   +      +     GK++ G      S         R   GF+GCI++  +N +          DL ++A+ +  V+  C    +     C  D+C+  G+C Q W    CDCS T+ SG +C++ STT +F   PS + Y+Y+  ++ + ++  F F   T           TQ    L++IE     DY       G++   Y      H+       + DG  H+++  +     T+++D L    + P       +++ +    +G++     +  K            +S+QG ISG+ +N + ILD L EN ++ I  I
Sbjct:  253 CQFSDHDGRNCEIEKNDGE---LTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGD-----------EKSYLHVMLQDGA--IIASSKFDGSDARIIRMF--NSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGS-----------IPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGG--SVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQ---HNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSS-VWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLSNE---LDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD-GFWSHSIYLQNP---ISVEIDEVGAAFS-----------------VH-SSAPPPRDEHFKGFLSKLVFNGNDY--LAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYR-TSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQD-EKTHDHVLLVD---NSSTTLIIDKIKKVESKMSGKLYFGSNPLGVS---------RPSNGFRGCISTLRINENA--------LDLYEDADSRMKVNRGC----SGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRT-----------TQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILD-LYENGSNRIHTI 1282          
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 235.343 bits (599), Expect = 4.691e-62
Identity = 268/1133 (23.65%), Postives = 479/1133 (42.28%), Query Frame = 2
Query:  701 CYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEIN---RSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSI-YKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQ-----FRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPV-SFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTID--DSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAK-KLSPLNIELTASLQPA---NVMRQFA-INFHSTKSYLVIPKVNI---FGDFRLEFQMKTLQPSGLLLFLQGESNDY---LILEMVNGLLHIIYNWGSGYK-----RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDY-------GFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSS----EVSSK------------NSFQGFISGLTINEIAILDTLKENFNSYILLI 3934
            C F  +  R C   K   +   LTF  +  +GY   +++ + +     ++   FKT    S LFY G            +  ++ V ++DG   II S+      +   R F  NS   +   DD WH + ++     + + +D  + E +  + +    +    F  +           +P++ P  +     FRGCMK++    +   + +V +  +      S  K   DI   C        V SFT  S YL      S+     S  F+T  SD LI Y    +   H  TD+ + E+ D  L+  I L S V     ++  VS+G  H++ L        +++D      +      ++  +  ++IG++ +  ++  S  VWS  L   ++GCI ++ ++   + I  +     ++ I  GC  S E   L++C   PC N G C    +   CDC+ TNF G  C  E    E NG +       +T  S+VE+  + F++    G++  T    +G  DK+ +F+ +  + + L     N  F   ++  D+ WH ++++R  + L +++D  ++  + +L+     I ++   +G+AF                  +H        ++ F G++   ++NG +Y  LAK K++   +  ++S +     NV  + A I+F ++  Y+      I    G FR++F+ +TL  S LL F   + +DY     L+M+NG L   Y   SG +      K+     L+D  WH+V I +   KTH     VD   + S   +      +     GK++ G      S         R   GF+GCI++  +N +          DL ++A+ +  V+  C    +     C  D+C+  G+C Q W    CDCS T+ SG +C++ STT +F   PS + Y+Y+  ++ + ++  F F   T           TQ    L++IE     DY       G++   Y      H+       + DG  H+++  +     T+++D L    + P       +++ +    +G++     +  K            +S+QG ISG+ +N + ILD L EN ++ I  I
Sbjct:  253 CQFSDHDGRNCEIEKNDGE---LTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGD-----------EKSYLHVMLQDGA--IIASSKFDGSDARIIRMF--NSFPSQRYDDDSWHTIILERSLQMMTLIVDGRRDEIRQYAPELDWISNSFGFLGS-----------IPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGG--SVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQ---HNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSS-VWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLSNE---LDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTG--ANGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD-GFWSHSIYLQNP---ISVEIDEVGAAFS-----------------VH-SSAPPPRDEHFKGFLSKLVFNGNDY--LAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPK-HDYDQSFRLQMLNGRLKYTYR-TSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQD-EKTHDHVLLVD---NSSTTLIIDKIKKVESKMSGKLYFGSNPLGVS---------RPSNGFRGCISTLRINENA--------LDLYEDADSRMKVNRGC----SGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRT-----------TQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILD-LYENGSNRIHTI 1282          
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 230.72 bits (587), Expect = 1.323e-60
Identity = 272/1147 (23.71%), Postives = 480/1147 (41.85%), Query Frame = 2
Query:  701 CYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEIN---RSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSI-YKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKF---AKATEPFQYYRQ-----------TQLPQYPPLSQ-----FRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPV-SFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTID--DSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAK-KLSPLNIELTASLQPA---NVMRQFA-INFHSTKSYLVIPKVNI---FGDFRLEFQMKTLQPSGLLLFLQGESNDY---LILEMVNGLLHIIYNWGSGYK-----RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDY-------GFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSS----EVSSK------------NSFQGFISGLTINEIAILDTLKENFNSYILLI 3934
            C F  +  R C   K   +   LTF  +  +GY   +++ + +     ++   FKT    S LFY G            +  ++ V ++DG   II S+      +   R F  NS   +   DD WH + +              ++  +  S + +   IHM      +  E  QY  +             +P++ P  +     FRGCMK++    +   + +V +  +      S  K   DI   C        V SFT  S YL      S+     S  F+T  SD LI Y    +   H  TD+ + E+ D  L+  I L S V     ++  VS+G  H++ L        +++D      +      ++  +  ++IG++ +  ++  S  VWS  L   ++GCI ++ ++   + I  +     ++ I  GC  S E   L++C   PC N G C    +   CDC+ TNF G  C  E    E NG +       +T  S+VE+  + F++    G++  T    +G  DK+ +F+ +  + + L     N  F   ++  D+ WH ++++R  + L +++D  ++  + +L+     I ++   +G+AF                  +H        ++ F G++   ++NG +Y  LAK K++   +  ++S +     NV  + A I+F ++  Y+      I    G FR++F+ +TL  S LL F   + +DY     L+M+NG L   Y   SG +      K+     L+D  WH+V I +   KTH     VD   + S   +      +     GK++ G      S         R   GF+GCI++  +N +          DL ++A+ +  V+  C    +     C  D+C+  G+C Q W    CDCS T+ SG +C++ STT +F   PS + Y+Y+  ++ + ++  F F   T           TQ    L++IE     DY       G++   Y      H+       + DG  H+++  +     T+++D L    + P       +++ +    +G++     +  K            +S+QG ISG+ +N + ILD L EN ++ I  I
Sbjct:  253 CQFSDHDGRNCEIEKNDGE---LTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGD-----------EKSYLHVMLQDGA--IIASSKFDGSDARIIRMF--NSFPSQRYDDDSWHTIIL--------------ERSLQMHSEEMVA--IHMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGG--SVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQ---HNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSS-VWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLSNE---LDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD-GFWSHSIYLQNP---ISVEIDEVGAAFS-----------------VH-SSAPPPRDEHFKGFLSKLVFNGNDY--LAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPK-HDYDQSFRLQMLNGRLKYTYR-TSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQD-EKTHDHVLLVD---NSSTTLIIDKIKKVESKMSGKLYFGSNPLGVS---------RPSNGFRGCISTLRINENA--------LDLYEDADSRMKVNRGC----SGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRT-----------TQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILD-LYENGSNRIHTI 1291          
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Match: nrx-1 (NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2HAJ7])

HSP 1 Score: 229.565 bits (584), Expect = 2.210e-60
Identity = 270/1146 (23.56%), Postives = 479/1146 (41.80%), Query Frame = 2
Query:  701 CYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEIN---RSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSI-YKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKF---AKATEPFQYYRQ-----------TQLPQYPPLSQ-----FRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPV-SFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTID--DSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAK-KLSPLNIELTASLQPA---NVMRQFA-INFHSTKSYLVIPKVNI---FGDFRLEFQMKTLQPSGLLLFL--QGESNDYLILEMVNGLLHIIYNWGSGYK-----RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDY-------GFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSS----EVSSK------------NSFQGFISGLTINEIAILDTLKENFNSYILLI 3934
            C F  +  R C   K   +   LTF  +  +GY   +++ + +     ++   FKT    S LFY G            +  ++ V ++DG   II S+      +   R F  NS   +   DD WH + +              ++  +  S + +   IHM      +  E  QY  +             +P++ P  +     FRGCMK++    +   + +V +  +      S  K   DI   C        V SFT  S YL      S+     S  F+T  SD LI Y    +   H  TD+ + E+ D  L+  I L S V     ++  VS+G  H++ L        +++D      +      ++  +  ++IG++ +  ++  S  VWS  L   ++GCI ++ ++   + I  +     ++ I  GC  S E   L++C   PC N G C    +   CDC+ TNF G  C  E    E NG +       +T  S+VE+  + F++    G++  T    +G  DK+ +F+ +  + + L     N  F   ++  D+ WH ++++R  + L +++D  ++  + +L+     I ++   +G+AF                  +H        ++ F G++   ++NG +Y  LAK K++   +  ++S +     NV  + A I+F ++  Y+      I    G FR++F+ +TL  S LL F   + + +    L+M+NG L   Y   SG +      K+     L+D  WH+V I +   KTH     VD   + S   +      +     GK++ G      S         R   GF+GCI++  +N +          DL ++A+ +  V+  C    +     C  D+C+  G+C Q W    CDCS T+ SG +C++ STT +F   PS + Y+Y+  ++ + ++  F F   T           TQ    L++IE     DY       G++   Y      H+       + DG  H+++  +     T+++D L    + P       +++ +    +G++     +  K            +S+QG ISG+ +N + ILD L EN ++ I  I
Sbjct:  253 CQFSDHDGRNCEIEKNDGE---LTFGGDEWVGYDVSLNISAAVRAKKENLTLTFKTVHGTSMLFYAGD-----------EKSYLHVMLQDGA--IIASSKFDGSDARIIRMF--NSFPSQRYDDDSWHTIIL--------------ERSLQMHSEEMVA--IHMTLIVDGRRDEIRQYAPELDWISNSFGFLGSIPKHNPSKEVNRVSFRGCMKKVRYDIDATRILLVNLADQSYGG--SVVKTEGDISYSCKNPSQRSDVLSFTETSSYLTLPRWNSLSSGSLSFHFRTTSSDGLILYHGVMQ---HNATDYVAFELIDSHLFMIINLGSGVVRLQTTSMKVSDGEWHHVQLDRLSRTGSVIVDAIKIDFSTPGVSANLIIDDPIFIGNVPNNSLVYPSS-VWSIALQKGYTGCIKNIRMNGVSTKIGQEFEASNSTGIELGCSLSNE---LDICEPNPCQNFGKCSKNLNSFDCDCSNTNFEGKQCELEQTAVEVNGEESKVHVLAHTKVSQVEHIKIRFRTTSSRGVLFDTGA--NGKNDKITVFLNDSQLNLFLQDSSTNNTFSWGKSLSDNHWHELQVRRLGQKLLLYLD-GFWSHSIYLQNP---ISVEIDEVGAAFS-----------------VH-SSAPPPRDEHFKGFLSKLVFNGNDY--LAKTKMNSAQLSKSSSRESKGQRNVKTRIASISFTNSTGYVAFSSDKISGLTGSFRVQFKFQTLMRSALLFFTLPKHDYDQSFRLQMLNGRLKYTYR-TSGQEFHTTSPKLPHRQHLSDMRWHNVLIYQD-EKTHDHVLLVD---NSSTTLIIDKIKKVESKMSGKLYFGSNPLGVS---------RPSNGFRGCISTLRINENA--------LDLYEDADSRMKVNRGC----SGPIARCIEDACANHGRCIQLWSSIRCDCSLTAHSGDRCQNPSTTVRFDGSPSAIFYEYAPNERPTTSKDYFVFSFRT-----------TQPNGVLISIECAADQDYFTIFLNKGYLNAHYNLGNRDHTTSYHTRILNDGFPHVIKISRTEANMTIQVDKLPSLRYRPKRASDLVLLNMQTRISIGAAFNTRHLDQKRLLRHRRNTEIFDSYQGEISGVNVNGLMILD-LYENGSNRIHTI 1291          
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 62.3882 bits (150), Expect = 3.267e-9
Identity = 69/313 (22.04%), Postives = 125/313 (39.94%), Query Frame = 2
Query: 2099 FNGYQFMRIKF---PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIK--YLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFG-DFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLN---DGLWHSVKIVRHMSKTHSFAFRVDGK 3010
            F   Q+ RI++   P       E F    +    NG+I    N+    TD + + +++G +    + G G    K+ ++  D +WH+IK+ RR K+  + +DDN YE       +  +I  +  + + G   D         +    N ++ +          F G +  F  NG++  +  K+            +  +   +  + F     Y ++ K    G  F LE +M+    +G+L  +     +Y+ +E VNG +      GSG +       + N   DG W S KI +   K +     V+GK
Sbjct: 3313 FGSQQYSRIEYDILPEAIDKSGE-FTFKIRPTSDNGIIFIATNK---RTDHIAVMLEHGRVVFTYDTGSGQVIIKSDKSIIDGRWHTIKVSRRGKSAHLIVDDNSYESEGAANQNEDLIETQPPFYVGGVPAD--------LAGFARNLVVGV-------RSQFSGCIKDFKLNGKS-LDNGKEF---------GTEQCSQFSEPGMYFGKDGGYAIVQKDYEVGLTFGLEVEMRPRMKNGILFSVG--VLEYITVEFVNGSIKTTVESGSGGEELWHHPDIENQYCDGQWQSFKISK---KRNLLTVAVNGK 3591          

HSP 2 Score: 61.2326 bits (147), Expect = 7.138e-9
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 2
Query: 2765 RLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVT 3118
            ++     T  P GLL F+ G+  D++ LE+ +G + +  + GSG  + I+ES   NDG WH+V IVR   +       +DG+ +    DVP     ++   F  +++GG     S+ T
Sbjct: 2921 KISLSFLTFSPHGLLFFV-GKDKDFMALELSDGGVKLSVDLGSGVGQWITESSNYNDGKWHTVSIVR---EEKHVKIMIDGETEVLEGDVPGKDSEMSVTEF--LYIGGTPSGLSVRT 3032          
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0084256)

HSP 1 Score: 308.145 bits (788), Expect = 1.605e-84
Identity = 310/1368 (22.66%), Postives = 565/1368 (41.30%), Query Frame = 2
Query:  146 NSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSA-KVR---------LDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIG-----YNS------------FKRFDGFLGDTMFF---GG--LPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLI----------PVMIQFQSDAMNTCY---FDSNFCRYCSSSKKCT--KYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDI---------VITLDDFQKEFKNLSNQ-QLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTY--KSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-------LNIELTASLQPANVMRQF-AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNN---SVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKN----SFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQS 4003
            N +L  + K +   GL+ Y +D  T  F  LKL+  A ++R         + VG   HD     + + +      D  T +I    +DG+  +  T       K    QF +F+   ++ +G     Y+S              RF G + + ++    GG    +++KQ    +             R   +R VR                  + I   S  +  C    +D  +C    +  + T    ++L++D    +G      ++S  + +I+F F+T+Q N  LFY G             T ++++ + DG   + +            ++ H         D +WH V +     +I         V  +DD   +  +++ +  +  +  +    A  P        L      + F GC++++    + + LN++++           G L    C    P  PV+FT +  +L      + +++  S  F+T + + +I     SK+    +    +IE+ +  +Y  + L S       S   V +G  H+++L       ++ +D          +   +E +G +Y+G +      +S    +W+  L   F GC+  L +    I +     ++ ++S+   C         NVC   PC N G C   W++  CDC+ T + G TC +E     FNG Q M I   N    K++ E   + FK+  P GL+L T  + S + D+LEI +  G +   +      K     ++   D+ WH+I+  RR  NL++ +D         +      + I+ + +G  F    +IQ +S+               M N  F+G M   ++NG+ Y ++ K L P          +LTA    +   + + A  F S  SY+ +  +  +    ++F+ KT++P+GLL+F  G  ND++ +E+VNG +H  ++ G G      +S + +ND  WH V I R   KTH+         DDS   + +    ++    G +++GG  ++  + +    +  S+ GF+GC+AS  + +   S+++D V+              V   C     +    CS ++C+  G C Q W  Y+C+C  TS++GP C D S   +F  +   + Y +    +    +  +A GF T TR  A L+ +   +S +    +E++IV   G I + Y   +      E    V D  YH+VRF++    ATL+LDD + +   P             + + G    + +N     F G I+GL++N++ ILD   E  + +I +  + +  LV     R   Q ++Q+
Sbjct:  125 NGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGHWHKVQVLRN-----DEQTSLI----VDGVSQQRST-------KGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYD----LGQTGAEPIVSAQD-AISFYFRTRQPNGLLFYTGH-----------GTDYLNLALRDGGVSLTMGLANG------KQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVNP------RALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ-CPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCHVQA-----NVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRAETILGRHSTMEIRSVHLGGLFHAEEEIQMTST---------------MPN--FVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTV------DDSFEIISLTGNNMHLELAGILYIGGVFKD--MYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVV----------PSSLVVSGC-----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFIT-TRPDAVLLRV---ESATTQDYMELEIVE--GNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRILDLAVER-DPHITI--RGDVQLVTGVLDRNDLQRMQQT 1392          
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334607)

HSP 1 Score: 308.145 bits (788), Expect = 1.605e-84
Identity = 310/1368 (22.66%), Postives = 565/1368 (41.30%), Query Frame = 2
Query:  146 NSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSA-KVR---------LDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIG-----YNS------------FKRFDGFLGDTMFF---GG--LPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLI----------PVMIQFQSDAMNTCY---FDSNFCRYCSSSKKCT--KYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDI---------VITLDDFQKEFKNLSNQ-QLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTY--KSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-------LNIELTASLQPANVMRQF-AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNN---SVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKN----SFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQS 4003
            N +L  + K +   GL+ Y +D  T  F  LKL+  A ++R         + VG   HD     + + +      D  T +I    +DG+  +  T       K    QF +F+   ++ +G     Y+S              RF G + + ++    GG    +++KQ    +             R   +R VR                  + I   S  +  C    +D  +C    +  + T    ++L++D    +G      ++S  + +I+F F+T+Q N  LFY G             T ++++ + DG   + +            ++ H         D +WH V +     +I         V  +DD   +  +++ +  +  +  +    A  P        L      + F GC++++    + + LN++++           G L    C    P  PV+FT +  +L      + +++  S  F+T + + +I     SK+    +    +IE+ +  +Y  + L S       S   V +G  H+++L       ++ +D          +   +E +G +Y+G +      +S    +W+  L   F GC+  L +    I +     ++ ++S+   C         NVC   PC N G C   W++  CDC+ T + G TC +E     FNG Q M I   N    K++ E   + FK+  P GL+L T  + S + D+LEI +  G +   +      K     ++   D+ WH+I+  RR  NL++ +D         +      + I+ + +G  F    +IQ +S+               M N  F+G M   ++NG+ Y ++ K L P          +LTA    +   + + A  F S  SY+ +  +  +    ++F+ KT++P+GLL+F  G  ND++ +E+VNG +H  ++ G G      +S + +ND  WH V I R   KTH+         DDS   + +    ++    G +++GG  ++  + +    +  S+ GF+GC+AS  + +   S+++D V+              V   C     +    CS ++C+  G C Q W  Y+C+C  TS++GP C D S   +F  +   + Y +    +    +  +A GF T TR  A L+ +   +S +    +E++IV   G I + Y   +      E    V D  YH+VRF++    ATL+LDD + +   P             + + G    + +N     F G I+GL++N++ ILD   E  + +I +  + +  LV     R   Q ++Q+
Sbjct:  125 NGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGHWHKVQVLRN-----DEQTSLI----VDGVSQQRST-------KGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYD----LGQTGAEPIVSAQD-AISFYFRTRQPNGLLFYTGH-----------GTDYLNLALRDGGVSLTMGLANG------KQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVNP------RALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ-CPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCHVQA-----NVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRAETILGRHSTMEIRSVHLGGLFHAEEEIQMTST---------------MPN--FVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTV------DDSFEIISLTGNNMHLELAGILYIGGVFKD--MYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVV----------PSSLVVSGC-----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFIT-TRPDAVLLRV---ESATTQDYMELEIVE--GNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRILDLAVER-DPHITI--RGDVQLVTGVLDRNDLQRMQQT 1392          
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334610)

HSP 1 Score: 306.99 bits (785), Expect = 3.497e-84
Identity = 313/1374 (22.78%), Postives = 567/1374 (41.27%), Query Frame = 2
Query:  146 NSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSA-KVR---------LDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIG-----YNS------------FKRFDGFLGDTMFF---GG--LPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLI----------PVMIQFQSDAMNTCY---FDSNFCRYCSSSKKCT--KYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDI---------VITLDDFQKEFKNLSNQ-QLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTY--KSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIG------IKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-------LNIELTASLQPANVMRQF-AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNN---SVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKN----SFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQS 4003
            N +L  + K +   GL+ Y +D  T  F  LKL+  A ++R         + VG   HD     + + +      D  T +I    +DG+  +  T       K    QF +F+   ++ +G     Y+S              RF G + + ++    GG    +++KQ    +             R   +R VR                  + I   S  +  C    +D  +C    +  + T    ++L++D    +G      ++S  + +I+F F+T+Q N  LFY G             T ++++ + DG   + +            ++ H         D +WH V +     +I         V  +DD   +  +++ +  +  +  +    A  P        L      + F GC++++    + + LN++++           G L    C    P  PV+FT +  +L      + +++  S  F+T + + +I     SK+    +    +IE+ +  +Y  + L S       S   V +G  H+++L       ++ +D          +   +E +G +Y+G +      +S    +W+  L   F GC+  L +    I +     ++ ++S+   C         NVC   PC N G C   W++  CDC+ T + G TC +E     FNG Q M I   N    K++ E   + FK+  P GL+L T  + S + D+LEI +  G +   +      K     ++   D+ WH+I+  RR  NL++ +D          E    I+G      I+ + +G  F    +IQ +S+               M N  F+G M   ++NG+ Y ++ K L P          +LTA    +   + + A  F S  SY+ +  +  +    ++F+ KT++P+GLL+F  G  ND++ +E+VNG +H  ++ G G      +S + +ND  WH V I R   KTH+         DDS   + +    ++    G +++GG  ++  + +    +  S+ GF+GC+AS  + +   S+++D V+              V   C     +    CS ++C+  G C Q W  Y+C+C  TS++GP C D S   +F  +   + Y +    +    +  +A GF T TR  A L+ +   +S +    +E++IV   G I + Y   +      E    V D  YH+VRF++    ATL+LDD + +   P             + + G    + +N     F G I+GL++N++ ILD   E  + +I +  + +  LV     R   Q ++Q+
Sbjct:  125 NGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGHWHKVQVLRN-----DEQTSLI----VDGVSQQRST-------KGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYD----LGQTGAEPIVSAQD-AISFYFRTRQPNGLLFYTGH-----------GTDYLNLALRDGGVSLTMGLANG------KQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVNP------RALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ-CPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCHVQA-----NVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSET---ILGRHSTMEIRSVHLGGLFHAEEEIQMTST---------------MPN--FVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTV------DDSFEIISLTGNNMHLELAGILYIGGVFKD--MYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVV----------PSSLVVSGC-----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFIT-TRPDAVLLRV---ESATTQDYMELEIVE--GNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRILDLAVER-DPHITI--RGDVQLVTGVLDRNDLQRMQQT 1395          
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334612)

HSP 1 Score: 306.99 bits (785), Expect = 3.618e-84
Identity = 313/1374 (22.78%), Postives = 567/1374 (41.27%), Query Frame = 2
Query:  146 NSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSA-KVR---------LDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIG-----YNS------------FKRFDGFLGDTMFF---GG--LPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLI----------PVMIQFQSDAMNTCY---FDSNFCRYCSSSKKCT--KYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDI---------VITLDDFQKEFKNLSNQ-QLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTY--KSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIG------IKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-------LNIELTASLQPANVMRQF-AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNN---SVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKN----SFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQS 4003
            N +L  + K +   GL+ Y +D  T  F  LKL+  A ++R         + VG   HD     + + +      D  T +I    +DG+  +  T       K    QF +F+   ++ +G     Y+S              RF G + + ++    GG    +++KQ    +             R   +R VR                  + I   S  +  C    +D  +C    +  + T    ++L++D    +G      ++S  + +I+F F+T+Q N  LFY G             T ++++ + DG   + +            ++ H         D +WH V +     +I         V  +DD   +  +++ +  +  +  +    A  P        L      + F GC++++    + + LN++++           G L    C    P  PV+FT +  +L      + +++  S  F+T + + +I     SK+    +    +IE+ +  +Y  + L S       S   V +G  H+++L       ++ +D          +   +E +G +Y+G +      +S    +W+  L   F GC+  L +    I +     ++ ++S+   C         NVC   PC N G C   W++  CDC+ T + G TC +E     FNG Q M I   N    K++ E   + FK+  P GL+L T  + S + D+LEI +  G +   +      K     ++   D+ WH+I+  RR  NL++ +D          E    I+G      I+ + +G  F    +IQ +S+               M N  F+G M   ++NG+ Y ++ K L P          +LTA    +   + + A  F S  SY+ +  +  +    ++F+ KT++P+GLL+F  G  ND++ +E+VNG +H  ++ G G      +S + +ND  WH V I R   KTH+         DDS   + +    ++    G +++GG  ++  + +    +  S+ GF+GC+AS  + +   S+++D V+              V   C     +    CS ++C+  G C Q W  Y+C+C  TS++GP C D S   +F  +   + Y +    +    +  +A GF T TR  A L+ +   +S +    +E++IV   G I + Y   +      E    V D  YH+VRF++    ATL+LDD + +   P             + + G    + +N     F G I+GL++N++ ILD   E  + +I +  + +  LV     R   Q ++Q+
Sbjct:  125 NGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGHWHKVQVLRN-----DEQTSLI----VDGVSQQRST-------KGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYD----LGQTGAEPIVSAQD-AISFYFRTRQPNGLLFYTGH-----------GTDYLNLALRDGGVSLTMGLANG------KQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVNP------RALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ-CPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCHVQA-----NVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSET---ILGRHSTMEIRSVHLGGLFHAEEEIQMTST---------------MPN--FVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTV------DDSFEIISLTGNNMHLELAGILYIGGVFKD--MYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVV----------PSSLVVSGC-----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFIT-TRPDAVLLRV---ESATTQDYMELEIVE--GNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRILDLAVER-DPHITI--RGDVQLVTGVLDRNDLQRMQQT 1395          
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Match: Nrx-1 (gene:FBgn0038975 transcript:FBtr0334608)

HSP 1 Score: 306.99 bits (785), Expect = 3.618e-84
Identity = 313/1374 (22.78%), Postives = 567/1374 (41.27%), Query Frame = 2
Query:  146 NSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSA-KVR---------LDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIG-----YNS------------FKRFDGFLGDTMFF---GG--LPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLI----------PVMIQFQSDAMNTCY---FDSNFCRYCSSSKKCT--KYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDI---------VITLDDFQKEFKNLSNQ-QLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTY--KSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIG------IKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-------LNIELTASLQPANVMRQF-AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNN---SVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKN----SFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQS 4003
            N +L  + K +   GL+ Y +D  T  F  LKL+  A ++R         + VG   HD     + + +      D  T +I    +DG+  +  T       K    QF +F+   ++ +G     Y+S              RF G + + ++    GG    +++KQ    +             R   +R VR                  + I   S  +  C    +D  +C    +  + T    ++L++D    +G      ++S  + +I+F F+T+Q N  LFY G             T ++++ + DG   + +            ++ H         D +WH V +     +I         V  +DD   +  +++ +  +  +  +    A  P        L      + F GC++++    + + LN++++           G L    C    P  PV+FT +  +L      + +++  S  F+T + + +I     SK+    +    +IE+ +  +Y  + L S       S   V +G  H+++L       ++ +D          +   +E +G +Y+G +      +S    +W+  L   F GC+  L +    I +     ++ ++S+   C         NVC   PC N G C   W++  CDC+ T + G TC +E     FNG Q M I   N    K++ E   + FK+  P GL+L T  + S + D+LEI +  G +   +      K     ++   D+ WH+I+  RR  NL++ +D          E    I+G      I+ + +G  F    +IQ +S+               M N  F+G M   ++NG+ Y ++ K L P          +LTA    +   + + A  F S  SY+ +  +  +    ++F+ KT++P+GLL+F  G  ND++ +E+VNG +H  ++ G G      +S + +ND  WH V I R   KTH+         DDS   + +    ++    G +++GG  ++  + +    +  S+ GF+GC+AS  + +   S+++D V+              V   C     +    CS ++C+  G C Q W  Y+C+C  TS++GP C D S   +F  +   + Y +    +    +  +A GF T TR  A L+ +   +S +    +E++IV   G I + Y   +      E    V D  YH+VRF++    ATL+LDD + +   P             + + G    + +N     F G I+GL++N++ ILD   E  + +I +  + +  LV     R   Q ++Q+
Sbjct:  125 NGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGHWHKVQVLRN-----DEQTSLI----VDGVSQQRST-------KGKEFQFGKFASNSDVYVGGMPNWYSSKLALLALPSVIFEPRFRGAIRNLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVRGGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYD----LGQTGAEPIVSAQD-AISFYFRTRQPNGLLFYTGH-----------GTDYLNLALRDGGVSLTMGLANG------KQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFTMLSSSRVYVGGAVNP------RALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ-CPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVRASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFARVQDSASVKPSCHVQA-----NVCNGNPCLNGGTCLEGWNRPICDCSATLYGGPTCGRELATLAFNGSQHMTIWLGNGQGTKTQTEELVIRFKTSRPAGLLLLTSAE-SNSPDRLEIALVAGRVRASVRLSDREKNLLAGQSVLNDNNWHTIRFSRRASNLRLQVDGAPPVRGMLSET---ILGRHSTMEIRSVHLGGLFHAEEEIQMTST---------------MPN--FVGQMQGLVFNGQRYLDIVKSLGPELSALPSATFKLTARFVNSPAGQPYHAATFRSKHSYVGLAMLKAYNSISIDFRFKTVEPNGLLVFNGGRRNDFVAVELVNGHIHYTFDLGDGPVTMRDKSRIHMNDNRWHQVSIRRPGPKTHTLTV------DDSFEIISLTGNNMHLELAGILYIGGVFKD--MYSKLPASISSRSGFEGCLASLDLGDASPSLTSDAVV----------PSSLVVSGC-----EGPTKCSQNACANRGNCVQQWNAYACECDMTSYTGPTCYDESIAYEFGNNKGMVQYTFPENAQADTEEDNIALGFIT-TRPDAVLLRV---ESATTQDYMELEIVE--GNIFMVYNIGSVDLPLGEIGTKVNDNAYHVVRFQRKGGNATLQLDDYNVQALTPQSHHSTVFNTMSNVQVGGKFSRNGRNRIERPFAGVIAGLSVNKLRILDLAVER-DPHITI--RGDVQLVTGVLDRNDLQRMQQT 1395          
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 325.865 bits (834), Expect = 1.718e-90
Identity = 364/1558 (23.36%), Postives = 630/1558 (40.44%), Query Frame = 2
Query:   92 FIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT--CYFD-----SNFCRY--------CSSS----KKCT--KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCP-----DNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQC-PGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPF--EYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            F G        P  N    S +SF +K  +  GL+ Y +D     F+ L L+ + ++ L   +F  +                   T   D +  D     WH + +  + K+  L  ++  + V +       KR D  +   +F GG+P +L+  A      SSAI  E  + G I+ +R+         PV+I   SD +N+  C  D        C          CS +    K C+  + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G + +  C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N           +G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C       +       C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E                 PN    R + S +   + P +  T Q +      R +  P IT+                        N Q K + T  ++    S   P   E + P  D +++   +   K  P  E   +S+      ++       A  ++ L   +Y+   +DEGSY+V E R
Sbjct:   30 FTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPA-----------------TVFSDTAVND---SRWHAVTLRRNFKNTTLVVDEEIKWVEV-----KSKRRDMTVFSHLFLGGIPPELRSVALR--LTSSAIKDEVPYKGWITNLRVNGSE-----PVLIG--SDGVNSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVV-AFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGCEVALLKADLQGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEGD---------------PNV---RVEGSARLVGDMPSSSITPQSSVSAAGNRSETSPSITDI-----------------TTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDP-CDPSSAHPPLPEAKGYPSPEVIRESSSTTG--MVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESR 1432          

HSP 2 Score: 155.606 bits (392), Expect = 2.063e-37
Identity = 187/901 (20.75%), Postives = 369/901 (40.95%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN--KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIE-----IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+  +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E     +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 846          
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 325.094 bits (832), Expect = 2.564e-90
Identity = 345/1460 (23.63%), Postives = 596/1460 (40.82%), Query Frame = 2
Query:  392 EWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT--CYFD-----SNFCRY--------CSSS----KKCT------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQC-PGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPF--EYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
             WH + +  + K+  L  ++  + V +       KR D  +   +F GG+P +L+  A      SSAI  E  + G I+ +R+         PV+I   SD +N+  C  D        C          CS +    K C+                  + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G +    C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N G+G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C          C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E                 PN    R + S +   + P +  T Q +      R +  P IT+                        N Q K + T  ++    S   P   E + P  D +++   +   K  P  E   +S+      ++       A  ++ L   +Y+   +DEGSY+V E R
Sbjct:  109 RWHAVTLRRNFKNTTLVVDEEIKWVEV-----KSKRRDMTVFSHLFLGGIPPELRSVALR--LTSSAIKDEVPYKGWITNLRVNGSE-----PVLIG--SDGVNSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFK-CENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLGKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGC----EGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEGD---------------PNV---RVEGSARLVGDMPSSSITPQSSVSAAGNRSETSPSITDI-----------------TTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDP-CDPSSAHPPLPEAKGYPSPEVIRESSSTTG--MVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESR 1430          

HSP 2 Score: 149.443 bits (376), Expect = 1.712e-35
Identity = 187/912 (20.50%), Postives = 366/912 (40.13%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN------------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+                  +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E+    D G +++      G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLEL----DGGRVRLTVNLGKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 853          
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 315.849 bits (808), Expect = 2.693e-87
Identity = 360/1554 (23.17%), Postives = 624/1554 (40.15%), Query Frame = 2
Query:  149 SSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT--CYFD-----SNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQC-PGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPF--EYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            S +SF +K  +  GL+ Y +D     F+ L L+ + ++ L   +F  +                   T   D +  D     WH + +  + K+  L  ++  + V +       KR D  +   +F GG+P +L+  A      SSAI  E  + G I+ +R+         PV+I   SD +N+  C  D        C          CS +    K C+                      + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G +    C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N           +G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C          C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E                 PN    R + S +   + P +  T Q +      R +  P IT+                        N Q K + T  ++    S   P   E + P  D +++   +   K  P  E   +S+      ++       A  ++ L   +Y+   +DEGSY+V E R
Sbjct:   49 SEMSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPA-----------------TVFSDTAVND---SRWHAVTLRRNFKNTTLVVDEEIKWVEV-----KSKRRDMTVFSHLFLGGIPPELRSVALR--LTSSAIKDEVPYKGWITNLRVNGSE-----PVLIG--SDGVNSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFK-CENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGC----EGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEGD---------------PNV---RVEGSARLVGDMPSSSITPQSSVSAAGNRSETSPSITDI-----------------TTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDP-CDPSSAHPPLPEAKGYPSPEVIRESSSTTG--MVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESR 1443          

HSP 2 Score: 147.517 bits (371), Expect = 5.416e-35
Identity = 187/921 (20.30%), Postives = 369/921 (40.07%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIE-----IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+                      +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E     +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 866          
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 314.694 bits (805), Expect = 6.713e-87
Identity = 344/1469 (23.42%), Postives = 595/1469 (40.50%), Query Frame = 2
Query:  392 EWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT--CYFD-----SNFCRY--------CSSS----KKCT------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQC-PGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPF--EYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
             WH + +  + K+  L  ++  + V +       KR D  +   +F GG+P +L+  A      SSAI  E  + G I+ +R+         PV+I   SD +N+  C  D        C          CS +    K C+                  + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G +    C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N           +G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C          C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E                 PN    R + S +   + P +  T Q +      R +  P IT+                        N Q K + T  ++    S   P   E + P  D +++   +   K  P  E   +S+      ++       A  ++ L   +Y+   +DEGSY+V E R
Sbjct:  109 RWHAVTLRRNFKNTTLVVDEEIKWVEV-----KSKRRDMTVFSHLFLGGIPPELRSVALR--LTSSAIKDEVPYKGWITNLRVNGSE-----PVLIG--SDGVNSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFK-CENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGC----EGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEGD---------------PNV---RVEGSARLVGDMPSSSITPQSSVSAAGNRSETSPSITDI-----------------TTTTASNRQGKQTTTPQDDLLVASAECPSDDEDIDP-CDPSSAHPPLPEAKGYPSPEVIRESSSTTG--MVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESR 1439          

HSP 2 Score: 149.443 bits (376), Expect = 1.706e-35
Identity = 187/917 (20.39%), Postives = 369/917 (40.24%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN------------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIE-----IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+                  +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E     +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 862          
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Match: nrxn1a (neurexin 1a [Source:NCBI gene;Acc:565531])

HSP 1 Score: 313.153 bits (801), Expect = 1.883e-86
Identity = 325/1370 (23.72%), Postives = 564/1370 (41.17%), Query Frame = 2
Query:  149 SSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT--CYFD-----SNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN 3910
            S +SF +K  +  GL+ Y +D     F+ L L+ + ++ L   +F  +                   T   D +  D     WH + +  + K+  L  ++  + V +       KR D  +   +F GG+P +L+  A      SSAI  E  + G I+ +R+         PV+I   SD +N+  C  D        C          CS +    K C+                      + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G +    C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N           +G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C          C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E 
Sbjct:   49 SEMSFNMKTKSAHGLLVYFDDEGFCDFLEL-LIHNGRLSLRFSIFCAEPA-----------------TVFSDTAVND---SRWHAVTLRRNFKNTTLVVDEEIKWVEV-----KSKRRDMTVFSHLFLGGIPPELRSVALR--LTSSAIKDEVPYKGWITNLRVNGSE-----PVLIG--SDGVNSDICEADHICLNGGVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFK-CENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGC----EGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEG 1297          

HSP 2 Score: 147.132 bits (370), Expect = 7.056e-35
Identity = 187/921 (20.30%), Postives = 369/921 (40.07%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIE-----IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+                      +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E     +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 866          
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 310.457 bits (794), Expect = 1.837e-85
Identity = 298/1268 (23.50%), Postives = 525/1268 (41.40%), Query Frame = 2
Query:  134 NVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKI-DGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDA-------SHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYF-DSNFCRYCSSSKKCTKY-------EYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPD-----NHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            + +T S LSFQ++ +   GL+ Y +D     F+ L L              H   R +I  ++         T I+   K+ DG    WH +M++ ++    L  +  ++    P      ++    + D +F GG+P  ++  A           F    ++  +      +     +RL L  +  +   +    C   D      C+++    K+          TF  +  + Y    + I   +  I   FKT+Q N  + + G                + + +  G F  I+             KF+         D++WH V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +         +  K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K I    +T  DF+++E+ D  LY  + + S       +N   ++G   ++ +  +     I ++ +      S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N   C+  W++  CDCT T   G TC +EA I  ++G  +M+I  P    +E E+  L FKS+   GL+++T ++ S  T +LE  +  G + +++N           +G +     +   D++WH++++ RR K LK+ +DD+  E                         GT + D +     N        KR  +     F+G++   ++NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT+ P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+          D++A   V  G  N +  G++++ G +  QS+ +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C D     N       C  DSC+  G C Q W  ++CDCS TS+SG  C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I      G I V +   +   S  E    V DG YH+V++ ++   ATL++D+     H P G
Sbjct:   44 DASTRSDLSFQLRTNVSAGLLLYFDDGGICDFLCLSLADG-----------HVQLRFSIDCAE---------TAIVSDKKVNDG---GWHFLMLSRNRLRTTLVLDGEAK----PGEVRPQRQHMNIVSD-LFVGGVPSDIRSGALTLGSVRDMSAFAGYLLDIKYGNTEPRLLGSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTND--------KFN---------DNEWHEVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIG----DTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNA--AGVKSSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHTLKV-------DTKAVTQVINGAKNLDLKGELYIAGLV--QSMYSTLPKLVASRDGFQGCLASVDLNGRL--------PDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFST-TVKEGILVRIDSAPGLMDYLQLHIV----QGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGG 1199          
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 309.686 bits (792), Expect = 7.703e-85
Identity = 297/1268 (23.42%), Postives = 530/1268 (41.80%), Query Frame = 2
Query:  134 NVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKI-DGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDA-------SHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYF-DSNFCRYCSSSKKCTKY-------EYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPD-----NHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            + +T S LSFQ++ +   GL+ Y +D     F+ L L              H   R +I  ++         T I+   K+ DG    WH +M++ ++    L  +  ++    P      ++    + D +F GG+P  ++  A           F    ++  +      +     +RL L  +  +   +    C   D      C+++    K+          TF  +  + Y    + I   +  I   FKT+Q N  + + G               ++++ ++ G   ++I+       +F       N  +    D++WH V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +         +  K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K I    +T  DF+++E+ D  LY  + + S       +N   ++G   ++ +  +     I ++ +      S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N   C+  W++  CDCT T   G TC +EA I  ++G  +M+I  P    +E E+  L FKS+   GL+++T ++ S  T +LE  +  G + +++N           +G +     +   D++WH++++ RR K LK+ +DD+  E                         GT + D +     N        KR  +     F+G++   ++NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT+ P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+          D++A   V  G  N +  G++++ G +  QS+ +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C D     N       C  DSC+  G C Q W  ++CDCS TS+SG  C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I      G I V +   +   S  E    V DG YH+V++ ++   ATL++D+     H P G
Sbjct:   44 DASTRSDLSFQLRTNVSAGLLLYFDDGGICDFLCLSLADG-----------HVQLRFSIDCAE---------TAIVSDKKVNDG---GWHFLMLSRNRLRTTLVLDGEAK----PGEVRPQRQHMNIVSD-LFVGGVPSDIRSGALTLGSVRDMSAFAGYLLDIKYGNTEPRLLGSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK-----------SADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFN---DNEWHEVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIG----DTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNA--AGVKSSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHTLKV-------DTKAVTQVINGAKNLDLKGELYIAGLV--QSMYSTLPKLVASRDGFQGCLASVDLNGRL--------PDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFST-TVKEGILVRIDSAPGLMDYLQLHIV----QGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGG 1199          
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 306.22 bits (783), Expect = 1.140e-83
Identity = 260/1047 (24.83%), Postives = 455/1047 (43.46%), Query Frame = 2
Query:  746 KCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPD-----NHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            K  +    TF  +  + Y    + I   +  I   FKT+Q N  + + G               ++++ ++ G   ++I+       +F       N  +    D++WH V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +         +  K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K I    +T  DF+++E+ D  LY  + + S       +N   ++G   ++ +  +     I ++ +      S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N   C+  W++  CDCT T   G TC +EA I  ++G  +M+I  P    +E E+  L FKS+   GL+++T ++ S  T +LE  +  G + +++N G+G +     +   D++WH++++ RR K LK+ +DD+  E                         GT + D +     N        KR  +     F+G++   ++NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT+ P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+          D++A   V  G  N +  G++++ G +  QS+ +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C D     N       C  DSC+  G C Q W  ++CDCS TS+SG  C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I      G I V +   +   S  E    V DG YH+V++ ++   ATL++D+     H P G
Sbjct:  256 KAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK-----------SADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFN---DNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIG----DTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNA--AGVKSSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLGKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHTLKV-------DTKAVTQVINGAKNLDLKGELYIAGLV--QSMYSTLPKLVASRDGFQGCLASVDLNGRL--------PDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFST-TVKEGILVRIDSAPGLMDYLQLHIV----QGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGG 1218          

HSP 2 Score: 116.316 bits (290), Expect = 2.701e-25
Identity = 177/837 (21.15%), Postives = 332/837 (39.67%), Query Frame = 2
Query: 1460 KAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRD--FALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIY-NGRNYFELAKKL----SPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN-------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHS-FMESRLNVIDGLYHIVRFRKDRMAATLKL---DDLSDRIHVPD 3766
            ++  S   +T+ S  L+ Y      GI    DF  + + D    L FSI       + ++S+  V++G  H ++L        ++LD E     +      +     L++G +  + I S +  + S    + F+G +  +   ++  +L          S G +   E     +C   PC N G C +   + +CDCT T + G  C+                      +E  +A F G +++      N  +S  +   L FK++  NGLIL T      + D + + ++ G++ +++N G G         N KF       D++WH +K+ R   NL+          ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y N     EL++      + + I      +  NV     I+F S ++Y+ +PK N      + F  +T +P+GL+LF  G+               D+  +E+++G L+++ + GSG  +  + +   NDG W  V I R   ++ + +      P  +  +  +       +  G M+LGG  EN++ +    E  T     G+ GCI   +++           K++  L EA     V  +C      +   C    C     C   W ++ CDC+ T   G  CE  ++   +     Y+     ++       ++  F++  R +  L++     S   L     ++  D G +++      G  + +   +LN  D  +H VR    R   TLKL   DD+++   V D
Sbjct:   48 RSDLSFQLRTNVSAGLLLY--FDDGGI---CDFLCLSLADGHVQLRFSI---DCAETAIVSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVP-SDIRSGALTLGSVRDMSAFAGYLLDIKYGNTEPRL--------LGSHGARLDLE----GLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEDVNDIPGLAHLMIDDQGRSKAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFN------DNEWHEVKVTR---NLRQ---------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRD-GRSGTISVNTKRTPFTASGESEI------LDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGR--------SKNIRQLAEAQNAAGVKSSCSRLSGKQ---CDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQ-RAYGLLVATTSRDSADTL-----RLELDGGKVKLMVNLGKGPETLYAGQKLN--DNEWHTVRVV--RRGKTLKLTVDDDVAEGTMVGD 807          
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 303.523 bits (776), Expect = 7.075e-83
Identity = 298/1276 (23.35%), Postives = 532/1276 (41.69%), Query Frame = 2
Query:  134 NVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKI-DGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDA-------SHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYF-DSNFCRYCSSSKKCTKY-------EYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPD-----NHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            + +T S LSFQ++ +   GL+ Y +D     F+ L L              H   R +I  ++         T I+   K+ DG    WH +M++ ++    L  +  ++    P      ++    + D +F GG+P  ++  A           F    ++  +      +     +RL L  +  +   +    C   D      C+++    K+          TF  +  + Y    + I   +  I   FKT+Q N  + + G               ++++ ++ G   ++I+       +F       N  +    D++WH V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +         +  K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K I    +T  DF+++E+ D  LY  + + S       +N   ++G   ++ +  +     I ++ +      S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N   C+  W++  CDCT T   G TC +EA I  ++G  +M+I  P    +E E+  L FKS+   GL+++T ++ S  T +LE  +  G + +++N           +G +     +   D++WH++++ RR K LK+ +DD+  E                         GT + D +     N        KR  +     F+G++   ++NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT+ P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+          D++A   V  G  N +  G++++ G +  QS+ +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C D     N       C  DSC+  G C Q W  ++CDCS TS+SG  C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I      G I V +   +   S  E    V DG YH+V++ ++   ATL++D+     H P G
Sbjct:   44 DASTRSDLSFQLRTNVSAGLLLYFDDGGICDFLCLSLADG-----------HVQLRFSIDCAE---------TAIVSDKKVNDG---GWHFLMLSRNRLRTTLVLDGEAK----PGEVRPQRQHMNIVSD-LFVGGVPSDIRSGALTLGSVRDMSAFAGYLLDIKYGNTEPRLLGSHGARLDLEGLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK-----------SADYVNLALKGGAVSLVIN---LGSGAFEAIVEPTNDKFN---DNEWHEVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIG----DTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNA--AGVKSSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHTLKV-------DTKAVTQVINGAKNLDLKGELYIAGLV--QSMYSTLPKLVASRDGFQGCLASVDLNGRL--------PDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFST-TVKEGILVRIDSAPGLMDYLQLHIV----QGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGG 1207          
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Match: NRXN3 (neurexin 3 [Source:NCBI gene;Acc:100379902])

HSP 1 Score: 301.982 bits (772), Expect = 7.484e-83
Identity = 259/1048 (24.71%), Postives = 447/1048 (42.65%), Query Frame = 2
Query:  746 KCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPD-----NHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            K  +    TF  +  + Y    + I   +  I   FKT+Q N  + + G                + + +  G F  I+             KF+         D++WH V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +         +  K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K I    +T  DF+++E+ D  LY  + + S       +N   ++G   ++ +  +     I ++ +      S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N   C+  W++  CDCT T   G TC +EA I  ++G  +M+I  P    +E E+  L FKS+   GL+++T ++ S  T +LE  +  G + +++N           +G +     +   D++WH++++ RR K LK+ +DD+  E                         GT + D +     N        KR  +     F+G++   ++NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT+ P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+          D++A   V  G  N +  G++++ G +  QS+ +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C D     N       C  DSC+  G C Q W  ++CDCS TS+SG  C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I      G I V +   +   S  E    V DG YH+V++ ++   ATL++D+     H P G
Sbjct:  256 KAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGKSADYVNLALKGGAVSLVINLGSGAFEAIVEPTND--------KFN---------DNEWHEVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIG----DTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRDGRSGTISVNTKRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEAQNA--AGVKSSCSRLSGKQCDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSYDGGMYMKIIMPVVMHTEAEDVSLRFKSQRAYGLLVATTSRDSADTLRLE--LDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKTLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGFMTEKRFASAVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGMRSIIAD-PVTFRTKASYLTLSTLQAYTSMHLFFQFKTISPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSERPLNDNQWHNVVITRDNSNTHTLKV-------DTKAVTQVINGAKNLDLKGELYIAGLV--QSMYSTLPKLVASRDGFQGCLASVDLNGRL--------PDLIGDALHRSGQIERGCEDALTKANLQGPTTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNHCNDPGATYIFGKSGGLILYTWPHNDRPSTRTDRLAVGFST-TVKEGILVRIDSAPGLMDYLQLHIV----QGKIGVTFNIGSQDISIREESAPVNDGKYHVVKYTRNGGNATLQVDNWPVNEHYPGG 1219          

HSP 2 Score: 120.553 bits (301), Expect = 1.404e-26
Identity = 177/835 (21.20%), Postives = 334/835 (40.00%), Query Frame = 2
Query: 1460 KAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRD--FALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIK-YLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIY-NGRNYFELAKKL----SPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN-------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPL-LTIE---IKIVNDYGFIQVEYYTNTGTHS-FMESRLNVIDGLYHIVRFRKDRMAATLKL---DDLSDRIHVPD 3766
            ++  S   +T+ S  L+ Y      GI    DF  + + D    L FSI       + ++S+  V++G  H ++L        ++LD E     +      +     L++G +  + I S +  + S    + F+G +  +   ++  +L          S G +   E     +C   PC N G C +   + +CDCT T + G  C+                      +E  +A F G +++      N  +S  +   L FK++  NGLIL T      + D + + ++ G++ +++N G G         N KF       D++WH +K+ R  + + + +D        + + D  ++G   +  +G +        D     VSN+              FMG +   +Y N     EL++      + + I      +  NV     I+F S ++Y+ +PK N      + F  +T +P+GL+LF  G+               D+  +E+++G L+++ + GSG  +  + +   NDG W  V I R   ++ + +      P  +  +  +       +  G M+LGG  EN++ +    E  T     G+ GCI   +++           K++  L EA     V  +C      +   C    C     C   W ++ CDC+ T   G  CE  ++   +     Y+     ++       ++  F++  R +  L++     S   L L ++   +K++ +   I++   ++ G  + +   +LN  D  +H VR    R   TLKL   DD+++   V D
Sbjct:   48 RSDLSFQLRTNVSAGLLLY--FDDGGI---CDFLCLSLADGHVQLRFSI---DCAETAIVSDKKVNDGGWHFLMLSRNRLRTTLVLDGEAKPGEVRPQRQHMNIVSDLFVGGVP-SDIRSGALTLGSVRDMSAFAGYLLDIKYGNTEPRL--------LGSHGARLDLE----GLCTENPCENGGACLLLDGEPTCDCTATGYVGKFCSEDVNDIPGLAHLMIDDQGRSKAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTRQRNGLILHTGK----SADYVNLALKGGAVSLVINLGSGAFEAIVEPTNDKFN------DNEWHEVKVTRNLRQVTISVD-GILTTTGYTQEDYTMLGSDDFFYVGGS----PSTADLPGSPVSNN--------------FMGCLKEVVYKNNDIRLELSRLARIGDTKMKIYGDVVFKCENVATLDPISFESPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQDRKDIRSQKNTKVDFFAVELLDGHLYLLLDMGSGTIKVKATNKKANDGEWCHVDIQRD-GRSGTISVNTKRTPFTASGESEI------LDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGR--------SKNIRQLAEAQNAAGVKSSCSRLSGKQ---CDSYPCKNNAACRDGWNRFVCDCTGTGHWGRTCEREASILSY-DGGMYMKIIMPVVMHTEAEDVSLRFKSQ-RAYGLLVATTSRDSADTLRLELDGGKVKLMVNLDCIRINCNSSKGPETLYAGQKLN--DNEWHTVRVV--RRGKTLKLTVDDDVAEGTMVGD 808          
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 331.643 bits (849), Expect = 2.699e-92
Identity = 345/1526 (22.61%), Postives = 608/1526 (39.84%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  ++   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLYIDRAEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1439          

HSP 2 Score: 53.5286 bits (127), Expect = 3.294e-6
Identity = 60/242 (24.79%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  +  E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QALPVDGGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 331.257 bits (848), Expect = 3.123e-92
Identity = 350/1544 (22.67%), Postives = 607/1544 (39.31%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEF-ASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  ++   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   AS       E + P    + +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLYIDRAEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1458          

HSP 2 Score: 53.9138 bits (128), Expect = 2.437e-6
Identity = 60/242 (24.79%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  +  E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QALPVDGGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 331.257 bits (848), Expect = 3.366e-92
Identity = 348/1543 (22.55%), Postives = 610/1543 (39.53%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  ++   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                  K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLYIDRAEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV-AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1457          

HSP 2 Score: 53.5286 bits (127), Expect = 2.651e-6
Identity = 60/242 (24.79%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  +  E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QALPVDGGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 330.102 bits (845), Expect = 7.470e-92
Identity = 348/1547 (22.50%), Postives = 609/1547 (39.37%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  ++   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLYIDRAEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1461          

HSP 2 Score: 53.5286 bits (127), Expect = 2.652e-6
Identity = 60/242 (24.79%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  +  E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QALPVDGGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Match: Nrxn1 (neurexin I [Source:MGI Symbol;Acc:MGI:1096391])

HSP 1 Score: 323.553 bits (828), Expect = 1.190e-89
Identity = 349/1555 (22.44%), Postives = 612/1555 (39.36%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  ++   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLYIDRAEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVV-AFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1469          

HSP 2 Score: 53.5286 bits (127), Expect = 3.222e-6
Identity = 60/242 (24.79%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS------CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S         + L  +  E    DE  P N     + C          C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSS---------QALPVDGGEVKLDDE--PPNSGGG-SPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Match: sp|Q9ULB1|NRX1A_HUMAN (Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 8.123e-91
Identity = 347/1542 (22.50%), Postives = 608/1542 (39.43%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSE--------------------EEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+                      K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                    + P     +Q  + I+VA  +CP  ++ E     +    G+  P  A  +                     +P+                      P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   54 MSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALLKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECP--SDDEDIDPCEPSSGGLANPTRAGGR---------------------EPY----------------------PGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1439          
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Match: sp|Q9Y4C0|NRX3A_HUMAN (Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4)

HSP 1 Score: 317.005 bits (811), Expect = 1.745e-86
Identity = 310/1324 (23.41%), Postives = 545/1324 (41.16%), Query Frame = 2
Query:  140 NTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTC------------YFDSNFCRYCSS-----------------------SKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKR---MENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN 3910
            +T S LSFQ K +   GL+ Y +D     F+ L L+   +V+L    F  D     +  +K+          + D S        WH +M++  +   +L  +   +   +       + +   + D +F GG+P  ++  A           P F G I  ++        L    +Q   DA   C              D +    CS+                       S++  +    TF  +  + Y    + I   +  I   FKT Q N  + + G               ++++ ++DG   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L +  +           G++    C  +  + P++F     Y+      + R    S  F+T + + LI +   +P  +K      +T  DF+++E+ D  LY  + + S       +    ++G  +++ +  +     I ++        S     ++ EG +Y+G L + +  L +   +W+ +L   + GCI  L ID     +  L +  ++  +G K+S    S   C + PC N  +C+  W++  CDCT T + G TC +EA I  ++G  +M+I  P    +E E+    F S+   GL+++T ++ S  T +LE  +  G + +++N           +G +     +   D++WH++++ RR K+LK+ +DD+  E                         GT + D +     N    +   KR   +    F+G++   ++NG  Y +L K       EL A     N++    + F +  SYL +  +  +    L FQ KT  P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S THS          D++    V  G  N +  G +++ G    Q + +   +   S+ GFQGC+AS  +N  +         DL+ +A +    ++  C          C  DSC+  G C Q W  ++CDCS TS+SG +C D   T  F K    ++Y +    + S   ++LA GF T T K   L+ I     L   L + I    + G I V +   T   S  E R  V DG YH+VRF ++   ATL++D+     H P G  Q T+ + +    +G  +      FQG +SGL  + + +L+   EN
Sbjct:   46 STRSDLSFQFKTNVSTGLLLYLDDGGVCDFLCLSLVD-GRVQL---RFSMDCAETAVLSNKQ----------VNDSS--------WHFLMVSRDRLRTVLMLDGEGQSGEL----QPQRPYMDVVSD-LFLGGVPTDIRPSA--LTLDGVQAMPGFKGLILDLKYGNSEPRLLGSRGVQM--DAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEDVSQDPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK-----------SADYVNLALKDGAVSLVINLGSG---AFEAIVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIADTKMKIYGEVVFK-CENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNA--AGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYGLLVATTSRDSADTLRLE--LDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVVRRGKSLKLTVDDDVAE-------------------------GTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMFNGLLYIDLCKNGDIDYCELKARFGLRNIIAD-PVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKV-------DTKVVTQVINGAKNLDLKGDLYMAGLA--QGMYSNLPKLVASRDGFQGCLASVDLNGRL--------PDLINDALHRSGQIERGC----EGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFST-TVKDGILVRIDSAPGLGDFLQLHI----EQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEHYPTG-RQLTIFNTQAQIAIGGKD--KGRLFQGQLSGLYYDGLKVLNMAAEN 1250          
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Match: sp|Q9CS84|NRX1A_MOUSE (Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 SV=3)

HSP 1 Score: 308.145 bits (788), Expect = 8.315e-84
Identity = 301/1312 (22.94%), Postives = 531/1312 (40.47%), Query Frame = 2
Query:  755 KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIK---------------EFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++                +    + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:  279 KEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1476          

HSP 2 Score: 138.272 bits (347), Expect = 2.717e-31
Identity = 187/873 (21.42%), Postives = 345/873 (39.52%), Query Frame = 2
Query: 1565 IEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDK-ENYVLNISTNYHDIEFEGSLYIGSLD-DTKILSVSHHVWSGILGTYFSGCIF--------SLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN-------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPL-LTIE---IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            I  R   L  S  +     + ++++  V++G  H++ +  +     + +D+ E   + + +   D+     L++G L  + +  ++   + S      F G I         +L +D   ++LD     NS   S C+  EE     VC N     G+C +  DQ  CDC++T F G  C+                      KE  IA F G ++       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R   NL+      +   N  L   +  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK+  P + I    + +  NV     I F + +S++ +PK N      + F  +T +P+GL+LF  G+               D+  +EM++G L+++ + GSG  +  +    +NDG W+ V             F+ DG+       + VNT    +   G         +++LGG  EN++ + F  E  T     G+ GCI   +++           KD+  + E      V  +C     +    C  + C   G C   W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++     S   L L ++   +K+  +   I++   ++ G  +      N+ D  +H VR  +   +  L +DD         G         I+   + +   ++ V S       +F G +  LT N +A +D  K
Sbjct:   82 ILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGGEVKLDDE-PPNSGGGSPCEAGEEGEG-GVCLNG----GVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTR---NLRQHSGIGHAMVNK-LHCSV-TISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVD------------FQRDGR----SGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQ--------SKDIRQMAEIQSTAGVKPSC---SKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLFAG-YNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPS-------NFIGHLQSLTFNGMAYIDLCK 891          
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Match: sp|A1XQX0|NR1AA_DANRE (Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 4.177e-83
Identity = 274/1137 (24.10%), Postives = 479/1137 (42.13%), Query Frame = 2
Query:  740 SKKCTKYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIK---------------EFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQ-----------PSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-ID----------------------------QNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN 3910
             K+  + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++                +    + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +          +G +    C  +  + PV+F     ++      + +    S  F+T + + L+ +            P S K +  D  F++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + GC+  L +D     +  + +   ++  G K S        C + PC N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T +Q S  T +LE  +  G + + +N           +G +   + +N  D++WH++++ RR K+LK+ +DD           +  I G    +    F N           V   I+   +        F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L FQ KT  P GL+L+ +G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  ++        + P+   SK GFQGC+AS  +N  +      L  D L  A +   V+  C          C  DSCS  G C Q W  +SCDCS TS+ GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G ID                            Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E 
Sbjct:  254 GKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFK-CENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVD--FFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVDFQRDGRSGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQSKDIRRIAEAQRAV--GVKPSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIQLPVVMHTEAEDVSLRFRSQRAYGVLMATTSQNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFSGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQL---EFHN-----------VETGIVTEKRYMPAVPSNFIGHLQGLSFNGMSYIDLCKNGDIDYCELNAMIGYRSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFFQFKTTSPDGLILYNRGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLYVGGVAKDMY-----KDLPKLVHSKEGFQGCLASVDLNGRLPD----LQSDALSTAGQ---VERGC----EGPSTTCQEDSCSNQGVCLQQWEGFSCDCSMTSYGGPLCNDPGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----ERGNIKVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPSGNIDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIFNSQTTIKIGGWEKGSR-PFQGQLSGLYYNGLKVLNMAAEG 1304          

HSP 2 Score: 145.591 bits (366), Expect = 1.907e-33
Identity = 189/922 (20.50%), Postives = 372/922 (40.35%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRR-RKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIE-----IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  +  L+ Y     +G     DF  + I +  L     +     + V S+  V++   H + L        +++D+E   + + +   D+     L++G +   ++ SV+  + S  +     + G I +L ++ S     +LI  +   S  C+        ++C N     G+C I  D+  CDC++T F G  C+                      +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  R++  +      +   N L   +  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK   P + +    + +  NV     + F + +S++ + K +      + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G         K++LGG  E+++ + F  E  T     G+ GC+   +++           KD+ + A  +  V    P    +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++   +Q+ +  L +E     +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         ++   V ++  M  V S       +F G + GL+ N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSAHGLLVY--FDDEGF---CDFLELLIHNGRLSLRFSIFCAEPATVFSDTAVNDSRWHAVTLRRNFKNTTLVVDEEIKWVEVKSKRRDMTVFSHLFLGGIP-PELRSVALRLTSSAIKDEVPYKGWITNLRVNGSE---PVLIGSDGVNSDICEAD------HICLNG----GVCSIVNDEPICDCSETGFQGKDCSEEEAYVGGLAHLMMGDQGKRKEREEYMATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQHSGIG-----HAMVNKLHCSV-TISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKLGDPKMKVSGVVAFKCENVATLDPVTFETPESFITLDKWSAKKAGSISFDFRTTEPNGLLLFSHGKPKPQQQKDPKSPKTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSIRTPYNAPGESEILDLDDKLYLGGLPEDRAGLIFPTEVWTALLNYGYVGCVRDLFMDGQ--------SKDIRRIAEAQRAVGVK-PSCSKEPPKQCLSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGVLMATT-SQNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFSGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNVETGIVTEKRYMPAVPS-------NFIGHLQGLSFNGMSYIDLCK 873          
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Match: sp|Q63372|NRX1A_RAT (Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 PE=1 SV=3)

HSP 1 Score: 305.449 bits (781), Expect = 5.950e-83
Identity = 300/1312 (22.87%), Postives = 531/1312 (40.47%), Query Frame = 2
Query:  755 KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI---------------KEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASR----STNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++                +    + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + +K+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G + N                VVDE L+               I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   +     S ++  +   P++    +   +   +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:  295 KEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVNKLHCSVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITHKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSE--------------------MSTSIMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1492          

HSP 2 Score: 138.272 bits (347), Expect = 3.108e-31
Identity = 187/889 (21.03%), Postives = 347/889 (39.03%), Query Frame = 2
Query: 1565 IEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDK-ENYVLNISTNYHDIEFEGSLYIGSLD-DTKILSVSHHVWSGILGTYFSGCIF--------SLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN--------------------------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN-------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFG---------KMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPL-LTIE---IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            I  R   L  S  +     + ++++  V++G  H++ +  +     + +D+ E   + + +   D+     L++G L  + +  ++   + S      F G I         +L +D S ++LD     NS   S C+  +E     VC N     G+C +  DQ  CDC++T F G  C+                                      KE  IA F G ++       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R   NL+      +   N  L   +  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK+  P + I    + +  NV     I F + +S++ +PK N      + F  +T +P+GL+LF  G+               D+  +EM++G L+++ + GSG  +  +    +NDG W+ V             F+ DG+       + VNT    +   G         +++LGG  EN++ + F  E  T     G+ GCI   +++           KD+  + E      V  +C     +    C  + C   G C   W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  L++     S   L L ++   +K+  +   I++   ++ G  +   +  N+ D  +H VR  +   +  L +DD         G         I+   + +   ++ V S       +F G +  LT N +A +D  K
Sbjct:   82 ILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDGSEVKLDEE-PPNSGGGSPCEAGDEGDG-GVCLNG----GVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKEDNNVEGLAHLMMGDQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTR---NLRQHSGIGHAMVNK-LHCSV-TISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVD------------FQRDGR----SGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQ--------SKDIRQMAEIQSTAGVKPSC---SRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSY-DGSMFMKIQLPVVMHTEAEDVSLRFRSQ-RAYGILMATTSRDSADTLRLELDAGRVKLTVNLDCIRINCNSSKGPETLF-AGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHTRLEFHNIETGIITERRYLSSVPS-------NFIGHLQSLTFNGMAYIDLCK 907          

HSP 3 Score: 55.0694 bits (131), Expect = 7.551e-6
Identity = 57/240 (23.75%), Postives = 92/240 (38.33%), Query Frame = 2
Query: 2738 PKVNIFGDFRLEFQMKTLQPSGLLLFLQGES-NDYLILEMV-NGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLE--NQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDS----CSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKH 3433
            PK N   +  + FQ+KT    GL+L+   E   D+L L +   G L + ++        +     +NDG WHSV+I R    T  +  R + K       V V +   +   F  + +GG       + +     + R +  F+G I    VN+S +          L     +  +DE  P++          +     C  GG C+    +  CDCS T F G  C       + + H
Sbjct:   44 PKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLYIDRAEAKW------VEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQA----------LPVDGSEVKLDEEPPNSGGGSPCEAGDEGDGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEDNNVEGLAH 267          
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Match: A0A2T7PG26 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07803 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.218e-104
Identity = 325/1307 (24.87%), Postives = 598/1307 (45.75%), Query Frame = 2
Query:  836 SINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDD-FQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFK--THKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT-KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQL--DLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWID-----------------DNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQ-----FFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDV-STTAQFVKHPSYLVYKYSIIKKH--SINQ--LAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNS--FQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCG---GAFMLIALSCLI---------YRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            SI+  F+TK  +  LFY G++             ++++ I DG   + I+    + S    R+   +       D+ WH V ++    +I + +D  +Q++     N +L  +  +  A + +         LP     + FRGCM+++    ++V L++ E+   +       G +  D C E+   +P++FT    YL    + S    + SL+F+  T +   ++ Y   +  G   + D +++E+ D  L+  I + S       S   V++G  H +   +      I +D +    +  ++    + +GS +IG +  T + + +   +W+G LG  + GC+  + +D   + L     I+  + ++  C+  E       C ++PC ++G C   W++ +CDC  T F  + C   A    F+G QF+++  P    ++ E+  L F++  PNGL+  T ++ +   DK+E+++++GSI++ ++ G G+K      +  DD+WH+  +KRR + +++ ID                  + +    FL    P   + +L         T+I   +++L    + ++G V + +N+      F+G M  FI+N   +F++A+      IE+TA L     +    + F ST +Y V+P++ I   F + FQ+KT +  GLL++  G   D+  +EM  G L+ +YN G+G +R + + +  L+D  WH V+++R  ++T+    RVD K      D    +  ++F+  G +++GG  +     T  +  P+   ++ GF GCI S Y+N  ++        ++ ++AN  H   E+  D      + C  DSC+ GG+C Q W  +SCDC  TSFSGP C+ V STT +F   P Y + K++   ++  S N+  LA GF+  TR    ++  I + +    + +E+    + G I   Y   T  +   E    V DG YH+VRF +    +T+++D+L  +  +P G   +T  ++  + I G  E +   S  FQG ISGL +N I ILD  ++  +  I L       +V +           Q +  P+N  T++    I      CP   E +           I+ P V  K        + +  ++   +  N P  +     +Q T D  ++  +  PK E + K   + N  L +  S G   G  + IA+S L+         Y+  ++DEG+Y V E +         +         ++ N +LL+     ++  +K+  + KEWYV
Sbjct:  280 SISLDFRTKHPDGLLFYTGNV-----------KDYLNIAIRDGAIILAIN----LGSGSLEREIRPSG--PRFDDNLWHQVVVRREAREISLEVDGIYQEKGSTTGNFKLLSSKALYVAGSPD------TANLPGSRVNANFRGCMRKVRYRADSVELDLTELARAEHALLKVIGGVIFDKCQELVDSRPITFTTPESYL-TIPVWSAGPERGSLAFQFQTVEQHGVLLYSTGAASG---NPDVFALELLDGYLHLVINMGSEPIRLKASRQPVTDGSPHMVYFEYAANRGYISVDGQKETFSTFSHLDRFDLQGSFFIGGISKTAEEIPLPTEMWAGTLGYGYVGCLQDMVVDGGRVDLVRAAQIQGVAGVAEYCQAMEPH-----CTSRPCMHQGQCTEGWNRFTCDCRATGFIDSVCQTAAATLRFDGKQFVKVTVPEESHTQAEDISLRFRTMHPNGLLFMTTSERA--EDKMELYLKSGSIFLGVDVGSGHKVLSVGHSLNDDRWHTAYIKRRAQTVELKIDVQRPVTGRHSPCDSFVFQSLHLTKTFLCNRAPPCDLAFL---------TEISRRAAELEFRRV-NIGDVLQDDNKSNAFSGFIGSMQQFIFNRNQFFDMARSE---KIEVTAKLSTNGHVMHDPVTFKSTDAYAVLPRLQIHDKFSISFQLKTTETDGLLMYNPGRGQDFFAMEMTGGFLYYVYNMGAGTQRIRANVNEKLSDNKWHEVQLLR--TETYKQLLRVDDKT--PTVDDLSGSSAIHFDLQGHLYIGGVRK-----TMYHTLPKKVEARFGFMGCIDSLYLNGYMA--------NIHRDANPIH---ESVVDGCQAPASQCQNDSCANGGRCVQQWNSFSCDCDMTSFSGPTCQAVESTTYRF--GPGYGLIKFAHPAENLPSTNRENLALGFK--TRSSDAVLVRIDSATYDDYIELEL----NKGNIVAVYNMGTMDYPIGEMFDKVNDGKYHVVRFTRSGPNSTIQVDNLMMQTKMPRGQQAHTFNNQAFVYIGGKQEKNKTVSRPFQGTISGLVLNGIKILDLARQG-DKRISLEGNVTHQIVHSIS--------IQKQTTPQNGVTDEI---IFSGGGPCPYDDEDDCTATGSGTDDDIITPSVIIKTTPPPPTTTTS--DKRLCKEENCP--HSASELEQPTEDIYVSTPE-QPKEEVSEKPTGDTNKTLSSGGSSGLNLGLIIGIAVSVLVAVVILCIALYKFRSRDEGTYKVDESQ---------NFTSLDSKKSQQGNGTLLSSSDTGKRGGKKK--DVKEWYV 1483          

HSP 2 Score: 117.472 bits (293), Expect = 2.050e-22
Identity = 126/502 (25.10%), Postives = 208/502 (41.43%), Query Frame = 2
Query: 1991 PC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAII--AEFNGYQFMRIKFPNTYKSEVEN---FYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGN--KKFKTLENCFDDK-WHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGR----NYFELAKKLSPLNIELTASL--QPANVMRQFAINFHSTKSYLVIPKVNIFGDFR--LEFQMKTLQPSGLLLFLQGESN---DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVI--LYKDLLKEANEKHY--VDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQF 3424
            PC N G+C        CDC +T F G  C+ E I   A F G Q+            V N     L F++K P+GL+  T N      D L I +++G+I + +N G G+  ++ +     FDD  WH + ++R  + + + +D  Y E  +    +  ++  K L +  + D        ++ L  + +          N  F G M    Y       +  ELA+    L   +   +  +   ++    I F + +SYL IP V   G  R  L FQ +T++  G+LL+  G ++   D   LE+++G LH++ N GS   R  +    + DG  H V      ++ +     VDG+ +              F+H  +  L G      I     E P     + G +   YV      D V+     DL++ A  +    V E C       E +C+   C   G+CT+ W +++CDC +T F    C+  + T +F
Sbjct:  218 PCLNGGVCLTTNSGLVCDCARTEFKGERCDLEKIPSDATFFGAQYFTYNLSGQGDGLVSNRDSISLDFRTKHPDGLLFYTGN----VKDYLNIAIRDGAIILAINLGSGSLEREIRPSGPRFDDNLWHQVVVRREAREISLEVDGIYQEKGS-TTGNFKLLSSKALYVAGSPD--------TANLPGSRV----------NANFRGCMRKVRYRADSVELDLTELARAEHALLKVIGGVIFDKCQELVDSRPITFTTPESYLTIP-VWSAGPERGSLAFQFQTVEQHGVLLYSTGAASGNPDVFALELLDGYLHLVINMGSEPIRLKASRQPVTDGSPHMVYFEYAANRGY---ISVDGQKETFS----------TFSHLDRFDLQGSFFIGGISKTAEEIPLPTEMWAGTLGYGYVG--CLQDMVVDGGRVDLVRAAQIQGVAGVAEYC----QAMEPHCTSRPCMHQGQCTEGWNRFTCDCRATGFIDSVCQTAAATLRF 676          
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Match: V4AS84 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_141333 PE=4 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 1.864e-99
Identity = 314/1153 (27.23%), Postives = 536/1153 (46.49%), Query Frame = 2
Query: 1229 LPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDY--LQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLD--KENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSG----CKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF---DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGG---LNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHY-VDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSS---KNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNEN---TIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            LP     S F+GCM+++    ++V L++ ++           G++  + C E+    P++F     +  L ++ + ++++A  +  F+T + + +I Y      G+ T TDF++IE+ D  LY  + L S       S   V++G  H + L ++ P   I LD  KE Y   + ++   ++  G L++G + +D    ++   +W+G+LG  + GC+  L I+ +  ++DL+      ++ G    C+  E       C + PC ++G+C   W++  CDC  T F  + C   +    F+G QF+++  P    +E E+  L F++  PNGL+  T +    TTD +E+++++GSI + ++    +  F++L       DD+WH++ +KRR + +++ ID  +      L  D   +  + +      D G +++D +S         +G     E+  F+G M  FI+N   +FELAK     NI++TA     + + +  + F S  +Y  +P ++ +  F L FQ KT + SGL+LF  G+  D+  +E+  G L+ IYN G+G +R  I+    LN+  WH V+++R   + H    R+    DD+   V  N GG   L+F+  G + +GG  +     T  +  P+   S+ GF GC+ S  +N  +         +L+KEA+  H  + E C          C +DSC   G+C Q W  Y CDC STS+SG  C++ ST+ +F      L + Y   ++     + LA GF+T ++  A L+ I    S +    +E+++VN  G I V Y   T  H   E    V DG YH++RF +    +T+++DDL  +   P G  Q  V + +    VG  +         F+G ISGL +N I ILD L EN +S I    +    LV +F     D+ L +    P+ P    K  R+   + +    T  EK Q      K  V   + F        HS    ++  S     PF  L                   PK +N   ++     +NI LI   + G    L+ L   +Y+  ++DEG+Y V E +                +   + N +LL    + ++ K+K   + KEWYV
Sbjct:   18 LPGSRVKSNFKGCMRKVQYQADSVNLDLTDLAKTSHGLISVVGEVLFNRCQELVESHPITFLTPKSFITLPSWDV-TLKRASIAFQFQTTEPNGVILYN----SGLGTYTDFFAIELLDGHLYLVVDLGSGTIKVKASKIPVNDGKPHEVYLDYQGPQGYITLDGTKEPYSSTVESDL--LQLGGKLFVGGINEDVDSSTLPKEMWAGMLGHGYVGCLQDLVINGN--KMDLVAAAALQLTEGIAEYCRRMEPQ-----CLSYPCMHQGVCVEGWNRFVCDCRATGFIDDVCQTASATLRFDGTQFVKVSMPEESLTEAEDISLRFRTMHPNGLLFMTTS--VKTTDIMELYLESGSIKLNVDLIILDILFQSLTVGHVLNDDRWHTVFIKRRAQTIEIAID-GHRPVTGELPGDAEELEFRNI------DVGHEMKDENS---------VG-----EHSGFIGSMQQFIFNKNYFFELAKSGQIENIDVTAKFSSDDYVVRDPVTFKSASAYATLPTLHAYKKFSLSFQFKTTEESGLVLFNSGQGQDFFCIELHGGYLYYIYNMGAGAQRIMINSKDKLNNNKWHEVRLLR--PELHKQLIRI----DDNTPTVD-NLGGSQALHFDLEGSLFVGGVRK-----TMYHSLPKIITSRHGFLGCLGSLDLNGYLP--------NLVKEADTIHQSIVEGC----KGPTTQCQVDSCGNRGRCVQQWNSYVCDCDSTSYSGETCKEESTSYRFGPGEGLLTFSYPAYQRPDTVGDNLALGFKTFSKD-AVLVRI---DSGNFDDYVEMELVN--GNIFVVYNMGTTDHPIGEIFKQVNDGKYHVIRFTRSGPNSTIQIDDLMMQTKNPKG-QQLGVFNNQAYVYVGGKKTEDGMIARPFEGTISGLVMNGIHILD-LAENNDSRI--TKEKMMKLVHSFY----DEVLLKPTSVPEPP----KKERV---KSKSTRQTSEEKNQTTP---KLGVTDDIIFSGAGAG-CHSDDE-DDCTSVGGATPFYPL--------------QSSFPPKGDNSKESVGGVATLNIGLIVGIAAGVLVALLILIFALYKFRSRDEGTYKVDESQ----------NFSYLESKKPQGNGALLGANDSNKRGKKK---DVKEWYV 1056          

HSP 2 Score: 108.227 bits (269), Expect = 1.001e-19
Identity = 135/600 (22.50%), Postives = 248/600 (41.33%), Query Frame = 2
Query:  674 QFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMV-TKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHD---------IEFEGSLYIGSLDDT------KILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKK----NSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFN-GYQFMRIKFPNTYKSEV--ENFYLMFKSKLPNGLILSTQNQFSGT-TDKLEIFMQNGSIYILLNFGRGNKKF-KTLENCFDDKWHSIKMKRRRKNLKVWIDD 2398
            +F  D   T + D + C+  S++        L FD    +  + P + ++E    I+ +F+T   N  LF   S         +  T  + +Y+E G   +      +VD       F   ++     DD+WH V IK     I I +D      + ++ +       ++F       +   +  + ++   S F G M++   ++N       E+  + ++ N     K +SD   +     PV+F   S Y     + + +K   S  FKT +   L+ +     +      DF+ IE+    LY+   + +    ++M N   S   L+N   H E+ ++R  L K+   ++ +T   D          + EGSL++G +  T      KI++  H          F GC+ SL ++     L  L+K+    + SI  GCK       ++ C N+    G C  +W+   CDC  T+++G TC +E+    F  G   +   +P   + +   +N  L FK+   + +++      SG   D +E+ + NG+I+++ N G  +    +  +   D K+H I+  R   N  + IDD
Sbjct:  280 RFVCDCRATGFID-DVCQTASAT--------LRFDGTQFVKVSMPEESLTEA-EDISLRFRTMHPNGLLFMTTS---------VKTTDIMELYLESGSIKL------NVDLIILDILFQSLTVGHVLNDDRWHTVFIKRRAQTIEIAIDG----HRPVTGELPGDAEELEFRNIDVGHEMKDENSVGEH---SGFIGSMQQFIFNKN----YFFELAKSGQIENIDVTAKFSSD---DYVVRDPVTFKSASAYATLPTLHAYKKFSLSFQFKTTEESGLVLFNSGQGQ------DFFCIELHGGYLYYIYNMGAGA-QRIMIN---SKDKLNNNKWH-EVRLLRPELHKQLIRIDDNTPTVDNLGGSQALHFDLEGSLFVGGVRKTMYHSLPKIITSRHG---------FLGCLGSLDLNG---YLPNLVKEADTIHQSIVEGCKGPTTQCQVDSCGNR----GRCVQQWNSYVCDCDSTSYSGETCKEESTSYRFGPGEGLLTFSYPAYQRPDTVGDNLALGFKTFSKDAVLVRID---SGNFDDYVEMELVNGNIFVVYNMGTTDHPIGEIFKQVNDGKYHVIRFTRSGPNSTIQIDD 810          
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Match: A0A341C607 (neurexin-1 isoform X16 OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=NRXN1 PE=4 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 2.712e-98
Identity = 349/1488 (23.45%), Postives = 605/1488 (40.66%), Query Frame = 2
Query:  149 SSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT--KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEF-ASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            S +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+  K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N G+G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   AS       E + P    + +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   52 SEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALLVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFVSLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSRETAKPCLSNPCKNSGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPLVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS--------------------IMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1399          
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Match: A0A2Y9R6E5 (neurexin-1 isoform X9 OS=Trichechus manatus latirostris OX=127582 GN=LOC101342964 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 3.234e-98
Identity = 350/1488 (23.52%), Postives = 604/1488 (40.59%), Query Frame = 2
Query:  149 SSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQF-----QSDAMNTCY----------FDSNFCRY--------CSSS----KKCT--KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEF-ASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            S ++FQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L L    ++       S   + C            +   C          CS +    K C+  K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N GIC+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N G+G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   AS       E + P    + +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   52 SEMTFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALLLDSGEVKLDDEPPHSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEIQST--AGVKPSCSRETAKPCLSNPCKNNGICRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAILVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAVQSEMSTS--------------------IMETTTTLATSTARRG---------KPPTKEPVSQTTDDILVASAECPSDDEDIDPCEPSSANPTRAGGRESYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1399          
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Match: A0A2Y9SE17 (neurexin-1 isoform X16 OS=Physeter macrocephalus OX=9755 GN=NRXN1 PE=4 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 4.152e-98
Identity = 349/1488 (23.45%), Postives = 605/1488 (40.66%), Query Frame = 2
Query:  149 SSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEK-VNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNT-----CY----------FDSNFCRY--------CSSS----KKCT--KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDN--ETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEF-ASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            S +SFQ+K  +  GL+ Y +D     F+ L L    +++L   +F  +                   T + D    DG    WH++ I    ++  L  +Q   K V +       KR D  +   +F GGLP +L+  A      S      F G I  VR+     L +    ++   +  N+     C            +   C          CS +    K C+  K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G +    C  +  + P++F     ++      + +    S  F+T + + LI +       Q  +K       DF++IE+ D  LY  + + S           V++G  +++    +     I ++              ++ +  LY+G L + K  L     VW+ +L   + GCI  L ID     +  + +  S+  +G K S    +   C + PC N G+C+  W++  CDC+ T + G +C +EA +  ++G  FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N G+G +      N  D++WH++++ RR K+LK+ +DD                  +  + G    + T ++  +   +   II   +        F+G++    +NG  Y +L K       EL A     N++    + F +  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH +++ G+G    K S +  LND  WH+V I R  S  H+          D++    +  G  N +    +++GG  +     T+ +  +   +K GFQGC+AS  +N  +         DL+ +A    + +             C  DSCS  G C Q W  +SCDCS TSFSGP C D  TT  F K    + YK+    + S   ++LA GF T  +K A L+ +  +  L   L + I      G I V++   T   +  ES   + DG YH+VRF +    ATL++D        P G  Q T+ + +   I+G  E      FQG +SGL  N + +L+   EN  +  ++ N      VP+     S  +  QSE                        I E           +G         KP T+E  S+T  +   AS       E + P    + +       +  P +   I+ + +    ++   +     +LI L  + Y+   +DEGSY+V E R
Sbjct:   52 SEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPA-----------------TLLADTPVNDG---AWHSVRIRRQFRNTTLFIDQVEAKWVEV-----KSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQALPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFK-CENVATLDPITFETPESFVSLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQST--AGVKPSCSRETAKPCLSNPCKNSGMCRDGWNRYVCDCSGTGYLGRSCEREATVLSYDGSMFMKIQLPLVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLE--LDAGRVKLTVNLGKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDD------------------QQAMTGQMAGDHTRLEFHN---IETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIAD-PVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKI-------DTKITTQITAGARNLDLKSDLYIGGVAKE----TYKSLPKLVHAKEGFQGCLASVDLNGRL--------PDLISDA---LFCNGQIERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFST-VQKEAVLVRVDSSSGLGDYLELHIH----QGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAG-RQLTIFNSQATIIIGGKE--QGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTS--------------------IMETTTTLATSTARRG---------KPPTKEPISQTTDDILVASAECPSDDEDIDPCEPSSANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM-YKYRNRDEGSYHVDESR 1399          
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Match: ENSAMXT00000000309.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10525143:11115194:1 gene:ENSAMXG00000000283.2 transcript:ENSAMXT00000000309.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 317.39 bits (812), Expect = 6.980e-88
Identity = 315/1368 (23.03%), Postives = 560/1368 (40.94%), Query Frame = 2
Query:   92 FIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRY--------CSSS----KKCT------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QP-----SSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDD--------NYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-IDQ--------------NTVVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN 3910
            F G        P  N    S +SF +K     GL+ Y +D     F+ L L+++ K+ L   +F                   + +T   D+   D    +WH + I  + K+  L  ++  +   +       KR D  +   +F GG+P +L+  A      ++  +  F+G I+ +++       L    +   +    T   +   C          CS +    K C+            K EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + L+ +   +P      +K  +    DF++IE+ D  LY  + + S        N  V++G  +++    +     I ++              ++ + +LY+G L + K  L     VW+ +L   F GC+  L ID      D+     S  ++G K+S    +   C + PC N G+C+  W++  C+C+ T F G +C ++A I  ++G +FM+I+ P    +E E+  L F+S+   G++++T ++ S  T +LE  ++ G + + +N           +G +     +N  D++WH++++ RR KNL++ +DD           EF+N   ++  I+  K  +               S + SN               F+G++   ++NG  Y +L K       EL A +   +++    + F S  SY+ +  +  +    L FQ KT    GL+L+  G+ ND++++E+V G LH + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G +++GG  +         E P+   +K GFQGC+AS  +N  +         DL+ +A      ++  C          C  DSC+  G C Q W  +SCDCS TSF GP C D  TT  F +    + Y +    + S   ++LA GF T   K A LI +  +  L   L + I    + G + V +   T   +  E    V DG YH+V+F +    ATL++DDL      P G ID                 VVDE L+                +G  +     SFQG +SGL  N + + +   E 
Sbjct:   30 FSGAEGQWAAFPMWNACCESEMSFNMKTKASQGLLVYFDDEGFCDFLEL-LMNNGKLNLRFSIF-----------------CAEPVTVFSDVVVND---SQWHGVTIKRNFKNTTLVVDREVKWAEV-----KSKRRDMTVFSRLFLGGIPPELRTVALRLTSDAAKEQVPFNGWITDLKVNNSVPAILTSGGVDNNACGSETMCLNGGVCSVVNDKPTCDCSETGYQGKDCSEGLAHMMMGDQGKEEYVATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRVALQGDPKMKIHGVV-AFKCENVATLDPITFETPEAFITLHKWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAINKKVNDGEWNHVDFQRDGRAGTISVNTIRTPYQAPGESEILDLDDNLYLGGLPENKAGLVFPTEVWTALLNYGFVGCVRDLFIDGQ--SKDVRRMAESQKATGVKSSCSKEAPKQCISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSYDGSKFMKIQLPVAMHTEAEDVTLRFRSQRAYGVLMATTSRDSADTLRLE--LETGRVRLTINLDCIRINCTTSKGPETLFAGQNLNDNEWHTVRVMRRGKNLQLSVDDLQTITGDHTQLEFHN---IETGIVTEKRYL---------------STVPSN---------------FIGHLQSLVFNGMAYIDLCKNGDIDYCELNAMIGFKSIIAD-PVTFKSRSSYISLTTLQAYYSMHLFFQFKTTSSDGLILYNSGDGNDFIVVELVKGYLHYVADLGNGAHLIKGNSNKPLNDNQWHNVMISRDTNNLHTVKI-------DTKVTTQTTMGAKNLDLKGDLYIGGVAKEMY-----KELPKLVHAKEGFQGCLASMDLNGRLP--------DLISDAITCVGQIERGC----EGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTSFGGPLCSDAGTTYIFGRDGGRITYTWPPNDRPSTRADRLALGFSTQL-KDALLIRVDSSSGLGDYLKLHI----EKGNVAVIFNVGTDDINIEEKAKFVNDGKYHVVKFTRSGGNATLQVDDLPVIERYPTGNIDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWDRDRSRSFQGQMSGLYYNGLKVFNMAVEG 1275          

HSP 2 Score: 145.976 bits (367), Expect = 1.538e-34
Identity = 188/911 (20.64%), Postives = 363/911 (39.85%), Query Frame = 2
Query: 1373 ICMEMFPIKPVSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTY--FSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIK-YLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIY-NGRNYFELAK---KLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN--------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK---------MHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLL----TIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDL----SDRIHVP-DGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            +C  +     + F+G      AF +  +  +++ S + KT  S  L+ Y     +G     DF  + + +  L     +       V S+  V++   H + +        +++D+E     + +   D+     L++G +   ++ +V+  + S        F+G I  L +++S   +         ++SG   +    S  +C N     G+C +  D+ +CDC++T + G  C+            KE  +A F G ++       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  + + + +D        + + D  ++G   +  +G +        D     VSN+              FMG +   +Y N     EL++   +  P + I    + +  NV     I F + ++++ + K N      + F  +T +P+GLLLF  G                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VNT    +   G+         ++LGG  EN++ + F  E  T     GF GC+   +++           KD+  + E+ +   V  +C     +    C  + C   G C + W +Y C+CS T F G  CE  +T   +     ++  +  +        +   F++  R +  L++     S   L     T  +++  +   I++   T+ G  +    + N+ D  +H VR  +      L +DDL     D   +    I+   V ++  ++ V S       +F G +  L  N +A +D  K
Sbjct:   18 VCTLVDAGASLKFSGAEGQWAAFPMWNACCESEMSFNMKTKASQGLLVY--FDDEGF---CDFLELLMNNGKLNLRFSIFCAEPVTVFSDVVVNDSQWHGVTIKRNFKNTTLVVDREVKWAEVKSKRRDMTVFSRLFLGGIP-PELRTVALRLTSDAAKEQVPFNGWITDLKVNNSVPAI---------LTSGGVDNNACGSETMCLNG----GVCSVVNDKPTCDCSETGYQGKDCSEGLAHMMMGDQGKEEYVATFKGSEYFCYDLSQNPIQSSSDEITLSFKTMQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNDWHDVKVTRNLRQVTISVD-GILTTTGYTQEDYTMLGSDDFFYVGGS----PSTADLPGSPVSNN--------------FMGCLKEVVYKNNDVRLELSRVALQGDPKMKIHGVVAFKCENVATLDPITFETPEAFITLHKWNAKKTGSISFDFRTTEPNGLLLFSHGRPKQQTKEAKSPLTLKVDFFAIEMLDGHLYLLLDMGSGTTKTRAINKKVNDGEWNHVD------------FQRDGRA----GTISVNTIRTPYQAPGESEILDLDDNLYLGGLPENKAGLVFPTEVWTALLNYGFVGCVRDLFIDGQ--------SKDVRRMAESQKATGVKSSC---SKEAPKQCISNPCLNNGVCREGWNRYVCECSGTGFLGRSCERDATILSY-DGSKFMKIQLPVAMHTEAEDVTLRFRSQ-RAYGVLMATTSRDSADTLRLELETGRVRLTINLDCIRINCTTSKGPETLFAGQ-NLNDNEWHTVRVMRRGKNLQLSVDDLQTITGDHTQLEFHNIETGIVTEKRYLSTVPS-------NFIGHLQSLVFNGMAYIDLCK 843          

HSP 3 Score: 104.76 bits (260), Expect = 6.232e-22
Identity = 128/565 (22.65%), Postives = 224/565 (39.65%), Query Frame = 2
Query: 1058 DDKWHNVQIKEFRNDIVITLDDFQK--------EFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGL-NSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDT--KILSVSHHVWSGILGTYFSGCIFSLTIDDS-PIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKF---PNTYKS-EVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDD-KWHSIKMKRRRKNLKVWIDD----NYYEFNNFLEMDMPII--GIKYLIIGSAFDNGTDIQDSSSKLV---SNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQ 2674
            D++WH V++     ++ +++DD Q         EF N+    +T+  ++    +T P  +    Q   +  ++    C         N  ++  E              LN+ I  +     PV+F  +S Y+    +++         FKT  SD LI Y            DF  +E+    L++   L N     K  SN  +++   HN+++  +   +  +          +    +++ +G LYIG +     K L    H   G     F GC+ S+ ++   P  +   I     I  GC+        + CANQ    G+C  +W+  SCDC+ T+F G  C+       F G    RI +   PN   S   +   L F ++L + L++   +  SG  D L++ ++ G++ ++ N G  +   +      +D K+H +K  R   N  + +DD      Y   N     + I    I Y  +G   D    + D   +L    S   I +G   R  ++ F G M    YNG   F +A +  P NI +  S++
Sbjct:  769 DNEWHTVRVMRRGKNLQLSVDDLQTITGDHTQLEFHNIETGIVTEKRYL----STVPSNFIGHLQSLVFNGMAYIDLC--------KNGDIDYCE--------------LNAMIGFKSIIADPVTFKSRSSYISLTTLQAYYSMHLFFQFKTTSSDGLILYNSGDGN------DFIVVELVKGYLHYVADLGNGAHLIKGNSNKPLNDNQWHNVMISRDTNNLHTVKIDTKVTTQTTMGAKNLDLKGDLYIGGVAKEMYKELPKLVHAKEG-----FQGCLASMDLNGRLPDLISDAITCVGQIERGCEGPSTTCQEDSCANQ----GVCLQQWEGFSCDCSMTSFGGPLCSDAGTTYIF-GRDGGRITYTWPPNDRPSTRADRLALGFSTQLKDALLIRVDSS-SGLGDYLKLHIEKGNVAVIFNVGTDDINIEEKAKFVNDGKYHVVKFTRSGGNATLQVDDLPVIERYPTGNIDNERLAIARQRIPYR-LGRVVDEW--LLDKGRQLTIFNSQTTIQIGGWDRDRSRSFQGQMSGLYYNGLKVFNMAVEGDP-NIRIEGSVR 1286          
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Match: ENSAMXT00000011949.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20986441:21378525:-1 gene:ENSAMXG00000011628.2 transcript:ENSAMXT00000011949.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 4.816e-84
Identity = 336/1507 (22.30%), Postives = 597/1507 (39.62%), Query Frame = 2
Query:  161 FQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFD-----SNFCRY--------CSSS----KKCT--------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY--------QPSSKKGIHT-DTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEA-NEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQC-PGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPF--EYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDR 4453
            F +K  +  GL+ Y +D     F+ L L+ + ++ L   +F  +                   T + D +  D     WH + +  + K+  L  +   + V +       KR D  +   MF GG+P +L+  A      S   +  + G I+ +++         P ++       N C  D        C          CS +    K C+              + EY+ TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + PV+F     ++      + +    S  F+T + + L+ +        Q    KG  T   DF++IE+ D  LY  + + S        N  V++G  +++    +     I ++      N       ++ +  LY+G L +D   L     VW+ +L   + G I  +      +    L+                 +L   +N   N G C+  W++  CDC+ T + G +C ++A I  ++G +FM+IK P    +E E+  L F+S+   G++++T ++ S  T +LE  +  G + + +N           +G +     +N  D++WH++++ RR K+LK+ +DD           +  I G    +     + G   +      V ++              F+G++    +NG +Y +L K       EL A +   +++    + F S  SY+ +P +  +    L  Q KT  P GL+L+ +G+ ND++++E+V G +H + + G+G +  K + +  LND  WH+V I R  +  H+          D++       G  N +  G + +GG  +         + P+   SK GFQGC+AS  +N  +         DLL +A      V+  C          C  DSCS  G C Q W  ++CDCS TSF GP C D  TT  F +    +VY +    + S   ++LA GF T  +K A L+ +  +  L   L ++I    + G I+V +   T   +  E+   V DG YHIVRF +    ATL++DDL      P G  Q T+ + +    +G  E  S+  FQG +SGL  N + +L+   E                 PN    R + S +   + P +  T Q +      R +  P +T+                        N Q K + T+ ++    S   P   E + P +  +            PK    +    +    ++       A  ++ L   +Y+   +DEGSY+V E R
Sbjct:   53 FNMKTKSSHGLLVYFDDEGFCDFLEL-LIHNGRISLRFSIFCAEPA-----------------TVLSDTAVND---SRWHAVTVRRNFKNTTLVVDDEIKWVEV-----KSKRRDMTVFSPMFLGGIPPELRSVALRLTSASIKDQVPYKGWITNLKVNDSE-----PAIVSSDGITSNVCEADHVCLNGGVCSIVNDQPICDCSETGFQGKDCSEGLAHLMMADQGMVREEYVATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDAKMKVSG-IVAFKCENVATLDPVTFETPESFVTLSKWTAKKAGSISFDFRTTEPNGLLLFSHGKPKQQQQKDPKGPKTMKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISVNSVRTPYNAPGESEILDLDDVLYLGGLPEDRAGLVFPTEVWTALLNYGYVGYIRRIAEAQRAVGSSFLV-----------------ALGKKSNPCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSYDGSKFMKIKLPVVMHTEAEDVSLRFRSQRAYGVLMATTSRNSADTLRLE--LDGGRVRLTVNLDCIRINCTTSKGPETIFAGQNLNDNEWHTVRVVRRGKSLKLMVDD-------LQPSEGQITGDHTQLEFHNIETGIITEKLYMPAVPSN--------------FIGHLQGLGFNGMSYIDLCKNGDIDYCELNAMIGYKSIVAD-PVTFKSRSSYVTLPTLQAYYSMHLFLQFKTTSPDGLILYNRGDGNDFIVVELVKGYMHYVSDLGNGAHLIKGNSNTPLNDNHWHNVMISRDTNNLHTVKI-------DTKITTQTTMGAKNLDLKGDLFVGGVSKEMY-----KDLPKLVHSKEGFQGCLASVDLNGRL--------PDLLSDALTTMGQVERGC----EGPSTTCQEDSCSNQGVCLQQWEGFTCDCSMTSFGGPLCNDAGTTYIFGRDGGLIVYTWPPNDRPSTRADRLAVGFSTQ-QKDAVLVRVDSSSGLGDYLQLQI----EKGNIRVVFNVGTDDINIEETSKFVNDGKYHIVRFTRSGGNATLQVDDLPVIERYPTG-RQLTIFNSQTTIKIGGWERGSR-PFQGQLSGLYYNGLKVLNMAAEGD---------------PNV---RVEGSARLVGDLPSSSITPQSSASATGNRSETSPSLTDI-----------------TTTTASNRQGKQTTTSQDDLLVASAECPSDDEDIDPCDPTSGGLEQCGRGGKKPKKSPEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYHVDESR 1392          

HSP 2 Score: 132.88 bits (333), Expect = 1.373e-30
Identity = 184/912 (20.18%), Postives = 360/912 (39.47%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILG--TYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN--------------KEAIIAEFNGYQFMRIKF-PNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIY-NGRNYFELAKKL----SPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN---------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK---------MHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPL-LTIE---IKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG---------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  S  L+ Y     +G     DF  + I +  +     +     + V+S+  V++   H + +        +++D E   + + +   D+     +++G +   ++ SV+  + S  +     + G I +L ++DS   +         +SS   TS    + +VC N     G+C I  DQ  CDC++T F G  C+              +E  +A F G ++      PN  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y N     EL++      + + +    + +  NV     + F + +S++ + K        + F  +T +P+GLLLF  G+                 D+  +EM++G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + VN+    +N  G+         ++LGG  E+++ + F  E  T     G+ G I            + ++   L K++N                        C   G C + W +Y CDCS T + G  CE  +T   +     ++  K  ++       ++  F++  R +  L++     S   L L ++   +++  +   I++   T+ G  +    + N+ D  +H VR  +   +  L +DDL        G         I+   + ++  M  V S       +F G + GL  N ++ +D  K
Sbjct:   28 MEFTGAEGQWARFPMWNACCESEMSFNMKTKSSHGLLVY--FDDEGF---CDFLELLIHNGRISLRFSIFCAEPATVLSDTAVNDSRWHAVTVRRNFKNTTLVVDDEIKWVEVKSKRRDMTVFSPMFLGGIP-PELRSVALRLTSASIKDQVPYKGWITNLKVNDSEPAI---------VSSDGITSNVCEADHVCLNG----GVCSIVNDQPICDCSETGFQGKDCSEGLAHLMMADQGMVREEYVATFKGSEYFCYDLSPNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNAWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDAKMKVSGIVAFKCENVATLDPVTFETPESFVTLSKWTAKKAGSISFDFRTTEPNGLLLFSHGKPKQQQQKDPKGPKTMKVDFFAIEMLDGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVD------------FQRDGR----SGTISVNSVRTPYNAPGESEILDLDDVLYLGGLPEDRAGLVFPTEVWTALLNYGYVGYIRRIAEAQRAVGSSFLVA--LGKKSN-----------------------PCLNSGTCREGWNRYVCDCSGTGYLGRSCERDATILSY-DGSKFMKIKLPVVMHTEAEDVSLRFRSQ-RAYGVLMATTSRNSADTLRLELDGGRVRLTVNLDCIRINCTTSKGPETIFAGQ-NLNDNEWHTVRVVRRGKSLKLMVDDLQPSEGQITGDHTQLEFHNIETGIITEKLYMPAVPS-------NFIGHLQGLGFNGMSYIDLCK 842          
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 303.138 bits (775), Expect = 4.536e-83
Identity = 303/1339 (22.63%), Postives = 553/1339 (41.30%), Query Frame = 2
Query:  137 VNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAM--------NTCYFDSNFCRYCSSSK--KCTKYEYL---------------------------------TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTL---NIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGS----------IYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVS--TDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILD 3895
             +T S LSFQ K D    L+ Y +D     F+ L ++   K++L   +   ++T                   ++   +++     WH + +  +    +L  +  ++   +       +++   + D +F GGLP+ ++   S     ++   P F G    +R +++ R   +P ++  Q   M        N C  +   C          C+K EY+                                 TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ ++DG   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L    +  +V  K+       K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K      +T  DF+++E+ D +LY  + + S       +   V++G  +++ +  +     I ++        S     ++ EG +Y+G L D +  L +   +W+ +L   + GCI  L ID     +  + +  +   +G K S    S   C + PC N+G+C+  W++  CDCT T +   TC +EA I  ++G  +M++  P    +E E+  L F S+   GL+++T ++ S  T +LE+   +GS          I I  N  +G +     +   D++WH++++ RR K+ K+ +DD+  E                         G  + D +     N    +   +R  +     F+G++    +NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT    G++LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S  H+          D++A   V  G  N +  G +++ G   N       N  P+   S+ GF+GC+AS  +N  +    +  +     ++   E  ++  +           C  DSC+  G C Q W  Y+CDCS TS++G +C D  TT  F K    + + +   ++ S   ++L  GF T+  K   L+ I     L   L + I    + G I V +   T      E+ + V DG YH+VRF ++   ATL++D+ +   H P G  Q T+ + +    +G ++   K  FQG +SGL  N + +L+
Sbjct:   41 ASTRSDLSFQFKTDASTALVLYFDDGGYCDFLQL-MVVEGKLQLQFSIDCAETT-------------------VVSDKRVND--SSWHFVSLGRYNLRTVLGVDGANKADEV----RPQRQYMKIVSD-LFLGGLPQDIR--TSVLTLPTAKDLPPFKG---IIRDLKYGRK--VPTLLSSQKVRMDMEGICTENPCE-NGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK-----------SADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFN---DNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKM-------KIQGDVVFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNG--AGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLEL---DGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAE-------------------------GQMVGDHTRLEFHNIETGVMTERRFVSHIPSSFIGHLQSLKFNGLLYIDLCKNGDIDYCELNARFGMRSIIAD-PVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRPLNDNQWHNVVITRDNSNLHTLKI-------DAKAVSQVVNGAKNLDLKGDLYIAGLGPNMY-----NSLPKLVASREGFKGCLASVDLNGRLPDLINDALFRSGQIERGCEVGFIKADL----QGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGKGGGTITFNWPANERPSTRTDRLTVGFSTSL-KDGILVRIDSAPGLGDYLMLHI----EQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAG-RQLTIFNTQATITIGGND--RKRPFQGQLSGLYYNGLKVLN 1254          
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 301.212 bits (770), Expect = 1.954e-82
Identity = 300/1358 (22.09%), Postives = 553/1358 (40.72%), Query Frame = 2
Query:  137 VNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAM--------NTCYFDSNFCRYCSSSK--KCTKYEYL---------------------------------TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTL---NIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVS--TDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQN-----------------------------TVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILD 3895
             +T S LSFQ K D    L+ Y +D     F+ L ++   K++L   +   ++T                   ++   +++     WH + +  +    +L  +  ++   +       +++   + D +F GGLP+ ++   S     ++   P F G    +R +++ R   +P ++  Q   M        N C  +   C          C+K EY+                                 TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ ++DG   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L    +  +V  K+       K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K      +T  DF+++E+ D +LY  + + S       +   V++G  +++ +  +     I ++        S     ++ EG +Y+G L D +  L +   +W+ +L   + GCI  L ID     +  + +  +   +G K S    S   C + PC N+G+C+  W++  CDCT T +   TC +EA I  ++G  +M++  P    +E E+  L F S+   GL+++T ++ S  T +LE  +    + + +N G+G +     +   D++WH++++ RR K+ K+ +DD+  E                         G  + D +     N    +   +R  +     F+G++    +NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT    G++LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S  H+          D++A   V  G  N +  G +++ G   N       N  P+   S+ GF+GC+AS  +N  +    +  +     ++   E  ++  +           C  DSC+  G C Q W  Y+CDCS TS++G +C D  TT  F K    + + +   ++ S   ++L  GF T+  K   L+ I     L   L + I    + G I V +   T      E+ + V DG YH+VRF ++   ATL++D+ +   H P G + N                             T+ + +    +G ++   K  FQG +SGL  N + +L+
Sbjct:   41 ASTRSDLSFQFKTDASTALVLYFDDGGYCDFLQL-MVVEGKLQLQFSIDCAETT-------------------VVSDKRVND--SSWHFVSLGRYNLRTVLGVDGANKADEV----RPQRQYMKIVSD-LFLGGLPQDIR--TSVLTLPTAKDLPPFKG---IIRDLKYGRK--VPTLLSSQKVRMDMEGICTENPCE-NGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK-----------SADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFN---DNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKM-------KIQGDVVFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNG--AGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLE--LDGSRVKLTVNLGKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAE-------------------------GQMVGDHTRLEFHNIETGVMTERRFVSHIPSSFIGHLQSLKFNGLLYIDLCKNGDIDYCELNARFGMRSIIAD-PVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRPLNDNQWHNVVITRDNSNLHTLKI-------DAKAVSQVVNGAKNLDLKGDLYIAGLGPNMY-----NSLPKLVASREGFKGCLASVDLNGRLPDLINDALFRSGQIERGCEVGFIKADL----QGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGKGGGTITFNWPANERPSTRTDRLTVGFSTSL-KDGILVRIDSAPGLGDYLMLHI----EQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGNNDNERLQMANKKIPFKYARPVEEWLQEKGRQLTIFNTQATITIGGND--RKRPFQGQLSGLYYNGLKVLN 1275          
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Match: nrxn3a (neurexin 3 [Source:NCBI gene;Acc:103035103])

HSP 1 Score: 295.049 bits (754), Expect = 1.695e-80
Identity = 306/1367 (22.38%), Postives = 554/1367 (40.53%), Query Frame = 2
Query:  137 VNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAM--------NTCYFDSNFCRYCSSSK--KCTKYEYL---------------------------------TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTL---NIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGS----------IYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQF---FMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEAN-EKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS--INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQN-----------------------------TVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILD 3895
             +T S LSFQ K D    L+ Y +D     F+ L ++   K++L   +   ++T                   ++   +++     WH + +  +    +L  +  ++   +       +++   + D +F GGLP+ ++   S     ++   P F G    +R +++ R   +P ++  Q   M        N C  +   C          C+K EY+                                 TF  +    Y    + I   +  I   FKT Q N  + + G               ++++ ++DG   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N++ L    +  +V  K+       K+  D+   C  +  + P+SF     Y+      + R    S  F+T + + LI +   +P  +K      +T  DF+++E+ D +LY  + + S       +   V++G  +++ +  +     I ++        S     ++ EG +Y+G L D +  L +   +W+ +L   + GCI  L ID     +  + +  +   +G K S    S   C + PC N+G+C+  W++  CDCT T +   TC +EA I  ++G  +M++  P    +E E+  L F S+   GL+++T ++ S  T +LE+   +GS          I I  N  +G +     +   D++WH++++ RR K+ K+ +DD+  E                         G  + D +     N    +   +R  +     F+G++    +NG  Y +L K       EL A     +++    + F +  SYL +  +  +    L FQ KT    G++LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S  H+          D++A   V  G  N +  G +++ G   N       N  P+   S+ GF+GC+AS  +N  +         DL+ +A      ++  C          C  DSC+  G C Q W  Y+CDCS TS++G +C D  TT  F K    + + +   ++ S   ++L  GF T+  K   L+ I     L   L + I    + G I V +   T      E+ + V DG YH+VRF ++   ATL++D+ +   H P G + N                             T+ + +    +G ++   K  FQG +SGL  N + +L+
Sbjct:   41 ASTRSDLSFQFKTDASTALVLYFDDGGYCDFLQL-MVVEGKLQLQFSIDCAETT-------------------VVSDKRVND--SSWHFVSLGRYNLRTVLGVDGANKADEV----RPQRQYMKIVSD-LFLGGLPQDIR--TSVLTLPTAKDLPPFKG---IIRDLKYGRK--VPTLLSSQKVRMDMEGICTENPCE-NGGICSLVDGEPLCDCSKTEYIGRFCSEEANSIPGLAHMMMADQAKSKAREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTGK-----------SADYVNLALKDGAVSLVIN---LGSGAFEAIVEPVNGKFN---DNVWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDIRLELSRLARIVDPKM-------KIQGDVVFKCENVATLDPISFETPEAYISLPKWNTKRMGSISFDFRTSEPNGLILFTHGKPQDRKATGSQKNTKVDFFAVELLDGSLYLLLDMGSGTIKVKATQNKVNDGAWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPDNRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKDIRQIAEAQNG--AGIKPSCNKVSGKQCESYPCKNKGVCKEGWNRFVCDCTGTGYWSRTCEREASILSYDGSMYMKVVMPTVMHTEAEDVSLRFMSQRAYGLLMATTSRDSADTLRLEL---DGSRVKLTVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVRVIRRGKSYKLTVDDDVAE-------------------------GQMVGDHTRLEFHNIETGVMTERRFVSHIPSSFIGHLQSLKFNGLLYIDLCKNGDIDYCELNARFGMRSIIAD-PVTFKAKSSYLSLATLQAYTSMHLFFQFKTTSADGIILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNLIKGNSDRPLNDNQWHNVVITRDNSNLHTLKI-------DAKAVSQVVNGAKNLDLKGDLYIAGLGPNMY-----NSLPKLVASREGFKGCLASVDLNGRL--------PDLINDALFRSGQIERGC----EGPSTTCQEDSCANMGICIQQWENYTCDCSMTSYTGTQCNDPGTTYIFGKGGGTITFNWPANERPSTRTDRLTVGFSTSL-KDGILVRIDSAPGLGDYLMLHI----EQGKISVTFNIGTVDIIVQENSIPVNDGKYHVVRFTRNGGNATLQVDNWAINEHFPAGNNDNERLQMANKKIPFKYARPVEEWLQEKGRQLTIFNTQATITIGGND--RKRPFQGQLSGLYYNGLKVLN 1275          
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002142.1 (pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1 gene:ENSPMAG00000001935.1 transcript:ENSPMAT00000002142.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.263 bits (726), Expect = 3.787e-78
Identity = 284/1195 (23.77%), Postives = 504/1195 (42.18%), Query Frame = 2
Query:  761 EYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFY---TRKFHCNSIYKTCADDKWHNVQI----KEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMK---FAKATEPFQYY----RQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY------QPSSKKGIHT-DTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGR----------GNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKL--VSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEK-HYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG-IDQ--------------NTVVDEELM------------AIVGSSEVSSKNSFQGFISGLTINEIAILD-TLKENFNSYILLINKSNADLV----------PNFQPRRSDQSLKQSEEEPKNPETNQKNNR-------------IVVARPQCP 4075
            EYL +D       A P+   S+    I   FKT Q N  + + G               ++++ ++DG   ++I+       +     T KF+         D+ WH+V++    ++  +     ++  Q       +  LT T + +       ++ F Y         LP  P  + F GC+KE+    ++  L + ++  +        G++ S  C  +  + P++F     ++     ++ R    S  F+T +   LI +      +    KG+ +   DF++IE+ D  L+  + + S       +  NV++G  +++    +     I ++ +        +   ++ +  +++G L +D   L +   +WS +L   + GC+  L ID     +  L ++ ++  +G K      S   C++ PC N G+C+  W++  CDCT T +TG +C +EA I  ++G  FM++  P    +E E+  L F S+   GL+L+T ++ S  T +LE+      + I L+  R          G +     ++  D+ WH++++ RR K LK+ +D                        G++ D   D   +  +   +   I+   +   +    FMG++ + ++NG  Y +L +       EL A      ++    I F +  SYL +  +  +    L FQ K+    GL+L+  G++NDY+ +E+V G +H I++ G+G    + +   +LND  WH+V I R  +  H+       K D       VN G  N +  G + +GG    +S+     +   S+ G+QGC+AS  +N  +         DLLKEA+ K + ++  C          C   SC   G C QHW  ++CDC+ TSFSG  C D  TT  F K    + Y +    + S   ++LA GF T+  K A L+ +    +L   + + IK     G + V +   T   S  E+ + V DG YH+ RF ++    TL+LD+       P G ID                 VVD+ L+            A +       +  FQG ++GL  N + +L  T K + N    +  + N  LV          P+   R +D+S+   E          ++NR             I+VA  +CP
Sbjct:   13 EYLCYDL-----AAHPIQSSSD---EITLSFKTLQRNGLILHTGK-----------AADYVNLALKDGAVSLVINLGSGAFEALVEPVTGKFN---------DNNWHDVKVTRNLRQLSSIGHAMVNKLQIVVTISVDGILTSTGYTQEDYTMLGSDDFFYVGGSPNTADLPGSPISNNFMGCLKEVIYKNSDQKLELSKLAKEGEPKMKVVGEI-SFTCENVAALDPITFEAPEAFITLPKWKTKRTGSISFDFRTTEPSGLIIFTQGKVSEVKDSKGLRSRKGDFFAIELFDGHLFLLLDMGSGTIKLKATESNVNDGEWYHVDFQRDGRTGSISVNSQRSPFTAGGDNEILDLDSEVFLGGLPEDKADLLLPTELWSALLNIGYVGCVRDLFIDGQSKDVRQLAEQQNA--AGVKPFCAKDSPKQCSSNPCRNHGVCREGWNRYVCDCTATGYTGRSCEREASILSYDGSMFMKVVMPVVIHTEAEDVTLRFVSQRAYGLLLATTSRDSADTLRLELDSARVKLTINLDCVRIKCNSTSARKGPEILYAGKHLNDNVWHTVQVIRRGKTLKLTVD------------------------GTSADGLMDGDHTRLEFHNIETGIMTERRYTSVMPSNFMGHLQNVVFNGMAYIDLCRNGDIRYCELNARFGMRTIIAD-PIIFKTRGSYLTLATLQAYTSMYLFFQFKSTSSDGLILYNSGDANDYIAVELVKGHIHYIFDLGNGQDLIRDNSKRVLNDNRWHNVIISRDNNNIHTL------KVDTQTVSQNVN-GARNLDLKGDLFIGGL--EKSMYAKLPKLVASREGYQGCLASLDLNGRL--------PDLLKEASYKVNEIERGC----EGPSTTCQEYSCGNQGMCVQHWATFTCDCTMTSFSGAYCNDPGTTYIFSKGGGLITYTWRPNDRPSTRADRLAVGFSTHL-KDALLVRVDSAATLGDFIELYIK----QGKVGVTFNVGTEDISVNETNVAVNDGNYHVARFSRNGGNCTLQLDNHPINERYPSGNIDNERLALARQRIPYRLGRVVDDWLLDKGRQLTIFNSQATITIGGQDRERPFQGQLAGLYYNGLQVLHLTAKNDPN----IKTQGNVRLVGDVPSILSTEPSATVRPTDRSMTFMEISTTIASATPRHNRPPTRDSLSSVSDDILVASAECP 1121          

HSP 2 Score: 110.923 bits (276), Expect = 1.685e-24
Identity = 111/478 (23.22%), Postives = 207/478 (43.31%), Query Frame = 2
Query: 2075 NKEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-----DDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGE-------------SNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLN--FNHFGKMHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCE 3400
             +E  +A F G +++      +  +S  +   L FK+   NGLIL T        D + + +++G++ +++N G G   F+ L         D+ WH +K+ R  + L        +   N L++ +  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   IY   +      +LAK+  P + +    S    NV     I F + ++++ +PK        + F  +T +PSGL++F QG+               D+  +E+ +G L ++ + GSG  K K +ES + NDG W+ V   R   +T S +       +  R+  P   GG N   +   ++ LGG  E+++ +    E  +     G+ GC+   +++           KD+ + A +++      P    D    CS + C   G C + W +Y CDC++T ++G  CE
Sbjct:    1 GREESMATFKGSEYLCYDLAAHPIQSSSDEITLSFKTLQRNGLILHTGK----AADYVNLALKDGAVSLVINLGSG--AFEALVEPVTGKFNDNNWHDVKVTRNLRQLSSI----GHAMVNKLQI-VVTISVDGILTSTGY-----TQEDYTMLGSDDFFYVGGSPNTADLPGSPISNNFMGCLKEVIYKNSDQKLELSKLAKEGEPKMKVVGEISFTCENVAALDPITFEAPEAFITLPKWKTKRTGSISFDFRTTEPSGLIIFTQGKVSEVKDSKGLRSRKGDFFAIELFDGHLFLLLDMGSGTIKLKATESNV-NDGEWYHVDFQRD-GRTGSISV------NSQRS--PFTAGGDNEILDLDSEVFLGGLPEDKADLLLPTELWSALLNIGYVGCVRDLFIDGQ--------SKDVRQLAEQQNAAGVK-PFCAKDSPKQCSSNPCRNHGVCREGWNRYVCDCTATGYTGRSCE 443          
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004299.1 (pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1 gene:ENSPMAG00000003933.1 transcript:ENSPMAT00000004299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 9.005e-34
Identity = 102/384 (26.56%), Postives = 171/384 (44.53%), Query Frame = 2
Query: 2291 GRGNKKFKTLENCFDDKWHSIKM----KRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKR-KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVD--------GKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCED 3403
            G+G +     +   D++WH++++    KRR K LK+ +D    E +   EM      +++  I    + G   +   + +V ++              F+G++   ++NG  Y +L K       E+ A      ++    + F +  SYL +  +  +    L FQ KT+ P GLLL+  G+  D++ LE+V G LH  ++ G G    K    G LND  WHSV ++R  +  H+     D         +  D + D+ V  GGL   H+  +H       + +V        S+ GFQGC+AS  +N  +      L  D L+ + +   ++  C          C  DSCS  G C Q W +++CDC+ TS++G  C D
Sbjct:    2 GKGPEVLHAGQKLNDNEWHTVRVSRRGKRRGKLLKLSVD----EVSKEDEMAGDHTRLEFHNI----ETGIMTERRYTSVVPSN--------------FIGHLQSLVFNGLPYLDLCKNGDVALCEINARFGLRTIIAD-PVTFRTRSSYLTLATLQAYAAMHLFFQFKTMSPDGLLLYNGGDGTDFIALELVQGYLHYAFDLGKGPSVIKGKSEGQLNDNQWHSVIVMRDANNLHTLKVDRDMATQNGNEARNLDLKGDLFV--GGLPREHYSGLH-------KLVV--------SRDGFQGCLASVDLNGRLPD----LLDDALRRSGQ---IERGC----EGPSTVCQDDSCSNQGLCVQQWEEFTCDCTMTSYTGAFCND 334          

HSP 2 Score: 73.9442 bits (180), Expect = 4.389e-14
Identity = 57/245 (23.27%), Postives = 109/245 (44.49%), Query Frame = 2
Query: 1358 KLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLN---SVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDS-PIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCN 2077
            ++N+   +      PV+F  +S YL    +++         FKT   D L+ Y           TDF ++E+    L+++  L    SV+  K  S   +++   H++++  +   +  L    +          +++ +G L++G L       +   V S      F GC+ S+ ++   P  LD  ++++  I  GC+         VC +  C N+G+C  +W++ +CDCT T++TG  CN
Sbjct:  105 EINARFGLRTIIADPVTFRTRSSYLTLATLQAYAAMHLFFQFKTMSPDGLLLYNGGD------GTDFIALELVQGYLHYAFDLGKGPSVIKGK--SEGQLNDNQWHSVIVMRDANNLHTLKVDRDMATQNGNEARNLDLKGDLFVGGLPREHYSGLHKLVVSR---DGFQGCLASVDLNGRLPDLLDDALRRSGQIERGCEGPS-----TVCQDDSCSNQGLCVQQWEEFTCDCTMTSYTGAFCN 333          
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007718.1 (pep scaffold:Pmarinus_7.0:GL476589:4931:52526:1 gene:ENSPMAG00000006969.1 transcript:ENSPMAT00000007718.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 8.634e-18
Identity = 109/494 (22.06%), Postives = 187/494 (37.85%), Query Frame = 2
Query: 2015 IEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFY-LMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLE-------NCFDDK-WHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQ---PANVMRQFAINFHSTKSYLVI-----------PKVNIFGDFRLEFQMKTLQPSGLLL----FLQGESNDYLILEMVNGLLHII--YNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHY----VDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKC 3397
            IEW+       +    G  C   + +A F+G   +  +F +  +   ++   L  ++K  +G++L  + Q  G    L + +  G + + L FG      + +        +  DD+ WH + + R  ++  + +D +   F                ++G       D Q S   L        GK     +  F+G M +  YNG +  +LA++  P  I +T ++    PA V     + F S   YL +           P++   G      Q +T   +GLLL     +QG   + L L +  G LH+    N     +  +     LNDG WH V +    ++  S    VDG+         ++    N  +FG  +           T       +   F GC+   +++N    D  +L + LL      H+    + + C  NH           C  GG+C Q W  +SCDC  TS++G  C
Sbjct:   29 IEWNPEGHIGLRVELYG--CPYRSSVAYFDGRSLLAYRFEHKVRRTRKDVVSLRMRTKRSDGVLLHGEGQRGG---GLTLQIHRGRLNLHLRFGMEGDAGEGMGYITVSAGSLLDDQHWHDVTITRSGRHGNLTVDRHMQRFQ---------------VMGDYESLDLDYQLSFGGLPFG-----GKPGNRAHPNFLGCMENVYYNGEDVTDLARRAKP-QIHITGNVMFGCPAEVAL-IPVTFPSPGGYLALAGHLLWPNHAQPQIQSLG-----LQFRTWDAAGLLLQVVSVVQGHGVEGLRLALSEGKLHMTSSLNLQGRTELFLVTGSSLNDGEWHGVTL---QARDDSLLVMVDGREHFVMLSPVLHLIAGNAYYFGGTN-----------TTPGHPQSAVAPFLGCMRLIHMDNQ-PVDITLLQQGLLGTFINVHFDLCGLTDRCLPNH-----------CEHGGRCMQTWGGFSCDCQGTSYTGSTC 464          

HSP 2 Score: 62.7734 bits (151), Expect = 4.626e-10
Identity = 89/465 (19.14%), Postives = 170/465 (36.56%), Query Frame = 2
Query:  773 FDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQF-------ISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSN-QQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGI------RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSL-NVCANQPCNEG-ICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFM 2119
            FD  S + Y F   V       ++ + +TK+ +  L +     G     QI + +        +     +G+ +I +S    +D                  D  WH+V I        +T+D   + F+ + + + L     + F     PF        P       F GCM+ +Y +  +VT    ++  +     H  G +    C     + PV+F     YL   G          +     L F+T  +  L+    S  +G   +    ++      +  S+ L       +++  ++++G  H + L      + +++D   + + +S   H I    + Y G  + T       H  S +    F GC+  + +D+ P+ + LL  +   + +      ++  L + C    C  G  C   W   SCDC  T++TG+TC+  A       Y+ +
Sbjct:   55 FDGRSLLAYRFEHKVRRTRKDVVSLRMRTKRSDGVLLHGEGQRGGGLTLQIHRGRLNLHLRFGMEGDAGEGMGYITVSAGSLLD------------------DQHWHDVTITRSGRHGNLTVDRHMQRFQVMGDYESLDLDYQLSFGGL--PF-----GGKPGNRAHPNFLGCMENVYYNGEDVT----DLARRAKPQIHITGNVMFG-CPAEVALIPVTFPSPGGYLALAGHLLWPNHAQPQIQSLGLQFRTWDAAGLLLQVVSVVQGHGVEGLRLALSEGKLHMTSSLNLQGRTELFLVTGSSLNDGEWHGVTLQARDDSLLVMVDGREHFVMLSPVLHLIAGN-AYYFGGTNTTP-----GHPQSAV--APFLGCMRLIHMDNQPVDITLL--QQGLLGTFINVHFDLCGLTDRCLPNHCEHGGRCMQTWGGFSCDCQGTSYTGSTCHTPAYELSCEAYKHL 479          
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Match: cntnap2b (contactin associated protein like 2b [Source:ZFIN;Acc:ZDB-GENE-070912-26])

HSP 1 Score: 76.2554 bits (186), Expect = 4.917e-14
Identity = 88/470 (18.72%), Postives = 181/470 (38.51%), Query Frame = 2
Query: 2015 IEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPN-TYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFG--RGNKKFKTLE--NCFDDK-WHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQ-GESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDS-RADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKC 3397
            ++W+       +    G     EA+   F+G   +  +F   T ++  +   L F+S L  G++L  + Q     D L + +Q G +++L++    R    + +    +  DD+ WH + + R  ++  + +D +   F+                         D  D   +L+   +   GK   +    F+G + +  Y+G    +LA+++ P +++    +      +    + F     +L +          +  + +T  P+GLLL          L L +  G L++           +S    LN+G WH+  +    ++  +    VDG  D + R+ +P +    +  +FG           S +TF     RS   F GC+    +++ +   +++         N  + + + C        + C    C  GG C+Q W  + C+C+ T ++G  C
Sbjct:   95 LDWNAYRWVGLRVEVYGCPYKSEAVF--FDGRSLLAYRFEQKTRRTRKDVVSLRFRSALSEGVLLHGEGQRG---DTLTLELQRGCLHLLISLDDVRSQVAYTSASAGSLLDDQHWHDVMLVRSGRHGNLTVDRHTQRFH--------------------VKGDDDSLDLDYQLMFGGLPFGGKAGSVGRPNFLGCLENVYYSGEYVTDLAQRIKPQIHMSGNVTFGCPRGVPAIPVTFPGPDGHLALTGRVGRAALAVAMEFRTWDPAGLLLLTALSRGLGELRLTLREGKLNLALIRPGSSDIHLSSGKQLNNGEWHTASV---QARERTLTLVVDGAEDTAVRSLLPFHVATGSIYYFGGA--------DSRLTFSKNLIRSLPPFLGCMRLINIDDHLVDLSLLQQG---LLGNYTNLMLDQC-----GLTDRCLPSHCENGGTCSQTWRSFECNCAGTGYTGVTC 520          

HSP 2 Score: 63.5438 bits (153), Expect = 3.362e-10
Identity = 72/291 (24.74%), Postives = 120/291 (41.24%), Query Frame = 2
Query: 2561 ENQFFMGYMMHFIY-------NGRNYFELAKKLSPLNIELTASLQPANVMRQF--AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNG-LLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGG-LNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKC 3397
            E+   +GY  H            R   E A K+ PL+          +  R F  ++ F +  SYL  P +       + F  KT   SG++L   G S D++ +++ +   +   ++ G+G  +  +     LND  WH V + R + +    + RVD  P   R  VP    G  +     ++++G  +   S             GF GC+ S  +N +          DL + A     V   C  +     +Y S+  C  GG+C + +  YSCDCS++S++GP C
Sbjct:  684 EDSGLLGYKPHLPVMQLLIGDTDRALSEAAYKVGPLS---------CHGDRHFWNSVLFTTPSSYLHFPPIRAETSLDIAFFFKTTTDSGVILENMGAS-DFIRVQLKSPHEVSFSFDVGNGPVEMAVRSEQPLNDEEWHVVSVERSLKEA---SLRVDLLP---RELVPAPAQGHTSLQLSSQLYVGSSVSGHS-------------GFLGCVRSLRINGAT--------LDLEERARVTPGVKPGCSGH---CRSYGSL--CRNGGRCIERYNGYSCDCSTSSYNGPSC 932          

HSP 3 Score: 50.0618 bits (118), Expect = 4.337e-6
Identity = 55/232 (23.71%), Postives = 96/232 (41.38%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIR---DFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFEL--PVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKE 2083
            V FT  S YL    IR+      +  FKT     +I     +       +DF  ++++   + +  F +G N  V   V S   +++   H + +   L    +R+ L     V   +  +  ++    LY+GS       SVS H  SG LG     C+ SL I+ + + L+   +    +  GC      +  ++C N     G C   ++  SCDC+ +++ G +C  E
Sbjct:  731 VLFTTPSSYLHFPPIRAETSLDIAFFFKTTTDSGVILENMGA-------SDFIRVQLKSPHEVSFSFDVG-NGPVEMAVRSEQPLNDEEWHVVSVERSLKEASLRVDLLPRELVPAPAQGHTSLQLSSQLYVGS-------SVSGH--SGFLG-----CVRSLRINGATLDLEERARVTPGVKPGCSGHCRSYG-SLCRNG----GRCIERYNGYSCDCSTSSYNGPSCTNE 935          
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000532.1 (pep scaffold:Pmarinus_7.0:GL482851:1933:10168:1 gene:ENSPMAG00000000481.1 transcript:ENSPMAT00000000532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 6.091e-14
Identity = 68/255 (26.67%), Postives = 122/255 (47.84%), Query Frame = 2
Query: 2699 AINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGL-LHIIYNWGSGYKRKISESGL-LNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKY 3457
            A +F + +SYL  P V+      + F  KT   SG+ L   G ++D++ +++ +   +   ++ G+G    +  SG  LND  WH+V + R + +    + RVD  P +  A VP + G  +     ++++G  +   S             GF GC+ S  VN      +V+L  DL ++A     V+  C  +     +Y ++  C  GG+C +H + YSCDCSS+ + GP C   +    F +  +++ Y++
Sbjct:    5 AASFSTHRSYLHFPPVHAETSLDITFLFKTSAESGVFLENMG-THDFIRVQLKSPYEVSFGFDVGNGPVEMVVRSGQPLNDEEWHAVSVERSLKEA---SVRVDRLPREV-AWVP-SRGHAHLQLNSQLYIGSSVSGDS-------------GFLGCVRSLRVN------SVML--DLEEQARVTPGVNPGCSGH---CRSYGAL--CRNGGRCVEHSVGYSCDCSSSPYDGPFC--TTEVGGFFERGTWVKYEF 225          
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Match: EDO46873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK6])

HSP 1 Score: 85.1149 bits (209), Expect = 1.314e-16
Identity = 134/660 (20.30%), Postives = 259/660 (39.24%), Query Frame = 2
Query: 2078 KEAIIAEFNGYQFMRI-KFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDK----LEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRME---------NQFFMGYMMHFIYNGRNYFELAKKL-----------------------SPLNIELTASLQPANVMRQFA----------INFHSTKSYLVIPKV--NIFGDFRLEFQMKTLQPSGLLLF---LQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK-MHLGG---YLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSF-GGKCTQHWMKYSCDCSSTSFSGPKCEDVS-TTAQFVKHPSYLVYKYS-IIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGI---DQNTVVDEELMAIVGSSEVSSKNSFQGFISGLT 3871
            + A    F G  +M + + P + ++  E   +MFK+   +GL+L     + G  DK    L + ++NG +    + G    + ++ +N   ++WH++ + R +++  + +D+                     ++  +      + D  ++L       LG V RM          +  F G +  F+ +GR   +L++ L                       +P +  ++     A  +  +           +   S +SYL  P    +    F +   +K    +GL+LF    +    D++ L +  G++  I++ GSG     S + ++ D +WH++ I R      +    +DG P      V  + G ++     + ++LGG   Y +  +IV   +       GF GCI    VN                 + E H        N  + ++ C      F GG C      Y C C+   ++G  CE     +A       ++ +K S I+ + S       F   T++ + L+  +  +S+S    I I +++  G ++V Y    G  + + S   + DG +H V+F +  +AA LK+DD      +  GI    Q   ++ +++ I G+  V  +     F+SGL 
Sbjct:   65 RSARQPRFKGTSYMSLPRLPRSARTSFE-LSIMFKASSGDGLLL-----YGGRKDKRKDFLALGLRNGHVEFRFSCGADIAQVRSRQNITLNQWHNVVVFRDKRDAHLMVDNGD-------------------LVTQSLKGTQSMMDLKTRLF------LGGVPRMRRVTSDAVPYHSGFTGCVKSFVVDGR-MLDLSQALGDVVKSRQVEECGESRDCECHHNAPCHYAVSGEPICACPLGTYGRLCEHDFKLVMPSFSGQSYLTYPSFGQSTLRTFTISLVLKPRSDTGLILFNSQKKDGKTDFISLSLREGIVEFIFDCGSGPAVIRSSTPIMAD-IWHTIVISR---DGRTGGLSLDGGP----PVVGTSPGRMSLISLEQEVYLGGMADYKQQPAIVDMPH-------GFNGCIQEVKVN-----------------SRELHLPSARSGLNVLNCDHICVTHLLCFNGGTCQAKMDHYKCHCA-VGYTGMMCERARRVSAPTFAGDGFMKFKGSEILSRLSGKNTELEFLFRTQESSGLLLSVQKESVSHGDHITIGLID--GILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDD-----EIKAGIASDSQYRQLNSDVLFIGGAPTVDRR-----FMSGLV 647          

HSP 2 Score: 79.337 bits (194), Expect = 8.031e-15
Identity = 106/490 (21.63%), Postives = 184/490 (37.55%), Query Frame = 2
Query: 1061 DKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLN-----------IVEMVTKKVYNFHSNGKLN----------------SDICMEMFPIKPVSFTGKSDYLQ--AFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRD--FALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHD-IEFEGSLYIGSLDDTK----ILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC--NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAE--FNGYQFMRIK---FPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDK-WHSIKMKRRRKNLKVWIDD 2398
            ++WHNV +   + D  + +D+     ++L   Q    +  +      P    R+      P  S F GC+K   +    + L+           + E    +    H N   +                  +C   F +   SF+G+S YL   +FG  ++R    SL  K      LI +    K G    TDF S+ +R+      F  G    V   + S+  +   + H IV+  +     + LD    V+  S      I  E  +Y+G + D K    I+ + H          F+GCI  + ++   + L        S  SG      ++  ++C       N G CQ + D   C C    +TG  C +   ++   F G  FM+ K     +    +      +F+++  +GL+LS Q +     D + I + +G + +  + G G +         DD  WHS+K  R+     + +DD
Sbjct:  150 NQWHNVVVFRDKRDAHLMVDNGDLVTQSLKGTQSMMDLKTRLFLGGVP--RMRRVTSDAVPYHSGFTGCVKSFVVDGRMLDLSQALGDVVKSRQVEECGESRDCECHHNAPCHYAVSGEPICACPLGTYGRLCEHDFKLVMPSFSGQS-YLTYPSFGQSTLRTFTISLVLKPRSDTGLILFNSQKKDG---KTDFISLSLREGIVEFIFDCGSGPAV---IRSSTPIMADIWHTIVISRDGRTGGLSLDGGPPVVGTSPGRMSLISLEQEVYLGGMADYKQQPAIVDMPHG---------FNGCIQEVKVNSRELHL-------PSARSGLNV---LNCDHICVTHLLCFNGGTCQAKMDHYKCHCA-VGYTGMMCERARRVSAPTFAGDGFMKFKGSEILSRLSGKNTELEFLFRTQESSGLLLSVQKESVSHGDHITIGLIDGILEVRYDLGVGRETVIRSTATLDDGYWHSVKFVRKSLAAYLKVDD 610          

HSP 3 Score: 60.4622 bits (145), Expect = 4.824e-9
Identity = 68/328 (20.73%), Postives = 139/328 (42.38%), Query Frame = 2
Query: 1448 RSVRKA-KFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVL-NISTNYHDIEFEGSLYIGSLDDTKIL---SVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCA---NQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKE--AIIAEFNGYQFMRIKFPNTYKSEVENFY--LMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWID 2395
            RS R + + S+ FK    D L+ Y     K      DF ++ +R+  + F     + + ++V S  N++    HN+V+  +     +++D  + V  ++      ++ +  L++G +   + +   +V +H       + F+GC+ S  +D     LDL       + S  +  EE      C    N PC+  +      +  C C    + G  C  +   ++  F+G  ++   +P+  +S +  F   L+ K +   GLIL    +  G TD + + ++ G +  + + G G    ++      D WH+I + R  +   + +D
Sbjct:   85 RSARTSFELSIMFKASSGDGLLLYGGRKDK----RKDFLALGLRNGHVEFRFSCGADI-AQVRSRQNITLNQWHNVVVFRDKRDAHLMVDNGDLVTQSLKGTQSMMDLKTRLFLGGVPRMRRVTSDAVPYH-------SGFTGCVKSFVVDGR--MLDLSQALGDVVKS--RQVEECGESRDCECHHNAPCHYAVS----GEPICACPLGTY-GRLCEHDFKLVMPSFSGQSYL--TYPSFGQSTLRTFTISLVLKPRSDTGLILFNSQKKDGKTDFISLSLREGIVEFIFDCGSGPAVIRSSTPIMADIWHTIVISRDGRTGGLSLD 389          
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Match: EDO47422 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM09])

HSP 1 Score: 78.9518 bits (193), Expect = 8.655e-15
Identity = 73/319 (22.88%), Postives = 138/319 (43.26%), Query Frame = 2
Query: 1463 AKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGS---LYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLD-LLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNG--YQFMRIKFPNTYKSEVEN-FYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCF-DDKWHSIKMKRRRKNLKVWID 2395
             + S  F+T++S+ L+ YQ     G+H   DF  + + +  +   IG++     + +   + ++   H + +  E   +   +D+    L  S +  D     +   LY+ S   T  L+++  V        F GC+  L    S  +LD   ++ +S  +SGC +      LN C +     G C  E  +  C+C  T + G+ C  E+  A FNG  Y    +      +S + N     F +  P+G+I+ +    S   D + + +  G + +  + G+G     + E C  D  WHS+ + R+R+ + + +D
Sbjct:   44 GEVSFVFRTNQSNGLLLYQ---DDGMH---DFVELFLDNGNVRIKIGIDDCYIQEKLVQGSFNDFHWHRVRITREPRNVTFAVDRAWLKLPCSPSKGDKFARATGRFLYVASFPPTLGLNLNWLV--------FPGCLGDLWFTTSEQRLDQATLRDSSGTTSGCNSPCRTPQLNKCLHG----GRCSAEIGRVECECQGTGYEGDDCGIESSSAWFNGSSYVLYDVGIHQPGRSTLTNTIAFRFATGNPDGVIVHS----SMFDDHVVVELSKGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLD 340          

HSP 2 Score: 64.6994 bits (156), Expect = 2.614e-10
Identity = 94/412 (22.82%), Postives = 159/412 (38.59%), Query Frame = 2
Query: 2723 SYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKG------GFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHS---INQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVD----EELMAIVGSSEVS------SKNSFQGFISGLTINEIAILDTL 3901
            SY      N+ G+  + F  +T Q +GLLL+     +D++ L + NG + I       Y ++    G  ND  WH V+I R   +  +  F VD      RA + +       + F +   G +L   S        P + G       F GC+   +   S       L +  L++++        C    N       ++ C  GG+C+    +  C+C  T + G  C   S++A F    SY++Y   I +       N +AF F T      P   I+ +      + +E+      GF++V +    G  +       + DG +H V   + R   TL LD       V  G  Q + +D    +E +   G  +        S+ +F G I  L  +E  ++D +
Sbjct:   33 SYTTFEPWNLHGE--VSFVFRTNQSNGLLLYQDDGMHDFVELFLDNGNVRIKIGIDDCYIQEKLVQGSFNDFHWHRVRITR---EPRNVTFAVD------RAWLKLPCSPSKGDKFARA-TGRFLYVASF-------PPTLGLNLNWLVFPGCLGDLWFTTSEQR----LDQATLRDSSG---TTSGC----NSPCRTPQLNKCLHGGRCSAEIGRVECECQGTGYEGDDCGIESSSAWF-NGSSYVLYDVGIHQPGRSTLTNTIAFRFATGN----PDGVIVHSSMFDDHVVVELS----KGFVRVSFDLGQGRLNITSREGCLHDGTWHSVTIHRKRRRVTLDLDKQERVTVVIPG--QFSFLDFKGGQEKLYFCGGPDSDTLAYSYSRKNFTGIIQQLRFDEYQVIDEV 403          
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Match: EDO39258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAQ4])

HSP 1 Score: 73.559 bits (179), Expect = 4.936e-13
Identity = 81/346 (23.41%), Postives = 149/346 (43.06%), Query Frame = 2
Query: 1058 DDKWHNVQIKEFRNDIVITLDDFQKEFKNLSN---QQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFY-SIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDI-EFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSG-CKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTC 2074
            D+KWH V++   +  +++TLD+ +       +     L K I +     + P  Y+     P       F+GC+K++Y       ++I+     ++  + + G+L S IC  +    PV F   + +L+   + S       LSF+T+  D ++A++      + TD   Y S+      L   IG +  +  K+    N+++GL H++        + + LD +  V + +    +I +F    YIGS               G   T F GC+ ++ ++ + ++   L K+ +    G C  + +      C   PC N G C+  WD  +CDC  T + G TC
Sbjct:   15 DNKWHTVKVARNQRSLLLTLDNKETRTNTAGSFVRLDLDKFIFVGGVDRSLPDDYHGARDAPN------FKGCLKDVYFD----FIDILYGAQYELLYYSTYGRL-SYIC-PLDDYTPVGFPSLNTHLRLTDL-SPNNFTVWLSFRTYSGDGVLAFK------MSTDARVYLSLVHAKLELEIRIGTDRPI--KISLGENLNDGLWHDVTSGINRKELWLTLDDKPEVRHANPWLKNIGKFRRRTYIGS---------------GTQKTGFVGCMNNIKLNGALVRPRKLSKEVAGAVIGRCSITSK------CFPNPCQNGGACKESWDSYTCDCQGTFYEGATC 318          

HSP 2 Score: 58.9214 bits (141), Expect = 1.831e-8
Identity = 86/374 (22.99%), Postives = 146/374 (39.04%), Query Frame = 2
Query: 2321 ENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN---NFLEMDMPIIGIKYLIIG----SAFDNGTDIQDSSS-----KLVSNDIIHLGKVKRMENQFFMGY-MMHFIYNGRNYFELAKKLSPLNIELTAS-LQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCE 3400
            EN  D+KWH++K+ R +++L + +D+     N   +F+ +D+     K++ +G    S  D+    +D+ +     K V  D I +    + E  ++  Y  + +I    +Y  +      LN  L  + L P N     +   +S             GD  L F+M T              +  + L +V+  L +    G+    KIS    LNDGLWH V    +  +       +D KP+   A+           + GK     Y+ + +           K GF GC+ +  +N ++     +  + L KE      V   C        + C  + C  GG C + W  Y+CDC  T + G  CE
Sbjct:   11 ENLDDNKWHTVKVARNQRSLLLTLDNKETRTNTAGSFVRLDLD----KFIFVGGVDRSLPDDYHGARDAPNFKGCLKDVYFDFIDILYGAQYELLYYSTYGRLSYICPLDDYTPVG--FPSLNTHLRLTDLSPNNFTVWLSFRTYS-------------GDGVLAFKMST--------------DARVYLSLVHAKLELEIRIGTDRPIKISLGENLNDGLWHDVTSGINRKE---LWLTLDDKPEVRHANP-------WLKNIGKFRRRTYIGSGT----------QKTGFVGCMNNIKLNGAL-----VRPRKLSKEVAGA--VIGRC-----SITSKCFPNPCQNGGACKESWDSYTCDCQGTFYEGATCE 319          
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Match: EDO36419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIM8])

HSP 1 Score: 57.3806 bits (137), Expect = 7.532e-9
Identity = 59/226 (26.11%), Postives = 99/226 (43.81%), Query Frame = 2
Query: 1418 KSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGS--LYIGSLDDTKILSVSHHVWSGIL-GTYFSGCIFSLTID-DSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNK 2080
            KS + Q    R       + SFKT   D L+ YQ     G+    D++++E++   L  +I       S+V     +++   H + +H E   I + LD    V+ I      ++   S  LY G L   + LS+S   +  ++    F+GCI  + I   + +Q +L + ++     GC+        N C + PC N G C  +    +CDC+ T F GN C +
Sbjct:    7 KSSFAQHQQWRVSSNGTLTFSFKTFLKDALLIYQDD---GV---MDYFNLELKVGRLLLNIRTGRKT-SQVTLGNQLNDLSWHQVSIHVEHVKIGLTLDDHTRVVKIPRKNLALKNNPSRYLYFGGL--PRSLSISTLSFPAVVFAKRFTGCIKDVEIQTGNGVQEELRLVESKGRVRGCR--------NACRSNPCQNGGRCINKIWSSACDCSGTGFYGNQCTE 215          

HSP 2 Score: 51.6026 bits (122), Expect = 5.522e-7
Identity = 62/222 (27.93%), Postives = 83/222 (37.39%), Query Frame = 2
Query: 2768 LEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGL---LNDGLWHSVKI-VRHMSKTHSFAFRVDGKPDDSRA-DVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTA 3418
            L F  KT     LL++      DY  LE+  G L +    G    RK S+  L   LND  WH V I V H+         +D   D +R   +P     L  N    ++ GG   + SI T           F GCI        V   T    ++ L+    K  V   C        N C  + C  GG+C       +CDCS T F G +C +  + A
Sbjct:   24 LTFSFKTFLKDALLIYQDDGVMDYFNLELKVGRLLLNIRTG----RKTSQVTLGNQLNDLSWHQVSIHVEHVK----IGLTLD---DHTRVVKIPRKNLALKNNPSRYLYFGGLPRSLSISTLSFPAVVFAKRFTGCI------KDVEIQTGNGVQEELRLVESKGRV-RGC-------RNACRSNPCQNGGRCINKIWSSACDCSGTGFYGNQCTEGESKA 220          
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Match: EDO45834 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW5])

HSP 1 Score: 60.077 bits (144), Expect = 8.530e-9
Identity = 67/268 (25.00%), Postives = 110/268 (41.04%), Query Frame = 2
Query: 2753 FGDFRLEFQMKTLQPSGLLLFLQGE----SNDYLILEMV-NGLLHIIYNWGSGYKR---KISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDG------KPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSIN-QLAFGFQTN 3511
            +GD  L F+    +    +LF QGE    + D++ + +  N  + + Y+ G+G +    +++E+ L  + LWH V +  ++ +   F   VDG       P      + V          G + +GGY+                 GF GCI  F +N  V         +L + + +  YV+E C    N++        C  G +CT  +  Y CDC  T F G  CE     A F +  SYL Y +   ++ +     A GF+T 
Sbjct:  691 YGDVSLFFRTPYTRG---ILFHQGEKTRNTRDFIQVNITSNDTVQLSYDIGNGPQSIVVQVTENPLNTNRLWHKVVVWFNIKE---FGLEVDGIRKIRLNPLQQSKQLDV---------VGNLFIGGYMREM------------MNGFVGCIRGFTINGEVL--------NLARLSKDFDYVNEGCYSACNNETQ------CKGGARCTDDYNIYKCDCHLTPFYGYFCEQ-DLGAAFKETDSYLRYTFPEGERDAWGTDFAVGFKTG 916          
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Match: ENSORLT00000013637.2 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 330.487 bits (846), Expect = 4.649e-92
Identity = 335/1453 (23.06%), Postives = 595/1453 (40.95%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCR---YCS---------------SSKKCT--------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHT-DTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANE-KHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN-----FNSYILLINKSNADLVP--NFQPRRSDQSL-------------KQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQE 4171
            +SF +K  +  GL+ Y +D     F+ L L+ + K+ L   +F  +                   T I D +  D     WHT+ I  + K+  L  +   + V +       KR D  +   +F GG+P +L+  A      +   EP F+G I+ V +           +I  +   M+ C   +N C+    CS                 K C+              K EY+ TF  +    Y   ++ I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + L+ +       QP   K   T   DF++IE+ +  LY  + + S        N  V++G  +++    +     I ++              ++ + +LY+G L + K+ L     VW+ +L   + GCI  L ID     +  L  I+K + +   C           C + PC N GIC+  W++  CDC+ T + G +C +EA I  ++G +FM+++ P    +E E+  L F+S+   G++++T ++ S  T +LE  + +G + + +N           +G +     +N  D++WH++++ RR K+LK+ +DD                     I G    + T ++  +   +   I+   +        F+G++    +NG +Y +L K       EL A +   N++    + F S  SY+ +  +  +    L FQ KT  P GL+L+  G+ ND++++E+V G LH + + G+G +  K + +  L+D  WH+V I R  +  H+          D++      TG  N +  G +++GG  ++  +  +  +   +K GFQGC+AS  +N  +         DL+ +A +    ++  C          C  DSC+  G C Q W  +SCDCS T+F GP C D  TT  F +    + Y +    + S   ++LA GF T+  K A L+ +  +  L   L + I    D G + V +   T   +  E    V DG YHIV+F +    ATL++DDL      P G + N                VVDE L+                +G  E     SFQG +SGL  N + + +   E          + L+  S + + P  +    RS+ S              +  +  P+ P+  Q  +  +VA  +CP  ++ E     +    G+  P   F  PN  E
Sbjct:   51 MSFNMKTKSSHGLLVYFDDEGFCDFLEL-LIRNGKLSLRFSIFCAEPA-----------------TVISDTAVND---SRWHTVTIRRNFKNTTLMVDNEIKWVEV-----MSKRRDMTVFSHLFVGGIPPELRSVALRLTSAAVKDEPPFAGWITDVTVNNTE-----CAIINSEGVLMDIC-GTANMCQNGGICSLIDNEPTCDCSHTGFQGKDCSEGLAHLMMGDQGMGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTV-AFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ----CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDD------------------LSPIEGQMAGDHTQLEFHN---IETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNNLHTVKI-------DTKITTQTTTGAKNLDLKGNLYIGGVAKD--MYMYLPKLVHAKEGFQGCLASVDLNGRL--------PDLMSDALDCVGQIERGC----EGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHL-KDAVLVRVDSSSGLGDFLKLHI----DKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWERDRSQSFQGQLSGLYYNGLKVFNMAAEGDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTASSRRVKQTTPREPQ--QTTDDFLVASAECP--SDDEDIDPCEPSSGGLANP--TFAGPNPPE 1382          

HSP 2 Score: 163.31 bits (412), Expect = 7.450e-40
Identity = 195/907 (21.50%), Postives = 367/907 (40.46%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTY--FSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN--------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIK-YLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN--------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK---------MHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLL----TIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLS--------DRIHVP-DGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  S  L+ Y     +G     DF  + IR+  L     +     + V+S+  V++   H + +        +++D E   + + +   D+     L++G +   ++ SV+  + S  +     F+G I  +T++++   +   I     +   C T+      N+C N     GIC +  ++ +CDC+ T F G  C+              KE  +A F G +F       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  + + + +D        + + D  ++G   +  +G +        D     VSN+              FMG +   +Y   +       LAK+  P + I  T + +  NV     I F + +S++V+ K N      + F  +T +P+GLLLF  G+                D+  +EM+ G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + +NT    +   G+         ++LGG  EN+  + F  E  T     G+ GCI   +++           KD+  L E  +   V  +C     +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  LI+     S   L     +  +++  +   I++   ++ G  +    + N+ D  +H VR  +   +  L +DDLS        D   +    I+   V ++  M+ V S       +F G +  L+ N ++ +D  K
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVY--FDDEGF---CDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIP-PELRSVALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQNG----GICSLIDNEPTCDCSHTGFQGKDCSEGLAHLMMGDQGMGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNDWHDVKVTRNLRQVTISVD-GILTTTGYTQEDYTMLGSDDFFYVGGS----PSTADLPGSPVSNN--------------FMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVD------------FQRDGR----SGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQ--------SKDVRRLAEIQKATGVKPSC---SKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQ-RAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQ-NLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPS-------NFIGHLQSLSFNGMSYIDLCK 849          
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Match: ENSORLT00000034989.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 321.242 bits (822), Expect = 5.132e-89
Identity = 336/1469 (22.87%), Postives = 597/1469 (40.64%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCR---YCS---------------SSKKCT----------------------KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQI-KEFRND-------IVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHT-DTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANE-KHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN-----FNSYILLINKSNADLVP--NFQPRRSDQSL-------------KQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQE 4171
            +SF +K  +  GL+ Y +D     F+ L L+ + K+ L   +F  +                   T I D +  D     WHT+ I  + K+  L  +   + V +       KR D  +   +F GG+P +L+  A      +   EP F+G I+ V +           +I  +   M+ C   +N C+    CS                 K C+                      K EY+ TF  +    Y   ++ I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++ +  R         + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + L+ +       QP   K   T   DF++IE+ +  LY  + + S        N  V++G  +++    +     I ++              ++ + +LY+G L + K+ L     VW+ +L   + GCI  L ID     +  L  I+K + +   C           C + PC N GIC+  W++  CDC+ T + G +C +EA I  ++G +FM+++ P    +E E+  L F+S+   G++++T ++ S  T +LE  + +G + + +N           +G +     +N  D++WH++++ RR K+LK+ +DD                     I G    + T ++  +   +   I+   +        F+G++    +NG +Y +L K       EL A +   N++    + F S  SY+ +  +  +    L FQ KT  P GL+L+  G+ ND++++E+V G LH + + G+G +  K + +  L+D  WH+V I R  +  H+          D++      TG  N +  G +++GG  ++  +  +  +   +K GFQGC+AS  +N  +         DL+ +A +    ++  C          C  DSC+  G C Q W  +SCDCS T+F GP C D  TT  F +    + Y +    + S   ++LA GF T+  K A L+ +  +  L   L + I    D G + V +   T   +  E    V DG YHIV+F +    ATL++DDL      P G + N                VVDE L+                +G  E     SFQG +SGL  N + + +   E          + L+  S + + P  +    RS+ S              +  +  P+ P+  Q  +  +VA  +CP  ++ E     +    G+  P   F  PN  E
Sbjct:   51 MSFNMKTKSSHGLLVYFDDEGFCDFLEL-LIRNGKLSLRFSIFCAEPA-----------------TVISDTAVND---SRWHTVTIRRNFKNTTLMVDNEIKWVEV-----MSKRRDMTVFSHLFVGGIPPELRSVALRLTSAAVKDEPPFAGWITDVTVNNTE-----CAIINSEGVLMDIC-GTANMCQNGGICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNDWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTV-AFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ----CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDD------------------LSPIEGQMAGDHTQLEFHN---IETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNNLHTVKI-------DTKITTQTTTGAKNLDLKGNLYIGGVAKD--MYMYLPKLVHAKEGFQGCLASVDLNGRL--------PDLMSDALDCVGQIERGC----EGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHL-KDAVLVRVDSSSGLGDFLKLHI----DKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWERDRSQSFQGQLSGLYYNGLKVFNMAAEGDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTASSRRVKQTTPREPQ--QTTDDFLVASAECP--SDDEDIDPCEPSSGGLANP--TFAGPNPPE 1398          

HSP 2 Score: 156.762 bits (395), Expect = 7.063e-38
Identity = 194/921 (21.06%), Postives = 369/921 (40.07%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTY--FSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN----------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN-------QFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN--------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK---------MHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLL----TIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLS--------DRIHVP-DGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  S  L+ Y     +G     DF  + IR+  L     +     + V+S+  V++   H + +        +++D E   + + +   D+     L++G +   ++ SV+  + S  +     F+G I  +T++++   +   I     +   C T+      N+C N     GIC +  ++ +CDC+ T F G  C+                      KE  +A F G +F       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  +             ++ +   M  I +  ++  + +      Q+  + L S+D  ++G      +         FMG +   +Y   +       LAK+  P + I  T + +  NV     I F + +S++V+ K N      + F  +T +P+GLLLF  G+                D+  +EM+ G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + +NT    +   G+         ++LGG  EN+  + F  E  T     G+ GCI   +++           KD+  L E  +   V  +C     +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  LI+     S   L     +  +++  +   I++   ++ G  +    + N+ D  +H VR  +   +  L +DDLS        D   +    I+   V ++  M+ V S       +F G +  L+ N ++ +D  K
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVY--FDDEGF---CDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIP-PELRSVALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQNG----GICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNDWHDVKVTRNLRQ------------HSGIGHAMVTISVDGILTTTGY-----TQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVD------------FQRDGR----SGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQ--------SKDVRRLAEIQKATGVKPSC---SKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQ-RAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQ-NLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPS-------NFIGHLQSLSFNGMSYIDLCK 865          
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Match: ENSORLT00000045162.1 (neurexin 1 [Source:NCBI gene;Acc:101159771])

HSP 1 Score: 315.464 bits (807), Expect = 2.955e-87
Identity = 287/1221 (23.51%), Postives = 514/1221 (42.10%), Query Frame = 2
Query:  755 KYEYL-TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY-------QPSSKKGIHT-DTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNF---------GRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSG-YKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANE-KHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM--------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN-----FNSYILLINKSNADLVP--NFQPRRSDQSL-------------KQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQE 4171
            K EY+ TF  +    Y   ++ I   +  I   FKT Q N  + + G               ++++ +++G   ++I+       +F       N  +    D+ WH+V++      + I++D         Q+++  L +          F     P        LP  P  + F GC+KE+    N+V L +  +  +       +G + +  C  +  + P++F     ++      + +    S  F+T + + L+ +       QP   K   T   DF++IE+ +  LY  + + S        N  V++G  +++    +     I ++              ++ + +LY+G L + K+ L     VW+ +L   + GCI  L ID     +  L  I+K + +   C           C + PC N GIC+  W++  CDC+ T + G +C +EA I  ++G +FM+++ P    +E E+  L F+S+   G++++T ++ S  T +LE  + +G + + +N           +G +     +N  D++WH++++ RR K+LK+ +DD                     I G    + T ++  +   +   I+   +        F+G++    +NG +Y +L K       EL A +   N++    + F S  SY+ +  +  +    L FQ KT  P GL+L+  G+ ND++++E+V G LH + + G+G +  K + +  L+D  WH+V I R  +  H+          D++      TG  N +  G +++GG  ++  +  +  +   +K GFQGC+AS  +N  +         DL+ +A +    ++  C          C  DSC+  G C Q W  +SCDCS T+F GP C D  TT  F +    + Y +    + S   ++LA GF T+  K A L+ +  +  L   L + I    D G + V +   T   +  E    V DG YHIV+F +    ATL++DDL      P G + N                VVDE L+                +G  E     SFQG +SGL  N + + +   E          + L+  S + + P  +    RS+ S              +  +  P+ P+  Q  +  +VA  +CP  ++ E     +    G+  P   F  PN  E
Sbjct:  275 KEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK-----------SADYVNLALKNGAVSLVINLGSG---AFEALVEPVNGKFN---DNDWHDVKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTV-AFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVDFQRDGRSGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDVRRLAEIQKATGVKPSCSKEPSKQ----CLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSYDGSKFMKVQLPVVMHTEAEDVSLRFRSQRAYGILIATTSRDSADTLRLE--LDSGRVRLTVNLDCIRINCTSSKGPETIFAGQNLNDNEWHTVRVFRRGKSLKLTVDD------------------LSPIEGQMAGDHTQLEFHN---IETGIVTEKRFMSTVPSNFIGHLQSLSFNGMSYIDLCKNGDIDYCELNAMIGFKNIIAD-PVTFKSRSSYVTLTTLQAYYSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVSDLGNGAHLIKGNSNKPLSDNQWHNVIISRDTNNLHTVKI-------DTKITTQTTTGAKNLDLKGNLYIGGVAKD--MYMYLPKLVHAKEGFQGCLASVDLNGRL--------PDLMSDALDCVGQIERGC----EGPSTTCQEDSCANQGVCLQQWEGFSCDCSMTTFGGPLCNDAGTTYIFGRDGGLITYTWPPNDRPSTRADRLAIGFSTHL-KDAVLVRVDSSSGLGDFLKLHI----DKGKVAVVFNVGTDDINIEEKAKFVNDGKYHIVKFTRSGGNATLQVDDLPVNERYPTGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQTTIQIGGWERDRSQSFQGQLSGLYYNGLKVFNMAAEGDSNVKIQGSVRLVGDSPSSITPQSSTTANRSETSTSIMEITTTTASSRRVKQTTPREPQ--QTTDDFLVASAECP--SDDEDIDPCEPSSGGLANP--TFAGPNPPE 1406          

HSP 2 Score: 154.451 bits (389), Expect = 4.180e-37
Identity = 195/931 (20.95%), Postives = 367/931 (39.42%), Query Frame = 2
Query: 1403 VSFTGKSDYLQAFGI-RSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTY--FSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCN--------------------------------------KEAIIAEFNGYQFMRIKFP-NTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG---------NKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIK-YLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRN----YFELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESN--------------DYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGK---------MHLGGYLENQSIVTFDNE--TPRSKGGFQGCIASFYVNNSVSTDTVILYKDL--LKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLL----TIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLS--------DRIHVP-DGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLK 3904
            + FTG       F +  +  +++ S + KT  S  L+ Y     +G     DF  + IR+  L     +     + V+S+  V++   H + +        +++D E   + + +   D+     L++G +   ++ SV+  + S  +     F+G I  +T++++   +   I     +   C T+      N+C N     GIC +  ++ +CDC+ T F G  C+                                      KE  +A F G +F       N  +S  +   L FK+   NGL+L T      + D + + ++NG++ +++N G G         N KF       D+ WH +K+ R  + + + +D        + + D  ++G   +  +G +        D     VSN+              FMG +   +Y   +       LAK+  P + I  T + +  NV     I F + +S++V+ K N      + F  +T +P+GLLLF  G+                D+  +EM+ G L+++ + GSG  +  + +  +NDG W+ V             F+ DG+       + +NT    +   G+         ++LGG  EN+  + F  E  T     G+ GCI   +++           KD+  L E  +   V  +C     +    C  + C   G C + W +Y CDCS T + G  CE  +T   +     ++  +  ++       ++  F++  R +  LI+     S   L     +  +++  +   I++   ++ G  +    + N+ D  +H VR  +   +  L +DDLS        D   +    I+   V ++  M+ V S       +F G +  L+ N ++ +D  K
Sbjct:   28 LEFTGAEGQWARFPVWNACCESEMSFNMKTKSSHGLLVY--FDDEGF---CDFLELLIRNGKLSLRFSIFCAEPATVISDTAVNDSRWHTVTIRRNFKNTTLMVDNEIKWVEVMSKRRDMTVFSHLFVGGIP-PELRSVALRLTSAAVKDEPPFAGWITDVTVNNTECAI---INSEGVLMDICGTA------NMCQNG----GICSLIDNEPTCDCSHTGFQGKDCSEEDNYTEGLAHLMMGDQDRIKGQRGEAWLLRSLLSTPGKEEYVATFKGSEFFCYDLSLNPIQSSSDEITLSFKTLQRNGLMLHTGK----SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFN------DNDWHDVKVTRNLRQVTISVD-GILTTTGYTQEDYTMLGSDDFFYVGGS----PSTADLPGSPVSNN--------------FMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGTVAFKCENVATLDPITFETPESFIVLNKWNAKKTGSISFDFRTTEPNGLLLFSHGKPKQQPKDSKSPQTFKVDFFAIEMLEGHLYLLLDMGSGTTKTKAVNKKVNDGEWYHVD------------FQRDGR----SGTISINTLRTAYTAPGESEILDLDDNLYLGGLPENKMGLVFPTEVWTALLNYGYVGCIRDLFIDGQ--------SKDVRRLAEIQKATGVKPSC---SKEPSKQCLSNPCQNNGICREGWNRYVCDCSGTGYLGRSCEREATILSY-DGSKFMKVQLPVVMHTEAEDVSLRFRSQ-RAYGILIATTSRDSADTLRLELDSGRVRLTVNLDCIRINCTSSKGPETIFAGQ-NLNDNEWHTVRVFRRGKSLKLTVDDLSPIEGQMAGDHTQLEFHNIETGIVTEKRFMSTVPS-------NFIGHLQSLSFNGMSYIDLCK 873          
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Match: ENSORLT00000036135.1 (neurexin-2 [Source:NCBI gene;Acc:101165088])

HSP 1 Score: 314.309 bits (804), Expect = 8.057e-87
Identity = 319/1351 (23.61%), Postives = 552/1351 (40.86%), Query Frame = 2
Query:  155 LSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYL---TCIIDLSKIDGLIHEWHTIMI--NFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAI--EPSFSGRISAVRIVRFSRLYLIPVMIQFQS---DAMNTCYFDS-----NFC------------------RYCSSS------------------KKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTD----TDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSL-DDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLL--IKKNSSISSGCKTSEEMH---SLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYK-RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEK-HYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNT---------------VVDEELM------------AIVGSSEVSSKNSFQGFISGLTINEIAILDTLKEN 3910
            LSF +K +    L+ Y +D     F+ L L+     RL +    H +              P +L   T + D          WH +M+  N+ +  +++   + + +V         KR +  +   ++ GG+   ++  A      SS +  EP F G IS +++        +P+++  Q+   D    C  DS       C                  RYC+                    ++  K    TF  N    +      I      I   F+T Q N  L + G           +   ++ + +  G F  ++  P S        KFH         D+ WH+V++      + I +D         Q+++  L +  L    ++  +  T          LP  P  + F GC+K++    N   L +  +  ++      +G L    C  +  ++PV+F   S +L      + +    S  F+T +   L+ +   S  G   D     DF+++E+ D  LY  + + S       S+  + NG   ++    +     I ++ +N     +     ++ +G +++G L ++ + L +   VW+  LG  F GC+  L ID     L  L  ++  + +SS C  ++E H   S + CAN     G C+  W++  CDC+ T + G +C KEA    ++G  ++++  P T  +E E+  L F S+   GL+L+T +Q S   D L + +  G + + +N G+G +     E   D++WH++K+ RR KNL++ +D+   E +        + G    +  +  + G   +     +V ++              F+G++    +NG  Y +  K       EL A     +++    + F +  SYL    +  +    L FQ KT  P GL+LF  G+ +D++++E+V G +H +++ G+G    K +    LND LWH+V I R  +  H           DSR       G  N +  G++++GG    +S+ +       S+ G++GC+AS  +N  +         DLL +A  K   V+  C          C+ DSC   G C Q W  +SCDC+ T++ GP C D  TT  F K  + + Y ++  ++ S   ++LA GF T  +K A L+ +  T  L   L + I    D G I V +   T   +  E  + V DG YH+VRF +    ATL++D+       P G   N                VVDE L+            A +          FQG ISGL  N + +L    E+
Sbjct:   47 LSFILKTNITKALVLYLDDGGNCDFLELLLVDG---RLQLRFTIHCA-------------EPAFLHTETYVND--------QRWHRVMLTRNYRETRLVVDNEEKTAEVK-------SKRKEMVVASDLYVGGISPDVRLSA----LTSSTVKYEPPFQGFISNLKVGE-----ALPILLDGQAVHNDLEYICATDSPCSNKGICSINQGEVLCNCISTSYRGRYCNEVVQKEVEGLAHLMLNRQVYRQGQKESVATFRGNEFFSFNLSQTPIQSNLDEITLSFRTLQRNGLLLHTGRSADYVNLSLRNGALWLVINLGSGAFEALV-EPAS-------GKFH---------DNVWHDVRVTRNLRQVTILVDGILTTTGYTQEDYTMLGSDDL---FYIGGSLNT--------ADLPGSPVSNNFMGCLKDVIYKNNEFRLELSRLAEQRDPKISIHGDLVFS-CENVEALEPVTFDTPSAFLTLPRWNTKKTGAISFDFRTSEPSGLLLFSHGSLHGAQPDRKPRADFFAVELLDGFLYLVMDMGSGSIKVKASDKRLDNGEWCHVDFQRKGRSGFISVNSQNIPFTANEGSEILDLDGDMFLGGLPEERQSLILPPEVWTASLGLGFVGCVRDLFIDGQSRNLWRLAEVQIAAGVSSFC--TKETHVRCSRDTCANG----GHCREGWNRHICDCSGTGYLGPSCGKEATTVGYDGSMYLKVGLPRTMHTEAEDVSLRFMSQRAFGLLLATTSQQS--ADTLRVELDAGRVKLTVNLGKGPETLLVGEKLNDNEWHTVKVARRGKNLQLSVDNVTAEGH--------MTGAHTRLEFNNIETGIMTERRFISVVPSN--------------FIGHLQALSFNGMLYLDQCKNGDISYCELNARFGLRHIIAN-PVTFLTQASYLAFSTLQAYASMHLFFQFKTTSPDGLILFNSGDGSDFIVVEIVKGYIHYVFDLGNGPSLMKGNSDRPLNDNLWHNVVISRDNNNVHVLKI-------DSRTVTQHANGARNLDLKGELYIGGV--GKSMYSSLPRLIASREGYKGCLASVDLNGRL--------PDLLADALHKVGDVERGC----GGPSTTCTEDSCHHQGVCLQQWEGFSCDCTMTTYGGPFCSDPGTTYIFGKGGALITYTWAPNERPSTRADRLAVGFSTQ-QKDAILVRVESTHGLGDYLQLHI----DQGKIGVIFNVGTDDITIDEPAVIVNDGKYHVVRFTRSGGNATLQVDNHPVIERYPPGHYDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGQDKGRPFQGQISGLYYNGLQVLKLAAES 1271          

HSP 2 Score: 154.451 bits (389), Expect = 4.161e-37
Identity = 195/887 (21.98%), Postives = 356/887 (40.14%), Query Frame = 2
Query: 1463 AKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLD-DTKILSVSHHVWSGILGTYFSGCIFSLTIDDS-PIQLDLLIKKNSSISSGCKTSEEMHSLNVCA-NQPC-NEGICQIEWDQRSCDCTKTNFTGNTCN-----------------------KEAIIAEFNGYQFMRIKFPNT-YKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENC-----FDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLI-IGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYF----ELAKKLSP-LNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGE----------SNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVP--VNTGGLNFNHFGKMHLGGYLE-NQSIVTFDNETPRSKG-GFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENY--CSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFM-ESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG--------IDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILL 3931
             + S   KT+ +  L+ Y          + DF  + + D  L     ++    + + +   V++   H ++L       R+++D E     + +   ++     LY+G +  D ++ +++           F G I +L + ++ PI LD           G     ++    +CA + PC N+GIC I   +  C+C  T++ G  CN                       ++  +A F G +F       T  +S ++   L F++   NGL+L T      + D + + ++NG++++++N G G   F+ L         D+ WH +++ R  + + + +D        + + D  ++G   L  IG +  N  D+  S    VSN+              FMG +   IY    +      LA++  P ++I         NV     + F +  ++L +P+ N      + F  +T +PSGLLLF  G             D+  +E+++G L+++ + GSG  +  +    L++G W  V   R   K  S    V+ +      ++P   N G    +  G M LGG  E  QS++        S G GF GC+   +++         L++  L E      V   C      KE +  CS D+C+ GG C + W ++ CDCS T + GP C   +TT  +     YL              ++  F +  R F  L++    QS   L     ++  D G +++      G  + +   +LN  D  +H V+  +      L +D+++   H+           I+   + +   +++V S       +F G +  L+ N +  LD  K    SY  L
Sbjct:   45 GELSFILKTNITKALVLYLDDGG-----NCDFLELLLVDGRLQLRFTIHCAEPAFLHTETYVNDQRWHRVMLTRNYRETRLVVDNEEKTAEVKSKRKEMVVASDLYVGGISPDVRLSALTSSTVK--YEPPFQGFISNLKVGEALPILLD-----------GQAVHNDLEY--ICATDSPCSNKGICSINQGEVLCNCISTSYRGRYCNEVVQKEVEGLAHLMLNRQVYRQGQKESVATFRGNEFFSFNLSQTPIQSNLDEITLSFRTLQRNGLLLHTGR----SADYVNLSLRNGALWLVINLGSG--AFEALVEPASGKFHDNVWHDVRVTRNLRQVTILVD-GILTTTGYTQEDYTMLGSDDLFYIGGSL-NTADLPGSP---VSNN--------------FMGCLKDVIYKNNEFRLELSRLAEQRDPKISIHGDLVFSCENVEALEPVTFDTPSAFLTLPRWNTKKTGAISFDFRTSEPSGLLLFSHGSLHGAQPDRKPRADFFAVELLDGFLYLVMDMGSGSIKVKASDKRLDNGEWCHVDFQR---KGRSGFISVNSQ------NIPFTANEGSEILDLDGDMFLGGLPEERQSLILPPEVWTASLGLGFVGCVRDLFIDGQSRN----LWR--LAEVQIAAGVSSFC-----TKETHVRCSRDTCANGGHCREGWNRHICDCSGTGYLGPSCGKEATTVGY-DGSMYLKVGLPRTMHTEAEDVSLRFMSQ-RAFGLLLATTSQQSADTL-----RVELDAGRVKLTVNLGKGPETLLVGEKLN--DNEWHTVKVARRGKNLQLSVDNVTAEGHMTGAHTRLEFNNIETGIMTERRFISVVPS-------NFIGHLQALSFNGMLYLDQCKNGDISYCEL 850          
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Match: nrxn3b (neurexin-3b [Source:NCBI gene;Acc:101156134])

HSP 1 Score: 311.227 bits (796), Expect = 1.359e-85
Identity = 306/1270 (24.09%), Postives = 523/1270 (41.18%), Query Frame = 2
Query:  134 NVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIE-PSFSGRISAVRI---------VRFSRLYLIPVMIQFQSDAMNTCYF--DSNFC---------RYCSSSKKCTKYEYL------TFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFY---TRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDF-------QKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDI---CMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY---QPSSKKGI----HTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKI-LSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKN--SSISSGCKTSEEMHSLNVCANQPC-NEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYK-RKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPR---SKGGFQGCIASFYVNNSVSTDTVILYKDLLKEAN-EKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSI--NQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDG 3769
            + ++ S L+FQ K     GL+ Y +D     F+ L  LS  K++L V +   ++T  +  M  +                       WH   IN       L  +  +    +       + F   + D +F GGLPE ++  A   +   S  E P+F G IS +            +  RL +I +  +   +    C       +C         RYC+  K+      L      TF  +    Y    + I   +  I   FKT Q N  L + G               ++++ ++DG   ++I+       +      RKF+         D+ WHN+++      + I++D         Q+++  L +          F     P        LP  P  + F GC++E+    N++ L +  +            KL  DI   C  +  + P++F     +L      + R    S  F+T + + LI +   +P  ++      +   DF+++E+ D AL+  + + S       +   V++   +++ +  +     I ++        S     ++ EG LY+G L   +  L +   +W+ +L   + GCI  L ID     +  + +    + I   C      H    C + PC N G C+  W++  CDCT T F  +TC +EA I  F+G  +M++  PN   +E E+  L F S+   GL+++  ++ S  T +LE  + +G + + +N G+G +     E   D++WHS+++ RR KN K+ +D++  E        + +I I +  I + F +   I  SS                   QFF        +NG  Y ++ K       EL A      ++    + F +  SYL +  +  +    L FQ KT  P G +LF  G+ ND++ +E+V G +H +++ G+G    K +    LND  WH+V I R  S TH+   +VD K  +   +     G  N +  G + +GG   N     + N  P+   S+ GFQGC+A+  +N  +         DL+ +A      ++  C          C  DSC+  G C Q W  ++CDCS TS++G  C D  TT  F K    + Y +   ++ S   ++LA GF T T     L+ I     L+  + + I    + G + V +   T   S  E+   V DG YH+VRF ++   ATL++D+     H P G
Sbjct:   40 DASSTSDLTFQFKTSASEGLLLYFDDGGYCDFL-LLTLSEGKLQLRVSIDCAETTITSAKMVND---------------------SRWHFAAINRENLRTGLAVDGQTRTGEV----RPQRHFMKIVSD-LFLGGLPEDIRMSA---ITLPSVCELPAFRGVISDLSYGSKLPTLINSQKVRLEMIGLCTENPCENGGICSLADGETYCDCSRTGYVGRYCTEGKRAEGTVKLREENVATFRGSEYFCYDLSQNPIQSSSDEITLSFKTWQRNGLLLHTGK-----------SADYVNLALKDGAVSLVINLGSGAFEAIVEPVNRKFN---------DNSWHNIKVTRNLRQVTISVDGILTTTGYTQEDYTMLGSDDF-------FYVGGSP----STADLPGSPVSNNFMGCLQEVVYKNNDIRLELSRLARID----DPKMKLQGDIVFECENVPTLDPINFETPDSFLALPKWNTKRVGSISFDFRTTEPNGLILFTQGRPQDRRDAKGQKNNKVDFFAVELLDGALFLLLDMGSGTIKVKATQAKVNDDAWYHVDIQRDGRSGIISVNSHRTPFTASGENEILDLEGDLYLGGLPYNRAGLVLPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQIAQMQNITDIKFSCSKITGKH----CDSSPCKNNGACREGWNRFVCDCTGTGFWDSTCEREASILSFDGTMYMKVVMPNVMHTEAEDVSLRFMSQRAFGLLMAASSRESADTLRLE--LDSGRVKLTVNLGKGPEVLYAGEKLNDNEWHSVRVVRRGKNFKLIVDEDMAE-------GIAVIAIIWCSIYNVFSSLKRIVVSS-------------------QFFHFQSNSLKFNGMQYIDMCKNGDIDFCELNARFGMRFIIAD-PVTFKTKASYLGLATLQAYTTMHLFFQFKTTSPDGFILFNSGDGNDFIAVELVKGFIHYVFDLGNGPSLLKGNSDSPLNDNQWHNVVITRDASNTHT--LKVDSKSVNQNVN-----GAKNLDLKGDLFIGGLGPNM----YQN-LPKLVVSREGFQGCLATVDLNGRL--------PDLISDALFRSGQIERGC----EGPSTTCQEDSCANMGVCIQQWENFTCDCSMTSYTGTYCNDPGTTYIFGKGGGLITYTWPNNERPSTRADRLAVGFST-TINDGILVRIDSASGLADFIMLHI----EQGKVGVTFNIGTVDISVKETSTVVNDGKYHLVRFTRNGGNATLQVDNWPINEHFPSG 1182          
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 3089.67 bits (8009), Expect = 0.000e+0
Identity = 1519/1528 (99.41%), Postives = 1521/1528 (99.54%), Query Frame = 2
Query:   17 MSLTNMQNXXXXXXXXXXXXXEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCS SKKCTKYEYLTFDHNSEIGYAFPVDV SEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFT  SDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRI+LDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNS+STDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELM IVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSN DLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGG FMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV
Sbjct:    1 MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSLSKKCTKYEYLTFDHNSEIGYAFPVDVNSEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSISTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMVIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNVDLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGTFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 1528          
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 3076.19 bits (7974), Expect = 0.000e+0
Identity = 1514/1523 (99.41%), Postives = 1516/1523 (99.54%), Query Frame = 2
Query:   32 MQNXXXXXXXXXXXXXEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            MQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCS SKKCTKYEYLTFDHNSEIGYAFPVDV SEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFT  SDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRI+LDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNS+STDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELM IVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSN DLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGG FMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV
Sbjct:    1 MQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSLSKKCTKYEYLTFDHNSEIGYAFPVDVNSEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSISTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMVIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNVDLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGTFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 1523          
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 3019.18 bits (7826), Expect = 0.000e+0
Identity = 1493/1528 (97.71%), Postives = 1495/1528 (97.84%), Query Frame = 2
Query:   17 MSLTNMQNXXXXXXXXXXXXXEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCS SKKCTKYEYLTFDHNSEIGYAFPVDV SEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFT  SDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRI+LDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN                          IQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNS+STDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELM IVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSN DLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGG FMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV
Sbjct:    1 MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSLSKKCTKYEYLTFDHNSEIGYAFPVDVNSEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN--------------------------IQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSISTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMVIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNVDLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGTFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 1502          
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 3007.24 bits (7795), Expect = 0.000e+0
Identity = 1488/1523 (97.70%), Postives = 1490/1523 (97.83%), Query Frame = 2
Query:   32 MQNXXXXXXXXXXXXXEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTXXXXXXXXXXXXCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 4600
            MQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCS SKKCTKYEYLTFDHNSEIGYAFPVDV SEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFT  SDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRI+LDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN                          IQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNS+STDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELM IVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSN DLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGG FMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV
Sbjct:    1 MQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSLSKKCTKYEYLTFDHNSEIGYAFPVDVNSEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN--------------------------IQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCIASFYVNNSISTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPDGIDQNTVVDEELMVIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFNSYILLINKSNVDLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARPQCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRSTNKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCGGTFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEKSNQSLLTKIPNKRKSKRKRSGETKEWYV 1497          
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Match: SMESG000066308.1 (SMESG000066308.1)

HSP 1 Score: 1662.89 bits (4305), Expect = 0.000e+0
Identity = 821/827 (99.27%), Postives = 822/827 (99.40%), Query Frame = 2
Query:   17 MSLTNMQNXXXXXXXXXXXXXEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEYLTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTDI 2497
            MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCS SKKCTKYEYLTFDHNSEIGYAFPVDV SEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFT  SDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRI+LDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGT I
Sbjct:    1 MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQIKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISMSKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKVNIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGRISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSLSKKCTKYEYLTFDHNSEIGYAFPVDVNSEINRSINFQFKTKQDNSFLFYIGSLPGLAEQFQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLNSDICMEMFPIKPVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHNIVLHFELPVIRIILDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMHSLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQFMRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMPIIGIKYLIIGSAFDNGTGI 827          

HSP 2 Score: 62.3882 bits (150), Expect = 3.128e-9
Identity = 109/552 (19.75%), Postives = 220/552 (39.86%), Query Frame = 2
Query: 2141 YKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRG------NKKF---KTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFNNFLEMDMP-IIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMENQFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHSTKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGES------NDYLILEMVNGLLHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPDDSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGG--FQGCIASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKE-NYCSIDSCSFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSIIKKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQVEYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDD 3739
            +K++ +N +L +   LP    L+ Q Q S  T  + +++++G  +I+++  +        +KF      + C DDKWH++++K  R ++ + +DD   EF N     +   I +K+      F      Q      +S     + ++   +N   +  +        N+    K    LN ++   + P        ++F     YL    +      +     KT +   L+ +            D+  +E+ +  L+      S    K+  +  +++GL H+  IV H         R+    ++   ++  N   + F   G +++G  L++  I++  +       G  F GCI S  +++S       +  DLL + N    +   C  +      N C+   C+  G C   W + SCDC+ T+F+G  C   +  A+F  +  ++  K+    K  +      F++      P   I+ TQ+     T +++I    G I +      G   F ++  N  D  +H ++ ++ R    + +DD
Sbjct:  279 FKTKQDNSFLFYIGSLPG---LAEQFQIS-KTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDKWHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYYRQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGK----LNSDICMEMFPIK-----PVSFTRNSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAYQPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLHN--IVLHFELP---VIRIILDKENYVLNISTNYHDIEFE--GSLYIGS-LDDTKILSVSHHVWSGILGTYFSGCIFSLTIDDSP------IQLDLLIKKNSS--ISSGCKTSEEMHSLNVCANQPCN-EGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGY-QFMRIKFPNTYKSEVENFYLMFKSK----LPNGLILSTQNQFSGTTDKLEIFMQNGSIYILLNFGRGNKKF-KTLENCFDDKWHSIKMKRRRKNLKVWIDD 794          
The following BLAST results are available for this feature:
BLAST of neurexin-1 isoform X16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NRXN11.691e-9122.50neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN11.805e-9122.62neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN14.789e-9122.73neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN19.721e-9122.56neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
NRXN18.560e-8922.51neurexin 1 [Source:HGNC Symbol;Acc:HGNC:8008][more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrx-13.732e-6223.50NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-14.691e-6223.65NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-11.323e-6023.71NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
nrx-12.210e-6023.56NeuReXin related [Source:UniProtKB/TrEMBL;Acc:I2H... [more]
epi-13.267e-922.04Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrx-11.605e-8422.66gene:FBgn0038975 transcript:FBtr0084256[more]
Nrx-11.605e-8422.66gene:FBgn0038975 transcript:FBtr0334607[more]
Nrx-13.497e-8422.78gene:FBgn0038975 transcript:FBtr0334610[more]
Nrx-13.618e-8422.78gene:FBgn0038975 transcript:FBtr0334612[more]
Nrx-13.618e-8422.78gene:FBgn0038975 transcript:FBtr0334608[more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrxn1a1.718e-9023.36neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a2.564e-9023.63neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a2.693e-8723.17neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a6.713e-8723.42neurexin 1a [Source:NCBI gene;Acc:565531][more]
nrxn1a1.883e-8623.72neurexin 1a [Source:NCBI gene;Acc:565531][more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NRXN31.837e-8523.50neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN37.703e-8523.42neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN31.140e-8324.83neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN37.075e-8323.35neurexin 3 [Source:NCBI gene;Acc:100379902][more]
NRXN37.484e-8324.71neurexin 3 [Source:NCBI gene;Acc:100379902][more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrxn12.699e-9222.61neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn13.123e-9222.67neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn13.366e-9222.55neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn17.470e-9222.50neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
Nrxn11.190e-8922.44neurexin I [Source:MGI Symbol;Acc:MGI:1096391][more]
back to top
BLAST of neurexin-1 isoform X16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULB1|NRX1A_HUMAN8.123e-9122.50Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 S... [more]
sp|Q9Y4C0|NRX3A_HUMAN1.745e-8623.41Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 S... [more]
sp|Q9CS84|NRX1A_MOUSE8.315e-8422.94Neurexin-1 OS=Mus musculus OX=10090 GN=Nrxn1 PE=1 ... [more]
sp|A1XQX0|NR1AA_DANRE4.177e-8324.10Neurexin-1a OS=Danio rerio OX=7955 GN=nrxn1a PE=2 ... [more]
sp|Q63372|NRX1A_RAT5.950e-8322.87Neurexin-1 OS=Rattus norvegicus OX=10116 GN=Nrxn1 ... [more]
back to top
BLAST of neurexin-1 isoform X16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PG263.218e-10424.87Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V4AS841.864e-9927.23Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A341C6072.712e-9823.45neurexin-1 isoform X16 OS=Neophocaena asiaeorienta... [more]
A0A2Y9R6E53.234e-9823.52neurexin-1 isoform X9 OS=Trichechus manatus latiro... [more]
A0A2Y9SE174.152e-9823.45neurexin-1 isoform X16 OS=Physeter macrocephalus O... [more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000000309.26.980e-8823.03pep primary_assembly:Astyanax_mexicanus-2.0:21:105... [more]
ENSAMXT00000011949.24.816e-8422.30pep primary_assembly:Astyanax_mexicanus-2.0:6:2098... [more]
nrxn3a4.536e-8322.63neurexin 3 [Source:NCBI gene;Acc:103035103][more]
nrxn3a1.954e-8222.09neurexin 3 [Source:NCBI gene;Acc:103035103][more]
nrxn3a1.695e-8022.38neurexin 3 [Source:NCBI gene;Acc:103035103][more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002142.13.787e-7823.77pep scaffold:Pmarinus_7.0:GL476386:209124:506099:1... [more]
ENSPMAT00000004299.19.005e-3426.56pep scaffold:Pmarinus_7.0:GL477235:143017:163597:1... [more]
ENSPMAT00000007718.18.634e-1822.06pep scaffold:Pmarinus_7.0:GL476589:4931:52526:1 ge... [more]
cntnap2b4.917e-1418.72contactin associated protein like 2b [Source:ZFIN;... [more]
ENSPMAT00000000532.16.091e-1426.67pep scaffold:Pmarinus_7.0:GL482851:1933:10168:1 ge... [more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468731.314e-1620.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474228.655e-1522.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392584.936e-1323.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364197.532e-926.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458348.530e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of neurexin-1 isoform X16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013637.24.649e-9223.06neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000034989.15.132e-8922.87neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000045162.12.955e-8723.51neurexin 1 [Source:NCBI gene;Acc:101159771][more]
ENSORLT00000036135.18.057e-8723.61neurexin-2 [Source:NCBI gene;Acc:101165088][more]
nrxn3b1.359e-8524.09neurexin-3b [Source:NCBI gene;Acc:101156134][more]
back to top
BLAST of neurexin-1 isoform X16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066308.10.000e+099.41SMESG000066308.1[more]
SMESG000066308.10.000e+099.41SMESG000066308.1[more]
SMESG000066308.10.000e+097.71SMESG000066308.1[more]
SMESG000066308.10.000e+097.70SMESG000066308.1[more]
SMESG000066308.13.128e-999.27SMESG000066308.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018208 ID=SMED30018208|Name=neurexin-1 isoform X16|organism=Schmidtea mediterranea sexual|type=transcript|length=4755bp
TTTCGCATTTTAAAAAATGTCATTGACTAATATGCAAAATATTTTTATTT
TTATTTTAATTATCAGTTCAAAAAAATCGGAATTTCAAATTTTCATTGGC
ATATCTGCTTTGTCGGTTTATCATCCGTCAATAAATGTAAACACAAACTC
ATCTCTCTCATTTCAGATTAAAATTGATACATTAATGGGATTAATCTTTT
ACGCCGAAGACATTAAAACTAATTCTTTTGTATCTTTAAAGCTGCTTTCC
AGTGCCAAAGTAAGACTTGATGTTGGTTTATTCTATCATGATAGTACACG
AGAAAACATATCAATGTCAAAAGAATATCCGACTGCACCGGATTATTTGA
CGTGCATTATTGATTTATCGAAAATCGATGGATTAATTCACGAATGGCAC
ACAATAATGATTAATTTTCATAAAAAATCAATTATTTTACAATTCAATCA
GTTTTCTGAAAAAGTCAACATCCCAATCGGCTACAACAGCTTTAAGCGAT
TTGACGGGTTTTTAGGAGACACAATGTTTTTTGGTGGCTTGCCAGAGAAA
CTGAAACAGGACGCCTCTCATCGAGTTTTTTTCTCTTCGGCTATTGAGCC
GTCCTTTAGTGGAAGAATCAGTGCAGTTAGAATCGTTCGCTTTAGCCGAC
TCTATCTAATCCCAGTAATGATACAATTCCAATCAGATGCTATGAACACT
TGCTATTTTGATTCCAATTTCTGCCGATATTGTTCTTCATCAAAGAAATG
TACGAAATATGAATATCTAACCTTCGACCACAATTCTGAAATCGGGTATG
CTTTTCCCGTGGACGTGATTTCGGAAATAAATCGCTCCATTAATTTTCAG
TTCAAAACCAAACAAGATAATTCATTTTTATTTTACATTGGTTCATTGCC
TGGTTTAGCAGAACAATTTCAGATTTCCAAGACACAGTTCATTTCCGTCT
ATATTGAAGACGGATTATTTCATATTATCATTTCAAATCCTCAGTCAGTT
GATTCATCATTTTACACTAGAAAGTTTCATTGTAACAGTATTTACAAAAC
CTGCGCGGACGACAAATGGCATAATGTTCAAATCAAAGAATTTAGAAATG
ATATCGTGATTACTCTCGATGATTTTCAAAAAGAATTTAAAAATCTCTCA
AATCAACAATTAACCAAAACTATTCACATGAAATTTGCCAAAGCCACAGA
GCCGTTTCAATACTACAGGCAAACACAGCTACCACAATACCCCCCTTTAA
GCCAATTCAGAGGTTGCATGAAAGAGATTTACTTACATCAAAACAACGTA
ACTTTAAATATAGTCGAAATGGTTACCAAAAAAGTTTACAACTTTCATTC
GAATGGAAAACTTAATTCTGACATATGTATGGAAATGTTTCCTATTAAGC
CTGTGTCATTCACCGGAAAATCTGATTATCTTCAGGCATTCGGCATCCGA
TCGGTCAGAAAGGCAAAGTTCAGTCTTAGTTTCAAAACTCACAAATCAGA
TTGTTTAATTGCATATCAACCCTCATCAAAAAAAGGAATTCACACTGACA
CTGATTTTTATTCAATTGAAATTCGAGATTTTGCTCTATATTTTTCAATT
GGACTTAATAGCGTAGTTTACAGTAAGGTTATGTCAAACTACAATGTATC
CAATGGTCTTTTACATAATATTGTATTACATTTTGAACTGCCTGTCATCA
GAATTCTCTTAGATAAAGAAAATTATGTTTTGAACATATCGACCAATTAT
CATGATATTGAATTTGAAGGTTCTTTGTACATAGGTTCATTAGACGACAC
AAAAATTCTATCAGTTTCTCATCACGTTTGGTCGGGGATATTGGGAACAT
ACTTTAGCGGTTGCATTTTTAGTTTGACAATTGATGATAGTCCCATTCAA
TTGGATTTGTTAATAAAGAAAAATTCTTCTATTTCTTCTGGATGCAAAAC
ATCAGAAGAGATGCATTCATTAAATGTCTGTGCCAATCAACCATGCAATG
AAGGCATCTGTCAAATCGAATGGGATCAACGAAGCTGTGATTGCACAAAA
ACGAATTTCACTGGAAATACTTGCAACAAAGAGGCTATTATTGCTGAATT
TAATGGATATCAGTTTATGAGAATCAAATTTCCCAATACATACAAATCTG
AAGTTGAAAATTTCTATTTGATGTTCAAATCAAAACTCCCAAATGGTCTT
ATATTATCTACTCAAAACCAATTTTCTGGAACAACTGACAAACTGGAAAT
CTTTATGCAAAATGGAAGTATTTATATTCTACTGAATTTTGGAAGAGGAA
ATAAAAAATTTAAGACACTTGAAAATTGTTTCGATGATAAATGGCATTCT
ATTAAAATGAAAAGAAGACGGAAAAATCTCAAAGTTTGGATTGATGATAA
CTATTACGAATTCAACAATTTTCTCGAAATGGATATGCCTATTATTGGAA
TTAAGTATTTGATAATTGGTTCTGCATTCGATAATGGAACTGATATCCAG
GATTCGTCTTCAAAACTAGTTTCAAACGACATCATCCATTTGGGTAAAGT
GAAAAGAATGGAAAATCAGTTTTTTATGGGTTATATGATGCATTTTATCT
ATAACGGGAGGAATTATTTTGAGTTGGCGAAAAAATTGTCACCGCTAAAT
ATTGAGCTCACAGCGTCTTTGCAGCCAGCAAATGTGATGAGGCAATTTGC
CATAAATTTTCATTCAACCAAATCATATCTTGTGATTCCAAAAGTCAATA
TTTTTGGAGATTTCAGATTAGAATTCCAAATGAAAACTCTACAACCTTCG
GGACTTCTCTTATTTCTTCAAGGAGAAAGTAACGACTACCTCATTTTGGA
AATGGTCAATGGCCTTCTACATATCATATATAATTGGGGCAGTGGTTATA
AAAGAAAAATTTCCGAAAGTGGTTTACTAAATGATGGATTATGGCATAGT
GTTAAAATTGTTAGGCACATGTCAAAAACACATTCATTTGCTTTTCGAGT
TGATGGAAAGCCTGACGATTCAAGAGCAGATGTTCCTGTGAATACTGGTG
GTCTCAATTTTAATCATTTTGGTAAAATGCATCTCGGGGGTTATTTAGAA
AATCAGTCTATAGTCACGTTCGATAATGAGACTCCAAGATCAAAAGGAGG
GTTTCAAGGATGTATAGCATCATTCTATGTGAACAATTCAGTATCAACTG
ACACAGTTATTTTGTACAAAGACCTACTCAAAGAAGCAAATGAGAAACAC
TACGTTGATGAAAATTGTCCAGATAACCATAATGATAAAGAAAACTATTG
CTCCATAGATTCGTGTAGTTTTGGAGGAAAATGTACACAGCATTGGATGA
AATATAGTTGTGATTGTTCCTCGACTTCGTTTTCAGGCCCAAAGTGTGAG
GACGTGTCAACTACAGCTCAATTTGTCAAACATCCATCATATTTAGTTTA
CAAATACTCTATCATAAAAAAGCACTCAATTAACCAATTGGCCTTCGGCT
TTCAAACAAATACTCGCAAATTTGCGCCACTGATTTCAATAATCGGAACT
CAGAGCCTAAGTCCCTTATTAACAATTGAAATTAAAATTGTGAATGATTA
CGGTTTTATTCAAGTAGAATACTACACAAATACTGGAACTCATTCGTTTA
TGGAATCTCGACTAAATGTCATTGATGGTTTATATCATATAGTACGTTTC
CGAAAAGATAGAATGGCAGCAACTCTAAAGCTGGACGATTTATCTGACCG
TATACATGTACCAGACGGTATAGATCAAAATACAGTTGTTGACGAAGAGT
TGATGGCCATTGTTGGCAGTAGTGAAGTTTCCAGCAAAAATTCATTTCAA
GGATTTATTTCAGGTTTAACAATCAACGAAATTGCAATTTTGGATACATT
AAAAGAAAATTTCAATTCCTACATTCTCCTAATTAACAAATCGAATGCAG
ATCTCGTTCCGAATTTTCAACCTCGGCGCAGCGATCAGTCTCTGAAACAG
TCAGAAGAAGAGCCTAAAAATCCCGAAACCAACCAAAAAAATAACAGAAT
AGTTGTTGCCAGACCTCAATGTCCCGGAATAACTGAAGCTGAAAAGTTCC
AATGCCAACAGTATCATTATAAGGGAATCGTCAAACCAGGGGTTGCGTTT
AAGAAGCCTAATACTCAAGAGAAACATTCGAAAACAAATTTTGAAGAATT
TGCTTCGCGGTCAACGAACAAACCATTTGAATATCTATTACCAAACAATG
ATCAAACAACATCGGATTTCAATATTAACAATATGAAAATTAATCCTAAA
AATGAAAATACTATTAAATCAAATCTCAACATAAATATCTGGTTGATTGC
TGCTTTTTCATGTGGTGGAGCATTTATGTTGATTGCGTTGTCATGTTTGA
TTTATCGGTGTTCAACAAAAGATGAAGGCTCATATAATGTCAAAGAAGAC
CGAATATGTATTCAAACAAACTTAAATTCCTCTAAACTTAAATCTAAATT
GAATTGTGATGAAAAAAGCAATCAAAGTTTATTGACAAAAATTCCGAATA
AAAGAAAATCTAAGCGAAAAAGAAGTGGAGAAACGAAAGAATGGTATGTA
TAAGAGAAATGAAGAACAATTGATAGCACTTGTTGCATTTATTCGAATAA
ACATAGTTGTATATGACTAAAATCTTTCTAATAAAAATAATCTTTGAATT
TTCAATTTGTGTGACGATTCCAGAGAAGTTTTTTGTTTTTATCAATTGTT
GAAGG
back to top

protein sequence of SMED30018208-orf-1

>SMED30018208-orf-1 ID=SMED30018208-orf-1|Name=SMED30018208-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1529bp
MSLTNMQNIFIFILIISSKKSEFQIFIGISALSVYHPSINVNTNSSLSFQ
IKIDTLMGLIFYAEDIKTNSFVSLKLLSSAKVRLDVGLFYHDSTRENISM
SKEYPTAPDYLTCIIDLSKIDGLIHEWHTIMINFHKKSIILQFNQFSEKV
NIPIGYNSFKRFDGFLGDTMFFGGLPEKLKQDASHRVFFSSAIEPSFSGR
ISAVRIVRFSRLYLIPVMIQFQSDAMNTCYFDSNFCRYCSSSKKCTKYEY
LTFDHNSEIGYAFPVDVISEINRSINFQFKTKQDNSFLFYIGSLPGLAEQ
FQISKTQFISVYIEDGLFHIIISNPQSVDSSFYTRKFHCNSIYKTCADDK
WHNVQIKEFRNDIVITLDDFQKEFKNLSNQQLTKTIHMKFAKATEPFQYY
RQTQLPQYPPLSQFRGCMKEIYLHQNNVTLNIVEMVTKKVYNFHSNGKLN
SDICMEMFPIKPVSFTGKSDYLQAFGIRSVRKAKFSLSFKTHKSDCLIAY
QPSSKKGIHTDTDFYSIEIRDFALYFSIGLNSVVYSKVMSNYNVSNGLLH
NIVLHFELPVIRILLDKENYVLNISTNYHDIEFEGSLYIGSLDDTKILSV
SHHVWSGILGTYFSGCIFSLTIDDSPIQLDLLIKKNSSISSGCKTSEEMH
SLNVCANQPCNEGICQIEWDQRSCDCTKTNFTGNTCNKEAIIAEFNGYQF
MRIKFPNTYKSEVENFYLMFKSKLPNGLILSTQNQFSGTTDKLEIFMQNG
SIYILLNFGRGNKKFKTLENCFDDKWHSIKMKRRRKNLKVWIDDNYYEFN
NFLEMDMPIIGIKYLIIGSAFDNGTDIQDSSSKLVSNDIIHLGKVKRMEN
QFFMGYMMHFIYNGRNYFELAKKLSPLNIELTASLQPANVMRQFAINFHS
TKSYLVIPKVNIFGDFRLEFQMKTLQPSGLLLFLQGESNDYLILEMVNGL
LHIIYNWGSGYKRKISESGLLNDGLWHSVKIVRHMSKTHSFAFRVDGKPD
DSRADVPVNTGGLNFNHFGKMHLGGYLENQSIVTFDNETPRSKGGFQGCI
ASFYVNNSVSTDTVILYKDLLKEANEKHYVDENCPDNHNDKENYCSIDSC
SFGGKCTQHWMKYSCDCSSTSFSGPKCEDVSTTAQFVKHPSYLVYKYSII
KKHSINQLAFGFQTNTRKFAPLISIIGTQSLSPLLTIEIKIVNDYGFIQV
EYYTNTGTHSFMESRLNVIDGLYHIVRFRKDRMAATLKLDDLSDRIHVPD
GIDQNTVVDEELMAIVGSSEVSSKNSFQGFISGLTINEIAILDTLKENFN
SYILLINKSNADLVPNFQPRRSDQSLKQSEEEPKNPETNQKNNRIVVARP
QCPGITEAEKFQCQQYHYKGIVKPGVAFKKPNTQEKHSKTNFEEFASRST
NKPFEYLLPNNDQTTSDFNINNMKINPKNENTIKSNLNINIWLIAAFSCG
GAFMLIALSCLIYRCSTKDEGSYNVKEDRICIQTNLNSSKLKSKLNCDEK
SNQSLLTKIPNKRKSKRKRSGETKEWYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001791Laminin_G
IPR000742EGF-like_dom
IPR013320ConA-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 1094..1128
e-value: 13.0
score: 14.5
coord: 654..687
e-value: 28.0
score: 10.9
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 1091..1128
score: 12.992
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 651..687
score: 9.148
IPR001791Laminin G domainSMARTSM00282LamG_3coord: 481..625
e-value: 2.2E-8
score: 43.9
coord: 43..209
e-value: 0.3
score: 8.9
coord: 712..865
e-value: 3.1E-7
score: 40.0
coord: 914..1058
e-value: 6.6E-25
score: 98.8
coord: 271..426
e-value: 4.0E-7
score: 39.7
coord: 1154..1289
e-value: 0.006
score: 25.8
IPR001791Laminin G domainPFAMPF00054Laminin_G_1coord: 489..627
e-value: 2.5E-9
score: 37.5
IPR001791Laminin G domainPFAMPF02210Laminin_G_2coord: 1187..1288
e-value: 3.0E-5
score: 24.6
coord: 923..1057
e-value: 1.1E-21
score: 77.7
coord: 279..425
e-value: 4.0E-12
score: 46.8
coord: 720..864
e-value: 1.8E-9
score: 38.2
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 692..885
score: 14.939
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 1132..1311
score: 13.543
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 894..1084
score: 32.575
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 462..643
score: 22.142
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 22..229
score: 13.899
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 250..454
score: 21.786
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 30..210
e-value: 1.6E-10
score: 42.9
coord: 460..643
e-value: 2.1E-25
score: 91.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 891..1065
e-value: 3.2E-31
score: 110.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 240..453
e-value: 3.4E-17
score: 64.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 688..888
e-value: 1.7E-23
score: 85.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 651..687
e-value: 2.9E-7
score: 32.2
coord: 1091..1126
e-value: 2.9E-10
score: 41.8
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 1127..1305
e-value: 3.6E-18
score: 67.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1317..1343
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1508..1528
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1324..1338
NoneNo IPR availablePANTHERPTHR15036FAMILY NOT NAMEDcoord: 460..1255
NoneNo IPR availablePANTHERPTHR15036:SF51NEUREXIN-1coord: 460..1255
NoneNo IPR availableCDDcd00110LamGcoord: 462..623
e-value: 8.04193E-10
score: 57.0429
NoneNo IPR availableCDDcd00110LamGcoord: 695..795
e-value: 3.2758E-12
score: 63.9765
NoneNo IPR availableCDDcd00110LamGcoord: 251..424
e-value: 5.15124E-12
score: 63.2061
NoneNo IPR availableCDDcd00110LamGcoord: 895..1056
e-value: 2.14487E-24
score: 98.6444
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 650..688
NoneNo IPR availableTMHMMTMhelixcoord: 1441..1463
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 1115..1291
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 674..867
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 241..436
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 894..1058
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 38..229
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 461..633