Delta-like protein

Overview
NameDelta-like protein
Smed IDSMED30018205
Length (bp)3861
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Delta-like protein (SMED30018205) t-SNE clustered cells

Violin plots show distribution of expression levels for Delta-like protein (SMED30018205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Delta-like protein (SMED30018205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Delta-like protein (SMED30018205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018205SMESG000027402.1 SmedASXL_015512SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v6_11876_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018205SMESG000027402.1 OX_Smed_1.0.01232ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30018205SMESG000027402.1 OX_Smed_1.0.17501ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30018205SMESG000027403.1 SMESG000027402.1 dd_Smed_v4_11876_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 469.159 bits (1206), Expect = 2.568e-172
Identity = 308/864 (35.65%), Postives = 444/864 (51.39%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC  + PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC  +G+C ++   F C+C   WTG  C  +   C  N+C +GG C    NG  +C+C   + G  C L A  CE   C +A  C+     +  Y C C PG+ G+ CD  IN+C+   C+N+  C D +N Y+C C   + G +CE +I  C + PC NGG CQ     + C C TG++G  C++    C PNPC NGA CY    D++C C +++ GK C H + +C    CE   D+C++    N +      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPC+NGG CID +N+++CIC +G+ G  CE   + C ++PC N G C     +L NDF C+CKN W G+ CH  + S CD   C NGG+C      + F+C C  GW GT C   +I        N C N G C+ V    FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ + C CP G  G  C  V    S +P  C+    +   G  W  +C  C C  G++ C  V CG   CL   G  +   C  G+ C   P    +CFV PC     C +  S+ P             C  +S    N CA I  TFNK+ +  G+T + IC  ++ L  +++++      S+ I+C+ + + +  ++VAI +  E+I  D      P       +I   L+     N++    + ++ +    L + +     L+  +L   +A+   ++   YW  RK+
Sbjct:  287 NWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPD--KYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNG-FKCVCPPQWTGKTCQLDANECEAKPCVNAKSCK---NLIASYYCDCLPGWMGQNCDININDCL-GQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCR----DLVNDFYCDCKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDAFKCMCPGGWEGTTC---NIARNSSCLPNPCHNGGTCV-VNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCVCPPGHSGAKCQEV----SGRP--CITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSE---CPSGQSC--IPILDDQCFVHPCTGVGEC-RSSSLQP---------VKTKCTSDSYYQDN-CANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAE---YSIYIACEPSPSANNEIHVAISA--EDIRDD----GNPIKEITDKII--DLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLT--VAWICCLVTAFYWCLRKR 1096          

HSP 2 Score: 159.073 bits (401), Expect = 2.568e-172
Identity = 85/266 (31.95%), Postives = 135/266 (50.75%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKS---SWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L+I      + +  +G CCG   +     CT   C   F +CL+ Y + V+   P      C++G   T + G ++        +     +     +WP S TL++EA+D+S       ++I++  +   + PS     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PG+CRC+ GWQG +CD+C+ +PGC HG C + PW C CE 
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGP------CSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSR---QWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGIC-NEPWQCLCET 286          

HSP 3 Score: 256.144 bits (653), Expect = 5.095e-69
Identity = 215/671 (32.04%), Postives = 303/671 (45.16%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEK-----EKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCSRLSTLNG--------------------------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQ 2905
            C+E W G  C++  +IC Q      G C    +    C CQ G++G  C    P  +  C H +           ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC N G C+E   G+ C+C  G+TG  C      CSPN C +G  C  +   F C C  ++ GK C+       ++P    +SC+    S Y  C    M  +  I  N C   G C +          + C C PG+ GD CE DID+C +NPC NGG C + IN F+C+C  GF G  C+   DYC  +PC N   C   +    +D+ C+C  ++ G+ C HL  H  C + PC    SC+     N                           F C CN+G+ GT C   H +   C   N C+N G CI+ G N + C C  G+EG +C+ N N+C+ NPC NGG C D +N + C C  G+ G  C     +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C        +GE+++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A C+ E + Y    +  PG S   CQ
Sbjct:  220 CMEGWMGPECNR--AICRQGCSPKHGSCKLPGD----CRCQYGWQGLYCDKCIP--HPGCVHGI-------CNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCDININDC--LGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA----SDYFCKCPEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYC---HENINDC-ESNPCRNGGTCID-GVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCN-IARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGY--RCVCPPGHSGAKCQ 856          

HSP 4 Score: 91.2781 bits (225), Expect = 1.020e-17
Identity = 79/270 (29.26%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG-VCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTC 1507
            + W G +C+ ++N C++ NPC NGG C +L++                                   E   +KC+CP G+EG  C I     C PNPC   GTC+ +   F C C E W G +C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C+C PG++G  C     E    PC   G V  D    D  CN      G+     + C  +PC       E  +G +C
Sbjct:  657 DGWEGAYCETNINDCSQ-NPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCVDE---INGYRCVCPPGHSGAKC----QEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSC 917          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 456.833 bits (1174), Expect = 1.292e-168
Identity = 307/864 (35.53%), Postives = 429/864 (49.65%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHN-YCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYA-CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPII--AFGVL----VLIGAYW 3373
             NWGG  CD+ LNYC  ++PC NGG C N  +E   Y+C CP G+ GR+CE     C  NPC  G +C +    F C C   W+G  C  D   C  N C  GG C  D+     CIC + + G+ C L A  CE   C +A  C+     +G Y C C PG+ G  C   +N+C    C++ G C D +N Y+C C   F G++CEL    C + PC +GG+C+++  G+ C C  G++G  CE+    C P+PC NGA CY +  D+YC C  +F GK C   R  C   +C    D C         G   +  CG +G C+S     F C C  GF G  C  +IDDC   PC+NGG CID ++ F C C +G+ G+ C+   + C+  PC + G C     +L NDF C C + W G+ CH  +   CD+  C NGG+C    + + F+C C  GW G+ C    +        N C N G C+  G + F+C C+ G+EG+ C  NTN+CNP PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ + C CP GR G  C  V         SC      F  G +W  +C +C C  G+  C  V CG   CL A   +   A C  G+ C      P +C  PPC     C  E                  C P S    N CA++ L FN+ +VP G T+  IC GI++L   + +    R R L + CD   + ++ V VA+ +SP  ++    L      AH +   I +      + N++    + ++ + T++    S         LLVP++  AF VL    V++  +W
Sbjct:  297 TNWGGLLCDKDLNYCGSHHPCTNGGTCIN--AEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTC-VDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCK---NLIGGYYCDCIPGWKGINCHINVNDCR-GQCQHGGTCKDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACR-VIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCY----DLVNDFYCACDDGWKGKTCH-SREFQCDAYTCSNGGTC--YDSGDTFRCACPPGWKGSTCA---VAKNSSCLPNPCVNGGTCVGSGAS-FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGR----SCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRC--LEKAPGQCLRPPCEAWGECGAEEP------------PSTPCLPRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVA---RDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGA--AHAIVAAITQ------RGNSSLLLAVTEVKVETVVTGGSSTG-------LLVPVLCGAFSVLWLACVVLCVWW 1105          

HSP 2 Score: 159.458 bits (402), Expect = 1.292e-168
Identity = 93/279 (33.33%), Postives = 136/279 (48.75%), Query Frame = 3
Query:   63 FSLKITKYIKYSFQRLDGKCC-GDHGSVIQHTCT-VPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNK-----------------ESTHSYKFTIKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEIT 830
            F L+++     + + L G CC GD  +     C    C     +CL+ Y A V+P      TG C+YG   T + G +S                      +         + +WP S TLI+EA+D  ++T P  + +I+RV +   + P      W  +  S   +  +  + + C  +YY   C+++C+      GHY CD  G K C  GWMG +C   +C+ GC+ +HG C  PGECRC  GWQG FCDEC+ YPGC HG+CV+ PW C+CE  
Sbjct:   30 FELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTP------TGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPE---DRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVE-PWQCNCETN 298          

HSP 3 Score: 234.958 bits (598), Expect = 3.475e-62
Identity = 190/645 (29.46%), Postives = 278/645 (43.10%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVP-NPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQ------MLNSSGIK--------HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSI------------CDSNPCLNGGSCSRLSTLNG---------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNC----ACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C++ W GK C +  ++C Q      G C         C C  G++G  C    P             +  + +  ++C C+  + G  CDK++N C   +PC N G C ++  D Y+C C   + G+NCE    AC + PC NGG C EV +G+ C C +G++G  C +    C+ NPC  G  C      F C C +++ G  C+     C  + C +A+   ++        +    GI            C   GTC       + C C  GF G  CE++ D+C ++PC +GG+C D  + F C C  GF G  CE   D C  SPC N   C      L  D+ C C +++GG+ C +P+                D+ P + G + S +   +G         F C C+ G+ GT C   H +   C  +  C+N G CI+   + F C C  G+EG+ CD N N+C P+PC + G+C D +N + C C  G+ G  C     +C ++ C+ G  C D  D F C CP G  G  C  V  N S  P  CV       SG ++S  C++      C      C  +PC                C PG        N   C   PC   A C+ E + Y
Sbjct:  231 CMDGWMGKECKE--AVCKQGCNLLHGGCTVPG----ECRCSYGWQGRFCDECVPYPGC---------VHGSCVEPWQCNCETNWGGLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTC-KDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCY----NLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYC---HENIDDCLGQP-CRNGGTCIDE-VDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTC-AVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGY 849          
BLAST of Delta-like protein vs. Ensembl Human
Match: JAG2 (jagged canonical Notch ligand 2 [Source:HGNC Symbol;Acc:HGNC:6189])

HSP 1 Score: 409.838 bits (1052), Expect = 1.780e-154
Identity = 289/854 (33.84%), Postives = 412/854 (48.24%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYA-CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPII--AFGVLVLI 3361
             NWGG  CD+ LNYC  ++PC NGG C N  +E   Y+C CP G+ GR+CE     C  NPC   G+C +    F C C   W+G  C  D   C  N C  GG C  D+     CIC + + G+ C L       QC+H   C+     +  Y+C+C  G+ G++C+ E +EC  +PC + G+C D  + + C+C   F G  CE+++  C+  PC+NG  C  ++  Y C C   + G NC + +      PC  GA C  I+                      CG+++         MP    +SG+    CG +G C+S     F C C  GF G  C  +IDDC   PC+NGG CID ++ F C C +G+ G+ C+   + C+  PC + G C     +L NDF C C + W G+ CH  +   CD+  C NGG+C    + + F+C C  GW G+ C    +        N C N G C+  G + F+C C+ G+EG+ C  NTN+CNP PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ + C CP GR G  C  V         SC      F  G +W  +C +C C  G+  C  V CG   CL A   +   A C  G+ C      P +C  PPC     C  E                  C P S    N CA++ L FN+ +VP G T+  IC GI++L   + +    R R L + CD   + ++ V VA+ +SP  ++    L      AH +   I +      + N++    + ++ + T++    S         LLVP++  AF VL L 
Sbjct:  297 TNWGGLLCDKDLNYCGSHHPCTNGGTCIN--AEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTC-VDQVDGFECICPEQWVGATCQLDVNDCRGQCQHGGTCK---DLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPR-----EPCPGGA-CRVIDG---------------------CGSDA------GPGMPGTA-ASGV----CGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCY----DLVNDFYCACDDGWKGKTCH-SREFQCDAYTCSNGGTC--YDSGDTFRCACPPGWKGSTCA---VAKNSSCLPNPCVNGGTCVGSGAS-FSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRAGPRCQEVIGFGR----SCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRC--LEKAPGQCLRPPCEAWGECGAEEP------------PSTPCLPRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVA---RDRLLVLLCDRASSGASAVEVAVSFSPARDLPDSSLIQGA--AHAIVAAITQ------RGNSSLLLAVTEVKVETVVTGGSSTG-------LLVPVLCGAFSVLWLA 1059          

HSP 2 Score: 159.073 bits (401), Expect = 1.780e-154
Identity = 93/278 (33.45%), Postives = 136/278 (48.92%), Query Frame = 3
Query:   63 FSLKITKYIKYSFQRLDGKCC-GDHGSVIQHTCT-VPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNK-----------------ESTHSYKFTIKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            F L+++     + + L G CC GD  +     C    C     +CL+ Y A V+P      TG C+YG   T + G +S                      +         + +WP S TLI+EA+D  ++T P  + +I+RV +   + P      W  +  S   +  +  + + C  +YY   C+++C+      GHY CD  G K C  GWMG +C   +C+ GC+ +HG C  PGECRC  GWQG FCDEC+ YPGC HG+CV+ PW C+CE 
Sbjct:   30 FELQLSALRNVNGELLSGACCDGDGRTTRAGGCGHDECDTYVRVCLKEYQAKVTP------TGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARARAGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPE---DRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVE-PWQCNCET 297          

HSP 3 Score: 224.942 bits (572), Expect = 3.726e-59
Identity = 188/615 (30.57%), Postives = 265/615 (43.09%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNC--ELNIACQNQPCKNGGVCQEVDTG-YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCESAYDA--CSMPQMLNSSGIK------HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSI------------CDSNPCLNGGSCSRLSTLNG---------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNC----ACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            D+ GN+ C+   G+ G EC  A       CK   +  +        +C C  G+ G++CD    ECVP P   +G C   +  ++CNC T++ G  C  +LN    + PC NGG C   +   Y C C  GY+G NCE  +  C+ NPC NG  C+ +   F CHC   + G  C        S P     +C    D   C  P+    +  +         C   GTC       + C C  GF G  CE++ D+C ++PC +GG+C D  + F C C  GF G  CE   D C  SPC N   C      L  D+ C C +++GG+ C +P+                D+ P + G + S +   +G         F C C+ G+ GT C   H +   C  +  C+N G CI+   + F C C  G+EG+ CD N N+C P+PC + G+C D +N + C C  G+ G  C     +C ++ C+ G  C D  D F C CP G  G  C  V  N S  P  CV       SG ++S  C++      C      C  +PC                C PG        N   C   PC   A C+ E + Y
Sbjct:  224 DQYGNKACM--DGWMGKECKEAV------CKQGCN-LLHGGCTVPGECRCSYGWQGRFCD----ECVPYPGCVHGSC---VEPWQCNCETNWGGLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGGSCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDVNDCRGQCQHGGTC-KDLVNGYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLCEPSPCRNGARCY----NLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGTAASGVCGPHGRCVSQPGGNFSCICDSGFTGTYC---HENIDDCLGQP-CRNGGTCIDE-VDAFRCFCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYTCSNGGTCYDSGDTFRCACPPGWKGSTC-AVAKNSSCLPNPCVNGGTCVGSGASFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGY 811          
BLAST of Delta-like protein vs. Ensembl Human
Match: NOTCH1 (notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881])

HSP 1 Score: 339.732 bits (870), Expect = 4.331e-95
Identity = 220/606 (36.30%), Postives = 307/606 (50.66%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC-EIDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS--CQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQP--CKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE----------------HSRPYCGNE--SCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ--FLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   L+     NPC+NGG C+  L  +  YKC CP G+ G+ C + DPC  NPC   G C+  +  + C C   + G  C QD + C Q    C++GG C  +E G+ RC+C+  + G  C     PC  S C++   C  + T    ++C C PG+TG+ C++ I++C  N CKN G C D +N Y C C   + G+ C  ++  CQ  P  C+NGG C     GY C C  G+TG +C      C+   C +GA C+     FYC C     G  C                  + P  G    +C S Y   +  Q ++   +  N C   G C+ +    F C+C+ G+ G  CEID+++C +NPC+N   C+D I  F+CIC  G+ G  CE  TD C  SPC++ G CL    +  N+F CEC   + G LC       C S PC NG  C  L   N + C C +G+ GT C+      D  PC   + CK+       G   FTC C+PG+ G HC+ N NEC+  PC +GG C D+ N+Y C C KG  G NC++N D+CAS PC  G  C+D+ID +EC C  G  G +C+
Sbjct:   93 FSGPLCLTPLDNACLTNPCRNGGTCD--LLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTC-HNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTC--RPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCI-NTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCL----DKINEFQCECPTGFTGHLCQYDVDE-CASTPCKNGAKC--LDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGS-CKD-------GVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSG-TCLDKIDGYECACEPGYTGSMCN 676          

HSP 2 Score: 308.916 bits (790), Expect = 4.048e-85
Identity = 231/716 (32.26%), Postives = 324/716 (45.25%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQM----------------LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVC---INVGYND----------------------------------FTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN--NESPQPPSCVYYNRIFDSGETWSYNCQ-NCACDRG--KVTCESVPCGVWTCLQANGTDDPYACKPGEMC 2773
            + G  C+  +N C  +NPC+N   C   L ++  ++CIC  G+EG  CE+  D C  +PC   G C+    EF C+C   +TG LC  D   C    C+NG +C    N    C+C +GY G+ C +        PC    CK           +  + CLC+PGYTG +C+  INEC   PC++ G C D  N Y C C     G NCE+N+  C + PC +G    ++D GY C C+ GYTG+ C I    C+ NPC NG  C      F C C + +    C      C +  C   + AC                     +N++  + N C   GTC       ++C C  GF G +C+ +I++C +NPC N G CID +  ++C C   + G TCE     C  SPC N G C +  D  Y  F C C   W G+ C +  +  C  +PC +G SC   +T  G++CHC  G+ G  C+    D   CR  N C N G C   IN  + D                                  +TC C  GF G HC+ NT +C  + CFNGG C+D +NS+ C+C  GF GS CQ + +EC S PC +G  C D    + C CP+G  G  C ++ +  + SP            + G+ W  + Q  C C  G   + C+          Q  G D    C+ G +C
Sbjct:  444 YTGPRCEIDVNECV-SNPCQNDATC---LDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPN-TYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCK---------DGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID-GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECNSNPC--VHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTC-KDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSED--YESFSCVCPTGWQGQTCEVDINE-CVLSPCRHGASCQ--NTHGGYRCHCQAGYSGRNCE---TDIDDCR-PNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSP----------CKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLC 1122          

HSP 3 Score: 305.834 bits (782), Expect = 3.696e-84
Identity = 199/590 (33.73%), Postives = 282/590 (47.80%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIN--DYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKN------LCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C+ +++ CA  NPC NGG CE+    +  + C CP G+    C  E++ C  NPC  G C  S   + C C   W+G  CD + + C+ N C NGG C KD      C C++G+ G  C      C ++ C +   C I   A   YKC C   YTG  C+  +  C P+PC+N G C  S +   + C C T ++G+ CE++I  C   PC++G  CQ    GY C C+ GY+G NCE     C PNPC NG  C       +C C   F G  CE     C ++ C                        + G   +   + + C C  GF G  CE +  DC  + C NGG C+D IN+F C+C  GF G  C+   + C   PC++ G C     +    + C C   + G  C    H  CDS+PC NGG C +  T   ++C C  GW G  C    +  +   ++       LC++ G+C++ G N   C C+ G+ G +C+   +EC+P+PC NG  C D L  Y C C  G++G NC    DEC S PC  G  C+D  + ++C CP G  G  C+
Sbjct:  670 YTGSMCNINIDECA-GNPCHNGGTCED---GINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTC-KDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTC-IDDVA--GYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPC------------------------RNGANCTDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC----QDGCGSYRCTCPQGYTGPNCQNLVH-WCDSSPCKNGGKCWQTHTQ--YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAG-NTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCE 1219          

HSP 4 Score: 300.056 bits (767), Expect = 2.628e-82
Identity = 210/603 (34.83%), Postives = 285/603 (47.26%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCA-ENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDE-NGNRRCICQQGYKG-------SECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            W GQ+C + ++ C    N C+NGG C N       Y C+C +G+ G DC   ID C    C  G TC      FYC+C    TG LC  + + C  N C  G  C  +  NG   C C  GY G        EC L A    + C+HA  C      LG ++C C  GYTG  C+ ++NECV NPC+N+  C D I +++C C   ++G +CE+N   C + PC + G C +    + C+C TG+TG  C+     C+  PC NGA C      + C C + + G  CE     C  + C                         YG+C       F C C PG+ G  CE +I++C + PC++GG C D  N + C C  G  G  CE   D C  SPC + G CL   D     + C C+  + G +C++     C  NPC NGG+C     +NGF C C +G+    C  +    +  PC         G C +   N + C C PG+ G +CDIN NEC  NPC NGG C D  + Y C C +GF G NCQ N +ECAS PC     C+D +  ++C C     G  C+ V    +P P
Sbjct:  287 WTGQYCTEDVDECQLMPNACQNGGTCHNTHGG---YNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDA-CISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA----NPCEHAGKC---INTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCH------------------------YGSC-KDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPC-DSGTCLDKID----GYECACEPGYTGSMCNI-NIDECAGNPCHNGGTCE--DGINGFTCRCPEGYHDPTCLSEVNECNSNPCVH-------GACRD-SLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSP 837          

HSP 5 Score: 297.36 bits (760), Expect = 2.159e-81
Identity = 201/590 (34.07%), Postives = 294/590 (49.83%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI-DPCFPNPCKKGT---CMKSKGEFYCQCIERWTGKLCDQDTSICD--QNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID--DFECRCPEGRDGKLCD 2563
            N W G+ C ++++ CA +  C +G  C +    V  + C CP G  G  C + D C  NPC +G+        G+  C C   +TG  C QD   C    N C++ G+C  +  G+  C C QGY G  C +    C ++ C++   C  Q   +G+++C+C PGY G +C+   +EC  +PC +NG C D IN+++C C T F G  C+ ++  C + PCKNG  C +    YTC C  GYTGT+CE+    C P+PC  G+ C      F C C   + G  CE +   C ++ C                          GTC   +   ++C C+ G  G +CEI++DDC ++PC + G C+D I+ +EC C+ G+ G  C    D C  +PC N G C    ++  N F C C   +    C L + + C+SNPC++G       +LNG++C C+ GW GT C    I+   C   N C N G C ++  + + C C+ GF G +C  N NEC  NPC N G CID +  Y+C C   + G+ C++    CA  PC  G  C    D   F C CP G  G+ C+
Sbjct:  325 NGWTGEDCSENIDDCA-SAACFHGATCHD---RVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKC-INTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQ---IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGS-CKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHG-----------------------GTCQDRDN-AYLCFCLKGTTGPNCEINLDDCASSPC-DSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTC----EDGINGFTCRCPEGYHDPTC-LSEVNECNSNPCVHGAC---RDSLNGYKCDCDPGWSGTNCD---INNNEC-ESNPCVNGGTCKDM-TSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRQSEDYESFSCVCPTGWQGQTCE 867          

HSP 6 Score: 268.855 bits (686), Expect = 2.408e-72
Identity = 194/583 (33.28%), Postives = 274/583 (47.00%), Query Frame = 2
Query:  884 CKNGGICENLLSEVQPYKCICPSGFEGRDCE-IDPCFPNPCK-KGTC----MKSKGEFYCQCIERWTGKLCDQDT-SICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP--CKNNGVCTDSINDYKCNCSTSFKGKNCELN-IACQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACS-MPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS-ICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            C NGG CE   +      C+C   F G  C+  +PC   PCK  GTC     +   ++ C C   ++G LC     + C  N C+NGG C        +C C  G+ G  C  A PC ++ C +   C     +   Y C C P + G  C +++NEC   P  C++ G C + +  Y+C C  +  G NCE   + C   PC+NGG C+   D  + C C  G+TG NCE     C  N C NG  C      + C C  E+ G+ C                D C  MP    + G  HN  G Y            C C+ G+ G+ C  +IDDC +  C +G  C D + +F C C +G  G  C    D CI +PC     C   ++ +    IC C + + G  C          +NPC + G C  ++TL  F+C C QG+ G  C+   ID   C   N C+N+  C++    +F C C PG+EG HC++NT+EC  +PC + G+C+DK+N ++C C  GF G  CQ + DECAS PC  GA C+D  + + C C EG  G  C+   +   P P
Sbjct:   31 CLNGGKCE---AANGTEACVCGGAFVGPRCQDPNPCLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFEAS---YICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTED------------VDECQLMPNACQNGGTCHNTHGGYN-----------CVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCH-LNDACISNPCNEGSNC--DTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKC--INTLGSFECQCLQGYTGPRCE---IDVNECV-SNPCQNDATCLDQ-IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDP 574          

HSP 7 Score: 261.536 bits (667), Expect = 4.209e-70
Identity = 181/585 (30.94%), Postives = 264/585 (45.13%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHL-------PKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGV--CINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYR---CICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRC 2533
            + G  C+  L  CA + PC+NGG C     + + + C+CP+G++G+ CE+D   C  +PC+ G +C  + G + C C   ++G+ C+ D   C  N C NGG C  D      C C  G++G+ C      C +  C++  +C   +  +  Y C C  G++G +C+    +C  + C N G C D IN + C C   F G  C+ ++  C +QPC +GG CQ+    Y C C  GYTG NC+     C  +PC NG  C+  +  + C C   + G  C+     C   +     D   +             C   G C+        CRC  G+ G  CE  +D+C  +PC+NG  C D +  + C C  G+ G  C E  D C+  PC N G CL    +L N + C C     G  C +       P   +  S  C N G+C  +  + G+ C C  G++G  C+    D   C   N C   G   C+    NDF C C+ G  G+ C+   N C   PC NGG C    N+ R   C C  GF G+ C+ +   C S  C  G  C+       C C
Sbjct:  821 YTGATCEVVLAPCAPS-PCRNGGECRQS-EDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGSC-TDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC---TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARL-------------CQHGGLCVDAGNTHH-CRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCL----DLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTC--VDQVGGYSCTCPPGFVGERCEG---DVNECL-SNPCDARGTQNCVQR-VNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLC 1374          

HSP 8 Score: 249.98 bits (637), Expect = 1.794e-66
Identity = 193/610 (31.64%), Postives = 268/610 (43.93%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCS----------PNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC-------IKSP-CMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVG--YNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDR--------IDDFECRCPEGRDGKLC 2560
            W GQ C+  +N C  + PC++G  C+N       Y+C C +G+ GR+CE  ID C PNPC  G +C       +C C+  + G  C++D + C  + C+NG  C  D   +  C C  G+ G  C    P C  S C +   C      +  + CLC PG+TG YC  ++NEC   PC + G C D    Y+C C   + G NC+ L   C + PCKNGG C +  T Y C+C +G+TG  C++    C              C +G  C       +C C   + G  CE               D CS P    +     +Y G Y            C+C+ G+ G +C  +ID+C ++PC+NGG C+D  N ++C C  G  G  CE   D C        +SP C N G C+    +    + C C   + G  C    +  C SNPC   G+ + +  +N F C C  G  G  C+ +      C+ K  CKN G C         F C C  GFEG  C+ +   C    C NGG CI    S  C+C   F G  CQ      AS PC  G  C ++           + C CP   +G LC
Sbjct:  861 WQGQTCEVDINECVLS-PCRHGASCQNTHGG---YRCHCQAGYSGRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANC-TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTC---VDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCE------------DLVDECS-PSPCQNGATCTDYLGGYS-----------CKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCV----DQVGGYSCTCPPGFVGERCEGDVNE-CLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESV---INGCKGKP-CKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFP----ASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLC 1425          

HSP 9 Score: 194.897 bits (494), Expect = 2.712e-49
Identity = 158/502 (31.47%), Postives = 219/502 (43.63%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKH---------------------------ALDCQIQSTALG------------------DYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSP--NP------CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNS------------------SGIKHNYCGKYGTCL--SHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCE-ERTDYCI-KSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSI 2101
            G FC++ +N CA ++PC+NG  C +    V  Y C CP+GF G  CE     C  + C   GTC+     F C C   +TG  C  D + CD   C +GG C +D  G+ RC C QGY G  C  L   C++S CK+                           ++ C++ +   G                   + C CQ GYTG YC+  ++EC P+PC+N   CTD +  Y C C   + G NC   I  C + PC+NGG C ++   Y C C  G  G +CEI    C+P  +P      C N   C      + C C   F G+RCE     C +  C+ A    +  Q +N                   +G K   C   GTC   S+    FIC+C  GFEG +CE D   C +  C NGG CI    +  C+C   F G  C+   +  C+  +PC N G C   S+  +  + C C   + G LCH+  +S 
Sbjct:  939 GTFCEEDINECA-SDPCRNGANCTDC---VDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTC-QDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCD-ARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQGTCEPTSESPF--YRCLCPAKFNGLLCHILDYSF 1432          

HSP 10 Score: 166.007 bits (419), Expect = 1.613e-40
Identity = 125/378 (33.07%), Postives = 175/378 (46.30%), Query Frame = 2
Query: 1454 QPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQ----DFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYND---FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECN--PNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            + C NGG C+  +    C C   + G  C+     C   PC N   C+ +++    D+ C C   F G  C                +AC             N C   GTC      ++ CRC PG+ G SC+   D C +NPC NGG C+    ++ C C   F G TC +  + C + P    G+C RH    +N+   + C C+    G  C  P +  C  +PC NGG+C     +   +C C  G+ G  C+  +ID  P    N CKN G C++ G N + C C P + G++C  + +EC   PN C NGG C +    Y C+C  G+ G +C  N D+CAS  C +GA C DR+  F C CP GR G LC
Sbjct:   29 ETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNP-CLSTPCKNAGTCHVVDRRGVADYACSCALGFSGPLC-----------LTPLDNACLT-----------NPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKP----GLC-RHGGTCHNEVGSYRCVCRATHTGPNCERP-YVPCSPSPCQNGGTCRPTGDVT-HECACLPGFTGQNCE-ENIDDCP---GNNCKNGGACVD-GVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLC 370          

HSP 11 Score: 76.6406 bits (187), Expect = 3.327e-13
Identity = 91/293 (31.06%), Postives = 110/293 (37.54%), Query Frame = 2
Query: 2117 CLNGGSCSRLSTLNGFQ-CHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINV---GYNDFTCHCKPGFEGKHCDINT-NECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCA------CDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFN 2959
            CLNGG C      NG + C C   ++G  CQ    D  PC     CKN G C  V   G  D+ C C  GF G  C     N C  NPC NGG C +  L  Y+C C  G+ G +CQ   D CAS PCA G  C+     + C CP    G  C    N    +P  C +     +  E  SY C   A      C+R  V C   PC      Q  GT                          C P      E +  P        E+  DC  N+ KN   C   + T+N
Sbjct:   31 CLNGGKCE---AANGTEACVCGGAFVGPRCQ----DPNPCL-STPCKNAGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHN--EVGSYRCVCRATHTGPNCERPYVPCSPSPC------QNGGT--------------------------CRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYN 280          
BLAST of Delta-like protein vs. Ensembl Human
Match: NOTCH2 (notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882])

HSP 1 Score: 318.546 bits (815), Expect = 2.743e-88
Identity = 224/647 (34.62%), Postives = 307/647 (47.45%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTIN--QDFYCHCNKEFWGKRCEHSRPYCGNESC---------ESAYDACSMPQMLNSSGIKH-------NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCS------RLSTLNGF------------------------------QCHCNQGWIGTVCQFLHI--DFQPCRR----KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   ++ C  ++PC N G C +L   V  Y+C C  G  G +CEI  D C  NPC  G CM     + C C   +TG+ C+ D   C  N C+ G  C    NG  RCIC +G     C+      L+ PC +  C         +  L  YKCLC  G+ G  C+ + NEC+ NPC+N G C + +N Y+C C   FKG NC++NI  C + PC N G C +  +GYTC C   YTG NC+     CSPNPC N A C      + + C C   + G+RC      C ++ C         + +Y  C  P   +    +        N C   G+C+      F C C+PGF GD C+ D+++C + PCKNGG C D +N++ C C  GF G  CE   + C +S C N G C+    +  N F C C   + G  C L + + C S+PCLN G+C       R S   G+                              QC C  GW G  C   ++  D    RR    ++LC++ GVCIN G N   C C  G+ G +C+   +EC  NPC +G  C D +  YRC C  G+ G NC+   DEC + PC  G  C+D ++ F+C CP G  G LC+
Sbjct:  599 YMGAICSDQIDECY-SSPCLNDGRCIDL---VNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNG-FRCICPEGPHHPSCYSQVNECLSNPCIHGNC---------TGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSY-MCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDG-VNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCV----DGINSFSCLCPVGFTGSFC-LHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAG-NTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCE 1223          

HSP 2 Score: 297.36 bits (760), Expect = 1.924e-81
Identity = 226/674 (33.53%), Postives = 308/674 (45.70%), Query Frame = 2
Query:  830 WGGQFCDQSLNYC-AENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDE-NGNRRCICQQGYKGS-------ECHLA--APCENS---------------------QCK------HALDCQIQSTAL---GDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCESAYDACSMPQMLNSSG----IKHNYCGK----YGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECI-------------------------------------CDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCI-NVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            W GQFC + ++ C  + N C+NGG C N       Y C+C +G+ G DC   ID C    C  G TC+     F C C E   G LC  D + C  N C  G  C  +  NG   C C QGYKG+       EC +A   PCE++                     +C+      H+  CQ  +T L   G + CLC PG+ G +C+ EINEC  NPC NNG C D +N ++C C   F G  C+++I  C + PC NG  C +   GY C+C TG+TG  CE     C P+PC +G  C      + C CN  + G  C       +S P   +  C    +         +SG    I  + C      +G C+     ++ C C PGF G  C IDID+C +NPC+ G  CI+ +N F CI                                     CD G+ G  CE   + C+ +PC N G C    D L N + C CK  + G  C +     C SNPCLN G+C     ++G+ CHC   + G  CQ +     PC   N C+N  VC  +  +  +TC C PG++G+ C I+ +EC   PC N G C +   SY C C  GF G +C+ + D+C + PC  G  C+D ++ F C C  G  G  C
Sbjct:  290 WTGQFCTEDVDECLLQPNACQNGGTCANRNGG---YGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDA-CISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICMDG-INRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTC----DNLVNGYRCTCKKGFKGYNCQV-NIDECASNPCLNQGTC--FDDISGYTCHCVLPYTGKNCQTV---LAPC-SPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKC 946          

HSP 3 Score: 290.041 bits (741), Expect = 4.374e-79
Identity = 211/626 (33.71%), Postives = 299/626 (47.76%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVC---------------------QEVD----------------TGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSIN--NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN 2575
            + G  C+  +N C ++NPC N G C   + +V  ++C+CP GF G  C+ID   C   PC  G  C+     + CQC   +TG LC+++   CD + C +G QC +D   +  CIC  GY G+ C      C +S C +   C      +  Y+C CQPG +G  C+   ++C  NPC + G+C D IN Y C CS  F G+ C ++I  C + PC+ G  C                      +V+                +GY C C  G+ G NCE+ K  C  NPC NG  C  +   + C C K F G  C+                       +N      N C   GTC   +   + C C+  + G +C+  +  C  NPC+N  +C +S N  ++ C+C  G+ G+ C    D CI  PCMN+G+C  H+ +    ++CEC   + G  C       C +NPC NGGSC  +  +N F C C  G+ G  CQ    D   C  +  CKN G C +   N +TC C+ GF+G HC+ N NEC  + CFNGG C+D +NS+ C+C  GF GS C    +EC+S PC     CVD +  + C CP G  GK C  + N
Sbjct:  486 FKGVHCELEINEC-QSNPCVNNGQC---VDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHG-QC-QDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRC---IDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQ-----------------------VNIDECASNPCLNQGTCFD-DISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLC--HNTQ--GSYMCECPPGFSGMDCE-EDIDDCLANPCQNGGSC--MDGVNTFSCLCLPGFTGDKCQ---TDMNECLSEP-CKNGGTCSDY-VNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVN 1065          

HSP 4 Score: 286.189 bits (731), Expect = 7.546e-78
Identity = 227/709 (32.02%), Postives = 331/709 (46.69%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSKGEFY--CQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGS-------ECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQE--VDTGYTCKCKTGYTGTNCEIYKTGCS---PNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKV---------TCESVPCGVWTCLQANGTDDPYA------CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            + GQ C+  +N C     C++GG C NL      Y+C CP GF G+ C+    PC P+PC  G   +  G+F   C C+  + G  C+++   C  + CQNGG C  D      C C   + G        EC L    + + C++   C  ++   G Y C+C  G++G  C + I++C    C     C D +  + C C     G  C L+ AC + PC  G +C    ++  Y C C  GY G +C      C+    NPC +   C   +  F+C C K + G RCE     C ++ C++  DA                     TCL  +   F C CMPGF+G  CE++I++C++NPC N G C+D +N F+C+C  GF G  C+   D C  +PC+N   C+ H     N + C+C   + G LC       CD +PC + G C     ++ + C CN G++G +C  Q       PC       N+G CI++  N + C+C+PG  G +C+IN ++C  NPC + G C+D +N Y C+C+ GF G  C ++ DECAS PC  GA C++ ++ F C CPEG     C + + NE    P C++ N       T   +   C CD G V          C S PC      Q  GT D         CK G   Y+   N   C   PC+ +  C  + S Y
Sbjct:  174 FTGQKCETDVNECDIPGHCQHGGTCLNLPGS---YQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVC-VDGVNTYNCRCPPQWTGQFCTEDVDECLL----QPNACQNGGTCANRN---GGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQN--DA---------------------TCLD-KIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHP----NGYECQCATGFTGVLCE-ENIDNCDPDPC-HHGQCQ--DGIDSYTCICNPGYMGAICSDQIDECYSSPCL------NDGRCIDL-VNGYQCNCQPGTSGVNCEINFDDCASNPCIH-GICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSC-YSQVNECLSNP-CIHGNC------TGGLSGYKCLCDAGWVGINCEVDKNECLSNPC------QNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGY 817          

HSP 5 Score: 281.952 bits (720), Expect = 1.532e-76
Identity = 232/725 (32.00%), Postives = 324/725 (44.69%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDEN-GNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEH-----SRPYCGNE------------SCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNP----------CKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGK--CIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICV---DRIDDFECRCPEGRDGKLCD----HVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRG-KVTCESVPCGVWTCLQANGTDDPYACKPGEMCY-SFPFNPKRC---FVPPCVPKARCIKEY 2848
            W G  C+   N C  +NPC+NGG C+NL   V  Y+C C  GF+G +C+  ID C  NPC  +GTC      + C C+  +TGK C    + C  N C+N   C +  N  +  C+C  G++G  C +      + PC N    H L    Q    G Y C C PG++G  C+++I++C+ NPC+N G C D +N + C C   F G  C+ ++  C ++PCKNGG C +    YTCKC+ G+ G +CE     C+ + C NG  C      F C C   F G  C H     S   C NE            SC   Y   +   ++N      + C   GTC+  +K +  C C  G+ G  C++    C              C++ G+CI++ N   C C  G+ G  CEE+ D C  +PC +   C     +    + CEC   + G  C   +   C + PC NGG+C  L  +N F+C C  G  G +C+    +   C R   C N G C++     ++C C PGF G+ C+ + NEC  NPC + G   CI   N Y C+C   F G +C+   D C   PC  G  C    +  D F CRCP G  G  C      VK  +  Q        R F            C   R  +  C S PC      Q  G+  P    P   C  + PF+  RC     PP  P A C+ +Y
Sbjct:  749 WVGINCEVDKNECL-SNPCQNGGTCDNL---VNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMN----HGLCHNTQ----GSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNL--CSRSPCKNKGTCV-QKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATC----SDFIGGYRCECVPGYQGVNCEY-EVDECQNQPCQNGGTCIDL--VNHFKCSCPPGTRGLLCEE---NIDDCARGPHCLNGGQCMDR-IGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCF------------CPSPRDCESGCASSPC------QHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQY 1429          

HSP 6 Score: 281.567 bits (719), Expect = 1.944e-76
Identity = 193/582 (33.16%), Postives = 283/582 (48.63%), Query Frame = 2
Query:  881 PCKNGGICENLLSEVQPYKCICPSGFEGRDCE-IDPCFPNPCKK-GTCMKSK--GEFYCQCIERWTGKLCDQDTS--ICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC--HLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            PC N G+C    +      C CP GF G  C+  DPC  N C+  GTC+     G+  C+C   +TG+ C   TS        C NGG C         C CQ G+ G EC     C +  C +   C   +T    + C C  G+TG+ C+ ++NEC +P  C++ G C +    Y+C C   F G+ C+ L + C   PC NGG C++  D  + C C  G+ G+ CE     C  + C NG  C      + C C  ++ G+ C                D C +         + N C   GTC ++    + C C+ G+ GD C  +IDDC    C  G  CID + +F C+C  G  G  C    D CI +PC    +C   ++ L   +IC C   + G  C   + + ++ +SNPC + G C  ++T   F C C +G+ G  C+   +D   C   + C+N+  C++     FTC C PGF+G HC++  NEC  NPC N G+C+DK+N ++C+C  GF G  CQ++ D+C+S PC  GA C+D  + +EC+C  G  G LC+   +N  P P
Sbjct:   34 PCVNEGMCVTYHNGTG--YCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC---TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTED------------VDECLL---------QPNACQNGGTC-ANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLC-HLDDACISNPCHKGALC--DTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKC--VNTDGAFHCECLKGYAGPRCE---MDINEC-HSDPCQNDATCLD-KIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDP 578          

HSP 7 Score: 155.992 bits (393), Expect = 2.229e-37
Identity = 142/470 (30.21%), Postives = 196/470 (41.70%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICD----------QNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQP-CKNGGVCQEVDTGYTCKC----------------------------------------KTGYTGTNCEIYKTGCSPNPCLNGAYCYT---INQDFYCHCNKEFWGKRCEHSRPYCGNESC---ESAYDACSMPQMLN------SSGIKHNYCGKYGTCLSHEKEKFI-CRCMPGFEGDSCEIDIDDCKTNPC----------KNGGICIDSINNFECICDNGFFGKTCEERTDYCIKS-PCMNY 1999
            + G FC   +N C+ ++PC N G C + L     Y+C CP G+ G++C+  ++ C  +PCK KGTC++ K E  C C   W G  CD     CD          ++ CQ+ G C    N    C C  GY GS C      C ++ C+H   C   S  +G Y+C C PGY G  C+ E++EC   PC+N G C D +N +KC+C    +G  CE NI  C   P C NGG C +   GY+C+C                                        ++ +TG +CE +   C   PCLNG  C     +   F C C   F G RC+ S   CG   C   E      S P+          SG   + C   G+C    +  +  C+C P F G  CE+      T P              G+C ++ N+  C  D G    T E     C    PC +Y
Sbjct: 1017 FTGSFCLHEINECS-SHPCLNEGTCVDGLGT---YRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGN-THYCQCPLGYTGSYCEEQLDECASNPCQHGATC---SDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSS---CGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDY 1475          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 238.81 bits (608), Expect = 2.644e-63
Identity = 186/577 (32.24%), Postives = 265/577 (45.93%), Query Frame = 2
Query:  884 CKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRR--CICQQGYKGSECHLAAPC--ENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGI--CIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCR-RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSY-RCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNN 2578
            C+N   C   +   Q   C C  G+ G  CE+  D C   PC   G C +    + C C + + G  C  ++  C+   C NGG C  D  G +   C+C+ G+ G +C         N+ C++   C  +   LG +KC C PG+ G  CDK I++C  +PC  N  C D INDYKC C T F GK C +    C + PC +G +C +      C C+ G+TG NC+     C+ +PC N A C      + C C   + G  C+H   +C  + C                   HN      TC ++    + C C  GF+G  CE++ID+C  N C   G   C D++N+F+C+C  G+ G  C+ + D C  SPC+N   C+    ++   + C CK+ W G  C     S C + PC N G C  +S +  + C C  G  G  C+       P R     C N G C + G +   C C   F GK C+     C    C NGGKC +      +C C+ GF G  C+ N DEC++  C  GA CVD+++   C CP    G  CD + N 
Sbjct: 2022 CENNAECSVFMHRAQ---CHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVC-HDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEK--LGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHG-LCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPC-------------------HNN----ATC-TNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCV----DMGGAYKCVCKSGWTGPKCEQDNGS-CAAKPCRNNGFC--VSLVADYFCVCPPGVSGKNCES-----APNRCIGQPCHNGGECGDFG-SHLECACPASFTGKGCEFKNTGCKT--CENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMINT 2552          

HSP 2 Score: 215.312 bits (547), Expect = 5.562e-56
Identity = 145/459 (31.59%), Postives = 210/459 (45.75%), Query Frame = 2
Query: 1331 ECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTIN--QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCRRKNLCKNEGV--------------------------CINVG-------YNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            +C    C+NN  C+  ++  +C+C   + G  CE L   C  QPC NGG C++V T Y C C   + G  C+     C+   C NG  C+ +   +   C C   F G +CE               D CS           +N C     C+  +  +F C+C+PG+EG +C+ +IDDC  +PC     C+D IN+++C C  GF GK C  + + C  SPC+ +G+C+   D+LY+   C C+  W G  C       C ++PC N   C  +  +NG+ C C  G+ G  CQ L  H   QPC     C N G                           C  +G        NDF C CKPG+ G  CD+  ++C  +PC N  +C+D   +Y+C+C  G+ G  C+ +   CA+ PC     CV  + D+ C CP G  GK C+   N    QP
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRCEMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEE------------ITDICST----------NNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCV-HGLCI---DKLYSR-QCLCQPGWTGENCDQNIDE-CAASPCQNDAKC--IDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQP 2444          

HSP 3 Score: 196.052 bits (497), Expect = 4.298e-50
Identity = 168/593 (28.33%), Postives = 240/593 (40.47%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENL-------------------------------------LSEVQPYKCICPSGFEGRDCE--IDPCFP-NPCKKGT-CMKSK-GEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPC--LNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ-CHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ----LNYD 2461
            G  C+   + C+   PC NGG CE +                                     L  V+   C+C +GF G  CE   D C   NPC+ G  C+  K G F CQC+  W G  CD++   C  + C     C  D   + +C C  G+ G  CH+    C +S C H L        L   +CLCQPG+TG+ CD+ I+EC  +PC+N+  C D IN Y C C+  ++G +C+ L   C  QPC N   C  +   Y C C  G+ G +CE+    C+ N C  L    C     DF C C   + G RC+  +  C +  C                 +    C   G         + C C  G+ G  CE D   C   PC+N G C+  + ++ C+C  G  GK CE   + CI  PC N G C      L     C C  ++ G+ C   K++ C +  C NGG C+  +   G Q C C+ G+                                            G+ C+ N +EC+   C +G  C+D++N++ C+C     G +C      NYD
Sbjct: 2045 GDRCEMLEDVCS-TQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATC-VDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGLCID----KLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAKQPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPC-----------------LNDAQCVDMGGA-------YKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLE----CACPASFTGKGCEF-KNTGCKT--CENGGKCAEAA--GGLQKCECSPGFT-------------------------------------------GERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDKMINTNYD 2555          

HSP 4 Score: 182.956 bits (463), Expect = 5.581e-46
Identity = 131/433 (30.25%), Postives = 189/433 (43.65%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGIC--ENL----------------------------------LSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALG-DYKCLCQPGYTGKYCDKEINECVPNPCKNNGV--CTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCES--------AYDACSMPQMLNSSGIKH-----NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEE 1960
            + G  C++  + C+ NNPC+NG  C  E L                                  +  +  YKC CP+GF G+ C I  + C  +PC  G C+       C C   WTG+ CDQ+   C  + CQN  +C  + NG   C C  GY+G  C HL   C    C +   C    T +G  Y C C  G+ G +C+  I+EC  N C   G   C D++ND+KC C   + G  C++    C + PC N   C ++   Y C CK+G+TG  CE     C+  PC N  +C ++  D++C C     GK CE +   C  + C +        ++  C+ P      G +        C   G C         C C PGF G+ CE +ID+C T  C +G  C+D +N   C+C     G  C++
Sbjct: 2121 FAGPQCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCADSPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSPCVHGLCIDKLYSRQCLCQPGWTGENCDQNIDECAASPCQNDAKCIDEING-YMCECADGYEGVHCQHLVDHCAKQPCHNNATC----TNMGATYHCDCTLGFDGVHCEMNIDECAENQCDKLGTESCRDAVNDFKCVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQKCECSPGFTGERCETNIDECSTAHCPSGATCVDQVNTHICVCPFNLTGVHCDK 2548          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: crb-1 (Drosophila CRumBs homolog [Source:UniProtKB/TrEMBL;Acc:Q19350])

HSP 1 Score: 182.956 bits (463), Expect = 3.162e-46
Identity = 137/425 (32.24%), Postives = 199/425 (46.82%), Query Frame = 2
Query: 1343 NPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCY-TINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEI-DIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCP-EGRDGKLCDHVKNNESPQPPSCV 2605
            + C N   C D  N  KC C   F G+NCE N+  C+   C   G C +      C C  G+ G +CE+ K  C    C NG  C    ++   C C   + G                   D+C++ +  N    K + C  +G C+      F C CM G+ G+ CE  D+++C    C N G C+ +++   C C+ G+ G+ CE+  + C  + C + G C      ++N+ +C C NNW G  C   +   C   PC N G C R +  N F C C + ++GT C+      +    K  C + G CI +     TC C  G+EG  CD   + C   PC NG  C +KL  Y+C CA GF G++C++N DECA   C  GA C D+I+D+EC C   G +G+ C     NE   P +C+
Sbjct: 1181 STCLNGATCVDIWNKRKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMG-------------------DSCNVTKTTN---CKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGAC----SPVWNNTVCNCDNNWRGAHCQ-HQMDTCLDFPCNNDGVC-RTNDENTFSCECQKFFMGTRCEI-----EGSCLKAQCVH-GECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCT-TDINECANPNNCI 1569          

HSP 2 Score: 171.4 bits (433), Expect = 1.107e-42
Identity = 181/616 (29.38%), Postives = 256/616 (41.56%), Query Frame = 2
Query:  860 NYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSK-GEFYCQCIERWTGKLCDQDTSICDQNSCQN-GGQCGKDENGNRRCICQQGYKGSE-CHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELN--IACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAY-CYTIN---QDFYCHCNKEFWGKRCE--HSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTN--PCKNGGICIDSINNFECICDNGFFGKTCEERTDY-----CIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDF----ECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGET 2638
            N     N C NGG C  +  E + ++C CP GF G  C+ D C  + C  G C+K   GE  CQC E W G LCD    + D ++ Q    QCG DE       C +G  GS  C    P C    C++   C  ++   G+ KC C PG+ G +C+ + +EC  N C+N   C +    Y+C C   F GK CE+     C +  C N G C    +  +CKC  G+ G  CE+ K   +   C N A+ C  +N   +   C C   F G  C+   +RP C  E C            LN            G C+   +  F C C+P F G  C   + DC  N   CKNGG C+ ++    C C  GF G  CE    Y     C    C+N G C   ++    +  C C+  + G  C  PK S C  NPC NGG+C        + CHC  G+ G  C+ +     P                 +  FT     GF       + ++ +   C N   C+D  +   CIC  G++G  C   +D+C+   C  G  C    D+     +C C  G  G+ C+ V +         ++ +  F  G +
Sbjct:   19 NRACSRNTCLNGGTC-TVNDETRMFQCECPKGFSGLLCQ-DNCSLH-CLHGNCVKGTFGEETCQCSEGWMGSLCDN--LVTDDDTAQKCSPQCGDDER------CTKGADGSYICQSNEPSCATHTCQNNGTCVAEN---GNVKCACPPGFVGDHCETDEDECKENFCQNGADCENLKGSYECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCEL-KAEVNECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARP-CDREPC------------LNG-----------GHCVDDGQNLFTCFCLPSFTGIYCGEPV-DCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAE---GEPFCVCEEGFDGPFCE-PK-SGCTINPCQNGGTCQDAD--GQYFCHCTSGFGGVHCETVDEPSTPIPTLGT-----------FPSFTTSGIDGF-------SQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSGQTCSQVNDNVNITAQCGCEIGHFGQQCEMVTSATFSAKSLYIHQSSKFSLGTS 569          

HSP 3 Score: 170.244 bits (430), Expect = 2.616e-42
Identity = 154/485 (31.75%), Postives = 219/485 (45.15%), Query Frame = 2
Query: 1277 KCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL-NIACQNQPCKNGGVC-QEVDTGYTCKCKTGYTGTNCEIYK-TGCSPNPCLNGAYCYTINQDFY-CHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDF---QPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCIC-AKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPS-------CVY---YNRIFDSGETWSYNCQNCACDRG 2677
            KC+C  G+ G+ C+  +N+C    C  +G C D I++ KC C+  F G++CEL    C+   C NGG C +       C+C   + G +C + K T C  +PC N   C      F+ C+C   + G+ CE       NE   + YD      ++  SG                     C+C  G+ G  CE  ++ C +N C + G C    NN  C CDN + G  C+ + D C+  PC N GVC R +DE  N F CEC+  + G  C +     C    C++ G C +LS      C CN G+ G  C    ID+    PC     C+N+          + C C  GFEG  C+IN +EC    C NG KC DK+N Y C+C   GF G NC  + +ECA+        C + + +++C C  G  G  C  V+N  + Q  S       CV+    N +    +        CACDRG
Sbjct: 1197 KCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQRDV---NEC--NHYDCNRGHCVMTVSGPA-------------------CQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVC-RTNDE--NTFSCECQKFFMGTRCEI--EGSCLKAQCVH-GECIQLSP-ETHTCSCNIGYEGDACD-KKIDYCKAGPCLNGANCENK-------LTGYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGECTNTLGNYKCACRNGFIGPRCS-VRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRG 1641          

HSP 4 Score: 163.696 bits (413), Expect = 2.552e-40
Identity = 154/558 (27.60%), Postives = 235/558 (42.11%), Query Frame = 2
Query:  851 QSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPC-FPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP--CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCD-KEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQD-FYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECK-NNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDK---LNSYRCICAKGFYGSNCQLNYDECASFPCAY 2488
             S + C   + C NG  C ++ ++    KC+CP+GF G +CE  ++ C F +  K G C+    E  C C   + G+ C+     C+   C NGG+C K+ +    C C   + G  C++     C++S C++   C  ++     ++C C  GY+G+ C+ +++NEC    C N G C  +++   C C   + G+ CE L   C +  C + G C  V     C C   + G +C+     C   PC N   C T +++ F C C K F G RCE                +C   Q +            +G C+    E   C C  G+EGD+C+  ID CK  PC NG  C + +  ++C C  GF G  CE   D C    C N   C     +  ND+ C C    + GR C    +   + N C+N G C+  +TL  ++C C  G+IG  C   +    PC  +    N                          I++  C    C N    I+K   +  Y C C +G+ G  C     E A    +Y
Sbjct: 1172 MSTDQCGLYSTCLNGATCVDIWNK---RKCVCPAGFAGENCEDNVNDCKFVDCGKHGYCLDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTF--FECNCMDGYSGELCEQRDVNECNHYDC-NRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCE-------------IEGSCLKAQCV------------HGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFCKNGAKC----RDKINDYECVCDGTGFEGRNCTTDINECANPNNCIN-GECT--NTLGNYKCACRNGFIGPRCSVRN----PCTAQIASNN--------------------------ISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKESAMSNISY 1661          

HSP 5 Score: 135.576 bits (340), Expect = 1.267e-31
Identity = 135/478 (28.24%), Postives = 195/478 (40.79%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGE-FYCQCIERWTGKLCD-QDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQS--TALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTG--------------------------------------YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRC-MPGFEGDSCEIDIDDCKT-NPCKNGGICIDSINNFECICDNGFFGKTCEER-------------TDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC 2080
            + G+ C+ ++N C   + C   G C   L  +   KCIC +GF G  CE+  D C    C  G  C+K++ E   CQC   W G  C+   T+ C  + CQN GQC +  +    C C  GY G  C      + ++C H  DC        +    C C+ GYTG++C+K +N+C  N C + G C+   N+  CNC  +++G +C+  +  C + PC N GVC+  D                                        +TC C  GY G  C+     C   PCLNGA C      + C C   F G  CE +   C  E C                        K G     +   + C C   GFEG +C  DI++C   N C NG  C +++ N++C C NGF G  C  R             +  C+   C+N  V +  + E+   + C C   + G  C
Sbjct: 1204 FAGENCEDNVNDCKFVD-CGKHGYC---LDGIDEAKCICNNGFHGEHCELAKDECEGVECHNGGKCVKNRSEKIVCQCGNSWMGDSCNVTKTTNCKDSPCQNFGQCMQKTDTFFECNCMDGYSGELCEQR---DVNECNH-YDCNRGHCVMTVSGPACQCEMGYTGRFCEKLLNQCSSNTCSSRGACSPVWNNTVCNCDNNWRGAHCQHQMDTCLDFPCNNDGVCRTNDENTFSCECQKFFMGTRCEIEGSCLKAQCVHGECIQLSPETHTCSCNIGYEGDACDKKIDYCKAGPCLNGANCENKLTGYKCTCAVGFEGADCEINIDECALEFC------------------------KNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCINGE-CTNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAK-YECACDRGYTGPTC 1647          

HSP 6 Score: 102.064 bits (253), Expect = 2.028e-21
Identity = 97/368 (26.36%), Postives = 143/368 (38.86%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID---PCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRR---CICQQGYKGSECH--LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPN--PCKNNGVCTDSINDYKCNCSTSFKGKNCEL-----------NIACQN---------------------------------QPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNP-------------------------CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESA 1699
            G  C+   + C EN  C+NG  CENL      Y+C C  GF G+ CEI     C  + C   G C+ +  +  C+C   + G  C+    + ++  C+N        NG  R   C C  G+ G++C    A PC+   C +   C      L  + C C P +TG YC + + +C+ N   CKN G C  ++    C C   F G NCE+           +I C N                                  PC+NGG CQ+ D  Y C C +G+ G +CE      +P P                         C+N + C  +     C C+  ++G++C+     C   SC S 
Sbjct:  157 GDHCETDEDECKEN-FCQNGADCENLKGS---YECKCLKGFSGKYCEIQDKKQCTSDYCHNNGQCISTGSDLSCKCSPGFDGAFCELKAEV-NECICENPAHVCSLVNGTSRTTQCECPSGFMGADCKELQARPCDREPCLNGGHCVDDGQNL--FTCFCLPSFTGIYCGEPV-DCLVNGSDCKNGGKCVFALAATTCQCPEGFNGSNCEISNSYRSHPTCSDIRCLNGGSCKLDAEGEPFCVCEEGFDGPFCEPKSGCTINPCQNGGTCQDADGQYFCHCTSGFGGVHCETVDEPSTPIPTLGTFPSFTTSGIDGFSQSKISCEDCVNSSNCLDVESGPVCICDDGYFGQKCDQKHDKCSKVSCPSG 516          

HSP 7 Score: 73.1738 bits (178), Expect = 1.436e-12
Identity = 62/187 (33.16%), Postives = 90/187 (48.13%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGT-CMKSKGEFYCQCI-ERWTGKLCDQDTSIC-DQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCE--------------NSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINE 1333
            + G  CD+ ++YC +  PC NG  CEN L+    YKC C  GFEG DCEI  D C    CK G  C     ++ C C    + G+ C  D + C + N+C NG +C  +  GN +C C+ G+ G  C +  PC               + +C + +    ++  +  Y+C C  GYTG  C + I E
Sbjct: 1473 YEGDACDKKIDYC-KAGPCLNGANCENKLT---GYKCTCAVGFEGADCEINIDECALEFCKNGAKCRDKINDYECVCDGTGFEGRNCTTDINECANPNNCING-EC-TNTLGNYKCACRNGFIGPRCSVRNPCTAQIASNNISSVTCVHGKCVNPVVQIEKNREVAKYECACDRGYTGPTCSQRIKE 1653          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 180.259 bits (456), Expect = 1.672e-45
Identity = 182/631 (28.84%), Postives = 268/631 (42.47%), Query Frame = 2
Query:  830 WGGQFCDQS---------------LNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDP-CFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQN--SCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL---NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSH--EKEKFICRCMPGFEGDSCEIDIDDCKT-NPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLP--------------KHSICDSN--PCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLC-----KNEGVCINV-GYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNC-QLNYDECASFPCAYGAICVDRIDD-FECRCPEGRDGKLCDHVKN 2575
            +GG++C+Q                 +Y  E   CK+  I  N L      K  CPSG+ G DC+    C+P+ C  G  C+ +     C C + + G+ C+ D + C++N  +C N   C  +  G   C+C QG+   +C         + K  + C ++ +A         P     YC            +N G C  + +  KC C   + G  CEL     +C + PC +G VC     G+ C C  GY+G+ C+  K  C  N C  G+ C      ++C C  E  G       PYC    C +  D C+                 +GTC+     ++ F C+C PG+EG  CE D ++C + N C N G C++   +F C C  GF GK C+E  + C    C N G C+  SD   +  +C+CKN + G+ C                 +  IC      C NGG C     L+GF C C   + G  C+    + +    +NLC      N   CI+V  +  + C CK GFEG  C+ + + C  NPC NGG C     S+ C C  GFYG+ C Q     C    C  G +C++  +   +C C  G  G  C+   N
Sbjct:   55 FGGEYCEQQCDVSKCGADEKCVFDKDYRMETCVCKDCDINGNSL-----LKPSCPSGYGGDDCKTQGWCYPSVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTC-MNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPV-CFLEISAD-------HPDGRSMYC------------QNGGFCDKASS--KCQCPPGYHGSTCELLEKEDSCASNPCSHG-VCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTG-------PYCEKMDCSAIPDICN-----------------HGTCIDSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSD---HSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKC-----LSGF-CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKIN 623          

HSP 2 Score: 161.384 bits (407), Expect = 1.291e-39
Identity = 175/575 (30.43%), Postives = 240/575 (41.74%), Query Frame = 2
Query:  884 CKNGGICENLLSEVQPYKCICPSGFEGRDCEI----DPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKHA--LDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVP-NPCKNNGVCTDSINDYKCNCSTSFKGKNCE--LNIACQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCE---------------IYKTGCSPN--PCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKE-KFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCE-ERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLP------------KHSICDSNPC---LNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKN---EGVCINV------GYNDFTC-------------HCKPGFEGKHCDINTNECNPNPC-FNGGKCIDKLNS 2404
            C+NGG C+   S     KC CP G+ G  CE+    D C  NPC  G C+   G F C C + ++G  C +    C  N C+ G +C    N +  C C     G  C  +        C H   +D  +   A   ++C C+PGY G  C+++ NEC+  N C NNG C +    ++C+C+  F GK C+  LN+ CQ+  C+N G C    D    C+CK G+ G  CE               +    CS     C NG  C +     +C C  +F G +CE +R     +S  S     S P M N+            TC+  +    + C C  GFEGD CE   D C  NPC NGG+C     +F C C  GF+G  CE E+   C+KS C N GVC+   ++      CEC   + G  C                 S+C+   C    N G+C   +  N   C     + G  C      F  CR  N+C +    GVC          Y+   C             HC   F    CD    ECN N C F+GG C ++ N+
Sbjct:  221 CQNGGFCDKASS-----KCQCPPGYHGSTCELLEKEDSCASNPCSHGVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVN-SYFCDCPPERTGPYCEKMDCSAIPDICNHGTCIDSPLSEKA---FECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPLNM-CQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLS----GFCVCPPDFTGNQCEVNRK--NGKSSLSENLCLSDPCMNNA------------TCIDVDAHIGYACICKQGFEGDICERHKDLCLENPCSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRK---CECSYGFSGARCEEKINLTGFTEKDSLLRSVCEKRKCSERANDGNCD--ADCNYAACK----FDGGDCSGKREPFSKCRYGNMCADFFANGVCNQACNNEECLYDGMDCLPAVVRCPVKIREHCASRFANGICDP---ECNTNGCGFDGGDCDNETNA 755          

HSP 3 Score: 117.087 bits (292), Expect = 4.323e-26
Identity = 144/548 (26.28%), Postives = 205/548 (37.41%), Query Frame = 2
Query: 1325 INECVPNPCKNNGVC-----TDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGY---TCKCK---------------TGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKR-------CEHSRPYCGNES------------------------------CESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEI--DIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCM-------------------------------------NYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC-QFLHI--DFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHC-----------------DINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDE---------CASFPCAYGAICVDRID---DFECRCPEGRDGKLCDHVKN 2575
            I  C+   C  NG C       +   Y C C   F G+ CE    C    C     C   D  Y   TC CK               +GY G +C+  +  C P+ C+NG  C        C C   F G+R       CE ++  CGN S                               E     C +    +    +  YC   G C   +K    C+C PG+ G +CE+    D C +NPC + G+CI     F+CICD+G+ G  C+E  D C+ + C                                      N+G C+  S      F C+C+  + G LC   K+     N CLN G+C  L     F+C C +G+ G  C + L++  DF        C+N+G C++   +   C CK GF GK C                 +I         CFNGGKC+       C+C   F G+ C++N            C S PC   A C+D +D    + C C +G +G +C+  K+
Sbjct:   21 IGSCLGLICGRNGHCHAGPVNGTQTSYWCRCDEGFGGEYCEQQ--CDVSKCGADEKCV-FDKDYRMETCVCKDCDINGNSLLKPSCPSGYGGDDCKT-QGWCYPSVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEENKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPVCFLEISADHPDGRSMYCQNGGFC---DKASSKCQCPPGYHGSTCELLEKEDSCASNPCSH-GVCISFSGGFQCICDDGYSGSYCQEGKDNCVNNKCEAGSKCINGVNSYFCDCPPERTGPYCEKMDCSAIPDICNHGTCI-DSPLSEKAFECQCEPGYEGILCEQDKNECLSENMCLNNGTCVNLP--GSFRCDCARGFGGKWCDEPLNMCQDFH-------CENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGF----CVCPPDFTGNQCEVNRKNGKSSLSENLCLSDPCMNNATCID-VDAHIGYACICKQGFEGDICERHKD 545          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: egas-2 (EGF plus ASC domain ion channel [Source:UniProtKB/TrEMBL;Acc:Q9U1T8])

HSP 1 Score: 144.821 bits (364), Expect = 9.363e-35
Identity = 134/485 (27.63%), Postives = 201/485 (41.44%), Query Frame = 2
Query: 1256 STALGDYKCLCQPGYTGKYCDKEI-NECVPNPCKNNGVCTDS----INDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEV--DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQML--------------NSSGIKHNYCGKYGTCLSHEKE---KFICRCMPGFEGDSCEIDIDDCKTNPCK-----NGGICI----DSINNFECICDNGFFGKTCEE-RTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEG--VCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYG-------------AICVDRIDDFECRCPEGRDGKLCD 2563
            ++ +  + C CQ GYTG  C  E+   C  +PC++   C  S      +Y C C+    G +CE +  C + PC+N G C  V  ++ Y C C   + G  CE+     +P P  +G  CY  +      C  +F       S+  C N + E + D  +M  +               N+S      C K  +C     E   +   RC+  +E  + E D + C  N          GICI    D  N ++CIC   +    CE      C  SPC N G+C+ +  E YN + C C + + G LC  P   +C S+ CL GG+C+  S+  G+ C C   + GT C+    +   C   + C N      ++    ++TC C  G+ G++CD   + C PNPC     C      + C C  G  G+NC    D C  +  + G             A C   I+ F C C +     LCD
Sbjct:   98 TSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCEYDNLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTP-PVQDG--CYLYDTGSIGACTTKFTENSLTSSK--CNNYALEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKK--SCGGDSAEYCGRLNSRCIV-YEAGTSETDANACTDNSTLCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWN-GICVLN--EQYNTYTCACDDGYFGDLCQYPD--VCTSSTCLYGGTCTETSS-GGYTCSCLSQYFGTNCE----EINRCNYADPCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEINGFNCSCSDKWTDTLCD 564          

HSP 2 Score: 107.842 bits (268), Expect = 2.671e-23
Identity = 138/527 (26.19%), Postives = 198/527 (37.57%), Query Frame = 2
Query:  833 GGQFCDQSLNYCAENNPCKNGGICENLL--SEVQPYKCICPSGFEGRDCEID---PCFPNPCKKG-TCMKSKG----EFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKD-ENGNRRCICQQGYKGSECHLAAPCE-----------------------------NSQCKHALDCQIQSTALGDYKCLCQP-------------------------GYTGKYCDKEINECV----------PNPCKNN----------GVC----TDSINDYKCNCSTSFKGKNCELNI--ACQNQPCKNGG-VCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCY-TINQDFYCHCNKEFWGK------RCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC----------IKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHL 2086
            G + CD  ++ C ++ PC   G  E  L  S+++ + C C +G+ G DC  +    C  +PC+ G TC+ S      E+ C C ++  G  C+ D ++C  N CQN G C    EN N  C C   ++G  C +A                                 +S+C +    Q   T   +Y  LC                           G + +YC +  + C+           N C +N          G+C    +D  N Y+C C   +   +CE  +  AC   PC NG  V  E    YTC C  GY G  C+ Y   C+ + CL G  C  T +  + C C  +++G       RC ++ P C N  C++  D           GI  NY                C C  G+ G++C+  ID C  NPC     C      F C C  G  G  C    D C          IKSPC +       + E+ N F C C + W   LC L
Sbjct:   73 GTEPCDTIVDQCGDD-PC---GEPEYFLCTSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCEYD-NLCASNPCQNSGNCTMVLENSNYLCTCSPDWQGRRCEVADAVSTPPVQDGCYLYDTGSIGACTTKFTENSLTSSKCNNYALEQSTDTVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNSTLCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCETPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQ-YPDVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEINRCNYADP-CVNGDCQTTVD-----------GITTNY---------------TCTCDSGWTGENCDTMIDYCIPNPCSYNSTCSPYFKGFNCTCITGLTGANCSTIIDLCVPYKDSTGKWIKSPCNSKDDLANCTIEI-NGFNCSCSDKWTDTLCDL 565          

HSP 3 Score: 80.1073 bits (196), Expect = 7.227e-15
Identity = 130/516 (25.19%), Postives = 195/516 (37.79%), Query Frame = 2
Query: 1283 LCQPGYTGKYCDKEINECVPNP---CKNNGVCTDSINDY--KCNCSTSFK----GKNC--------------ELNIACQNQPCKNGG--VCQEVDTGYTCKCKTGYTGTNCEI-YKTGCSPNPCLNGAYCYTINQ----DFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTC-LSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFEC---ICDNGFFGKTC-----EERTDYCIKSPCMNY-----GVCLRHSDELYND---FICECKNNWGGR------------LCHLPKHSICDSNPC----------LNGGSCSRLST--LNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQL----NYDECASFPCAYG--AICVDRID-DFECRCPEGRDGKLCDHVKNNESPQP 2593
            L  P Y+      E     PNP   C N G+CTD         N ST+++     +NC               +   C + PC      +C      +TC C+ GYTG +C     T C+ +PC +GA C + N     ++ C C  + +G  CE+    C +  C+++                       G C +  E   ++C C P ++G  CE+  D   T P ++G    D+ +   C     +N      C     E+ TD    +  MNY       C+     L N       +CK + GG             + +    S  D+N C          L  G C  LS+   NG+QC C   W  T C+            + C N    +N  YN +TC C  G+ G  C    + C  + C  GG C +  +  Y C C   ++G+NC+     NY +    PC  G     VD I  ++ C C  G  G+ CD + +   P P
Sbjct:    7 LIFPYYSTPQTTVEYVAASPNPPHGCPNFGLCTDVTTTLVSSTNVSTTYEYGCAPENCYCVDGTTNGTEPCDTIVDQCGDDPCGEPEYFLCTSKIESHTCACQAGYTGADCTSELGTACATSPCRSGATCVSSNSSATTEYSCICTDQQFGTHCEYDN-LCASNPCQNS-----------------------GNCTMVLENSNYLCTCSPDWQGRRCEV-ADAVSTPPVQDGCYLYDTGSIGACTTKFTENSLTSSKCNNYALEQSTD----TVTMNYLTLCGAWCMVSEAPLCNTSWYMDGDCKKSCGGDSAEYCGRLNSRCIVYEAGTSETDANACTDNSTLCNANLGQGICINLSSDVTNGYQCICGPLWTDTDCE---TPVASACTPSPCWNGICVLNEQYNTYTCACDDGYFGDLCQY-PDVCTSSTCLYGGTCTETSSGGYTCSCLSQYFGTNCEEINRCNYAD----PCVNGDCQTTVDGITTNYTCTCDSGWTGENCDTMIDYCIPNP 485          
BLAST of Delta-like protein vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 137.502 bits (345), Expect = 2.564e-32
Identity = 146/517 (28.24%), Postives = 220/517 (42.55%), Query Frame = 2
Query: 1037 FYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENG-NRRCICQ-----------------QGYKGSECHL-----AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVC---QEVDTGYTCKCKTGYTGTNCEIYKTGCS-PNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCES----AYDACSMP-------------QMLNSSG---------IKHNYCGKY-GTCLSHEK-EKFICRCMPGFEGDSCEI--------DIDDCKTNPCKNGGICIDSINN-FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFI-CECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI--DFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC 2386
            ++C+C + + G  C+++   CD + C+ G +C  D  G N  CICQ                 +GY G +C         PC++  C + L         G ++C+C  GY G YC++ I+ C  N C     C +S+ +Y C+C     G+ CE           N G C   ++ D  + C C +GY G  C   K  C     C+N + C+ ++ DF C C   + GK CE +   C +  C++    A+D+  MP             ++   SG         ++  +C +  GTC +  +     C C P + GD CEI        DI  CK NPC N   CID  N+ + C C  GF+G  CE+    C  + C N G C     E  N  I C C N + G  C +    +C  +PC NGG C      N   C C  G+ G  C+ + +    +    ++LC+    C+++  N     C P       + N  ECN    F+GG C
Sbjct:   44 YWCRCKKGFGGAFCERE---CDLD-CKRGEKCIYDVYGENPTCICQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYPF----YGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCINGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTC-----EGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCK-----NTGYCECQYGYTGPTCEEVLVIEKSKETVIRDLCEQRK-CMDLASNGI---CNP-------ECNLEECN----FDGGDC 526          

HSP 2 Score: 123.25 bits (308), Expect = 6.443e-28
Identity = 101/349 (28.94%), Postives = 139/349 (39.83%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLL-------------------------------------SEVQPYKCICPSGFEGRDCEIDPCFPNPC-------KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-----------HLAAPCENSQCKHALDCQIQSTALGDYKCL-----CQPGYTGKYCD--------KEINECVPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIY-KTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEH 1660
            N +GG +C++ +++CA+N  C  G  C N +                                      E + ++C+C SG+EG  C  D    N C          TC    G+F C C   + GK C++   +C    CQN G C  D N    C C+QG+ G  C           H   P +   C  +       T   D +C+     C+P Y G  C+         +I  C  NPC NN  C D  N  Y C+C   F G NCE ++ C    C NGG C+ V+    C C  G++G  CEI  +  CS +PC NG  C       YC C   + G  CE 
Sbjct:  144 NGYGGSYCEEGIDHCAQNE-CAEGSTCVNSVYNYYCDCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDK---NECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRS-----NGTCYNDGRCINGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVCKNTG---YCECQYGYTGPTCEE 480          

HSP 3 Score: 119.783 bits (299), Expect = 6.725e-27
Identity = 130/461 (28.20%), Postives = 184/461 (39.91%), Query Frame = 2
Query:  830 WGGQFCDQS------------LNYCAENNPCKNGGICENLLSEVQPYKCI---CPSGFEGRDCE------IDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVC-QEVDTGYTCKCKTGYTGTNCEI---------------YKTGCSPN--PCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEER-TDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCH 2083
            +GG FC++              +   EN  C    IC++   E  P +     C  G+ G DC+      ++PC  +PC  G C    G F C C   + G  C++    C QN C  G  C  +   N  C C  G  G  C         + C H   C        +++C+C  GY G++C+K+ NEC +   C NN  C +   D+ C C   + GK CE  I  C++  C+N G C  + +    C C+ G+TG  CEI                +  CS +   C N   C     + +C C  ++ G RCE +R        +S                K+N C    TC+  +   + C C  GF G +CE  +  C    C NGG C        C C NGF G  CE +    C + PC N GVC        N   CEC+  + G  C 
Sbjct:   52 FGGAFCERECDLDCKRGEKCIYDVYGENPTC----ICQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTC-VNSVYNYYCDCPIGKSGRYCERTECALMGNICNHG-RCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRCI----NGFCVCEPDYIGDRCEINRKDFKFPDIQSC---------------KYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCEQHL-LCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCEIKDRQLCSRHPCKNGGVC-------KNTGYCECQYGYTGPTCE 479          

HSP 4 Score: 116.701 bits (291), Expect = 5.818e-26
Identity = 136/463 (29.37%), Postives = 189/463 (40.82%), Query Frame = 2
Query: 1274 YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVD-----TGYTCK-CKTGYTGTNCEI-YKTGCSP---NPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICI---DSINNFECICDNGFFGKTCEERTDYC-IKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQF--------LHIDFQPCRRKNLCKNEGVCINVG--YNDFTCHCKPGFEGKHCDINTNE--------CNPNPCFNGGKCIDKLNS-YRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            Y C C+ G+ G +C++E                    D  C      +G+ C  ++  +N  C    +CQ+ +     T  T K C+ GY G +C+    +G +P   +PC NG  CY     F C CN  + G  CE    +C                         N C +  TC+ +    + C C  G  G  CE        N C N G CI   D   NF C+CD+G+ G+ C +  + C I+  C+N   C      L+ DF C CK  + G+ C      +C    C N G C+  S      C+C QG+ G  C+         +H D  P +R +  ++ G C N G   N F C C+P + G  C+IN  +        C  NPC N   CID  NS Y C C  GFYG NC+  +  C    CA G  C        C CP G  G  C+
Sbjct:   44 YWCRCKKGFGGAFCEREC-------------------DLDCK-----RGEKCIYDVYGENPTC----ICQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDSDPCNNG-LCYPFYGGFQCICNNGYGGSYCEEGIDHCA-----------------------QNECAEGSTCV-NSVYNYYCDCPIGKSGRYCERTECALMGNIC-NHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCF----NLHGDFTCTCKPGYAGKYCE-EAIDMCKDYVCQNDGYCAHDSNQMPI-CYCEQGFTGQRCEIECPSGFGGIHCDL-PLQRPHCSRSNGTCYNDGRCINGF-CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCE-QHLLCTPTTCANGGTCEGVNGVIRCNCPNGFSGDYCE 443          

HSP 5 Score: 56.6102 bits (135), Expect = 1.390e-7
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query: 2303 CKPGFEGKHCDI----NTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVK 2572
            C+ G+ G  C        N C+ +PC N G C      ++CIC  G+ GS C+   D CA   CA G+ CV+ + ++ C CP G+ G+ C+  +
Sbjct:  101 CEEGYGGPDCKTPLFSGVNPCDSDPC-NNGLCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGRYCERTE 193          
BLAST of Delta-like protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 334.339 bits (856), Expect = 2.136e-95
Identity = 238/685 (34.74%), Postives = 334/685 (48.76%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENN--PCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDE-NGNRRCICQQGYKG-------SECHLAAPCENS---------------------QCKHALD------CQIQSTAL---GDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCE----------SAYDACSMPQM-----LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ-------------------------------FLHID----FQPCRRKNLCKNEGVCI-NVGYNDFTCHCKPGFEGKHCDINTNECN-PNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            N+ G+FC   ++ CA+ +   C+NG  C N       Y CIC +G+ G DC    D C    C  G TC+   G FYCQC +  TG LC  D + C  N C     C     NG+  C C  GYKG        EC   +PCE++                     +C+  ++      CQ + + L   G ++C+C PG+TG  C+ +I+EC  NPC N+G C D IN +KC+C+  F G  C++NI  CQ+QPC+N G+C +   GY+C+C  GYTGT+CEI    C  NPC  G     +N  F C C+  + G  C+     C +  C+          S Y  C          +N +    N C    TC+      + C+C+PGF G  CE ++D+C ++PC N G+CID +N ++C C  GF+   C    D C  +PC+N G C    ++  N+FIC C   + G+ C L     C SNPC +GG+C     LN F C C  G+ G  C+                               F   D      PC   N CKNE  C  +  + DF+C CK G+ G++CD + +EC+  +PC NG  C++   SYRC+C KG+ G +C +N D+CASFPC  G  C+D I D+ C C +G DGK C+   N    QP
Sbjct:  322 NFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGS---YSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDA-CTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNS-FKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDG-INSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRC----EDGINEFICHCPPGYTGKRCELDIDE-CSSNPCQHGGTC--YDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPC-ASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQP 992          

HSP 2 Score: 36.965 bits (84), Expect = 2.136e-95
Identity = 31/94 (32.98%), Postives = 45/94 (47.87%), Query Frame = 3
Query:  573 CKNNGGHYKCDINGEKVCDYGWMGSDCNNT--ICQPGCHRIHGYCENPG---ECRCRAGWQGTFC----DECMKYPGCKHGTCVD--SPWTCSC 821
            C N  G Y+C      +C  G+ G DC+     C P   +  G C + G   EC+C  G++G  C    D+C+ +     GTC+D  S +TC C
Sbjct:  232 CVNTHGSYQC------MCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRC 319          

HSP 3 Score: 331.257 bits (848), Expect = 1.215e-92
Identity = 225/624 (36.06%), Postives = 314/624 (50.32%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCK-KGTCMKSKG--EFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCGKY---------------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGV--CINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGA-ICVDRIDDFECRCPEGRDGKLCDHVKNNE-SPQP 2593
            + GQ C+ +++ C   NPC NGG C   + +V  YKC+C   F GRDCE  +DPC  N CK +  C  S    +F C C   +TG+ CD+D   C  +S C+NG  C  +  G+ RC+C +GY+G +C +    C +  C++   C      +GDY CLC  G+ GK+C+ +INEC+  PC+N   C+  +N Y C C   F G NC+ N   C    C NGG C +   GY C C  GY+G NC+     C  NPCLNGA C+  N ++ CHC   F GK+C     +CG   CE+      M    +   S+G     C                        GTC  +     +C C  G+ G  C+ +ID+C++ PC+NGG C D I  +EC C  GF G+ CE   D C  +PC N G C    D + N F C C     G +C + K   C    C N GSC  +  + GF+C C  G++G  C+    D   C   N C N G   C+ +  N++ C+C+PG  G+HC+   + C  +PC NGG C  + + + CIC  GFYG NC+L+  +C S PC  G  +  D    + C CP G  G+ C+    +E SP P
Sbjct:  821 YTGQKCETNIDDCV-TNPCGNGGTC---IDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC-LNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCL---DGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDY-GNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTC---HDRVMN-FSCSCPPGTMGIICEINKDD-CKPGACHNNGSC--IDRVGGFECVCQPGFVGARCEG---DINECL-SNPCSNAGTLDCVQL-VNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNP 1423          

HSP 4 Score: 309.686 bits (792), Expect = 1.377e-86
Identity = 245/771 (31.78%), Postives = 346/771 (44.88%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPC--------------------------------------FNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN--NESP--QPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQA---NGTDDPYA------CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNN-QISWPGES----HKDCQPNSIKNHNYCAKIILTFN 2959
            + G  C+  ++ C ++NPC N G C +   ++  +KC C  GF G  C+I  D C   PC+ +G C  S   + C+C   +TG  C+ + + CD N C  G +C  D N + +C+C  GY G  C      CE++ C+    CQ +   +G Y C CQ G +GK C+  +NEC  NPC N   C D IN YKC C   F G++CE N+  C + PC N GVC +   GY C+C  G+   +C      C+ NPC+N   C     +F CHC   + GKRCE     C +  C+                         GTC   +   F C+CMPG+ G  CE +IDDC TNPC NGG CID +N ++C+C   F G+ CE + D C  + C N   C   S+ L  DF C CK  + GR C         S+PC NG SC  L+    ++C C +G+ G  C    I+   C     C+N G C++ G  D++C C  GF+GKHC+ + NEC   PC                                       NGG CID +N Y C C  G+ G+NCQ   ++C S PC  GA C ++ +++ C CP G  GK C    +   +SP     +C      F    +  +  +   CD   ++C+         L+    NGT   Y       C  G            C   PC     C      Y    +  + G++      DC PN  +N   C   ++ F+
Sbjct:  518 FTGTQCEIDIDEC-QSNPCLNDGTCHD---KINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRG-KCIDDVN-SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDR---VGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHG-----------------------GTCYD-KLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFL--DFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC--LNVPGSYRCLCTKGYEGRDCA---INTDDCASF-PCQNGGTCLD-GIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGK--LCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFS 1244          

HSP 5 Score: 32.3426 bits (72), Expect = 1.377e-86
Identity = 37/103 (35.92%), Postives = 45/103 (43.69%), Query Frame = 3
Query:  564 DRYCKNNGGHYK--CD---INGEKVCD--YGWMGSDCNNTI--CQPGCHRIH-GYCEN-PG--ECRCRAGWQGTFCD----ECMKYPGCKHGTCVDSPWTCSC 821
            D  C +N  H    CD   ING   C    G+ G DC+  I  C  G    H G C N PG   C C  G+ G  C+    EC  +P    G+C+D P T  C
Sbjct:  410 DDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRC 512          

HSP 6 Score: 298.13 bits (762), Expect = 1.330e-82
Identity = 219/690 (31.74%), Postives = 324/690 (46.96%), Query Frame = 2
Query:  845 CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSI----------------------------------------------CDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAI--CVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGET-------WSYNCQNCACDRGKVTCESVPCGVWTCLQAN 2731
            C   ++ CA +NPC N G CE+ ++E   + C CP G+ G+ CE  ID C  NPC+ G TC      F CQC+  +TG+ C+ +   C  N C NGG C    NG  +C+C+  + G +C     PC +++CK+   C   S  L D+ C C+ GYTG+YCD++I+EC + +PC+N   C +    Y+C C+  ++G++C +N   C + PC+NGG C +    Y+C C  G+ G +CE     C   PC NGA C      + C C   F G  C+ +   C   SC            LN            G+C+      + C C+ G+ G +C+  ++ C +NPC NG  C +  N + C C +GF GK C E  D+C +SPC N   C     ++ + F C+C   W G+LC +   S                                               C S PC NGG+C  L  +  ++C C QG+ G  C+    D  P    N C+N G C +   N F+C C PG  G  C+IN ++C P  C N G CID++  + C+C  GF G+ C+ + +EC S PC+      CV  ++++ C C  G  G+ C+H  +  +  P        I  SG         +  NC+    D     C+S PC V  C+ A+
Sbjct:  750 CLSDVDECA-SNPCVNEGRCEDGINE---FICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG-YKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFL-DFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSC------------LNG-----------GSCIDG-INGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATC----SQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDL--IGAYECQCRQGFQGQNCELNIDDCAP----NPCQNGGTCHDRVMN-FSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQD-----CDSNPCRVGNCVVAD 1393          

HSP 7 Score: 30.4166 bits (67), Expect = 1.330e-82
Identity = 32/119 (26.89%), Postives = 44/119 (36.97%), Query Frame = 3
Query:  519 SMNLICKPDYYGEFC--------------DRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTI-------CQPGCHRIHGYCENPGECRCRAGWQGTFC----DECMKYPGCKHGTCVD 800
            S   +C P Y G  C              D +C++  G Y C       C  G  G +C   +       C  G   I G   N  +C+C  G+ G  C    DEC+  P   +G C+D
Sbjct:  622 SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQ------CQAGTSGKNCEVNVNECHSNPCNNGATCIDGI--NSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCID 732          

HSP 8 Score: 299.671 bits (766), Expect = 1.668e-82
Identity = 206/600 (34.33%), Postives = 295/600 (49.17%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIN--DYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI------DFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESP 2587
            + GQ C+++++ C  ++PC N G+C   + +V  YKC CP GF    C  ++D C  NPC  +G C     EF C C   +TGK C+ D   C  N CQ+GG C  D+     C C  GY G +C      C  + C +   C  +   +  YKC+C+  +TG+ C+ +++ C  N CKN   CT S N  D+ C C   + G+ C+ +I     + PC+NG  C  V   Y C C  GY G +C I    C+  PC NG  C     D+ C C   F GK CE     C ++ C++    CS  Q +NS                     + C C  GF G +C+ + +DC  + C NGG CID IN + C C  G+ G  C+ + + C  +PC+N   C     E  N++ C C + + G+ C       C  +PC NG +CS++   + F C C+ GW G +C    I      D +    + LC N G C + G N   C+C  G+ G +C    +EC   PC NGG C D + +Y C C +GF G NC+LN D+CA  PC  G  C DR+ +F C CP G  G +C+  K++  P
Sbjct:  707 FTGQHCEKNVDECI-SSPCANNGVC---IDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTC-YDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDK---VNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGA-TCS--QYVNS---------------------YTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC----HEQNNEYTCHCPSGFTGKQCS-EYVDWCGQSPCENGATCSQMK--HQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNN-GTCKDYG-NSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKP 1265          

HSP 9 Score: 298.13 bits (762), Expect = 5.889e-82
Identity = 206/633 (32.54%), Postives = 296/633 (46.76%), Query Frame = 2
Query:  842 FCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI-DPCFPNPCKKG---TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI---ACQNQP-CKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE----------HSRPYCGNE--------SCESAY---------DACSMPQMLNSSGIKHNYCGKY----------------------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEG 2542
             C+ ++    ++  C NGG C+  L  ++ Y C C +G+ G  CE  + C  +PC+ G   T +     F C C   +TG  C  D   C  N C+ GG C  + +G+ +C+C  GY G +C     PC  S C++   C+    +   Y+C C  G+ GK C++  ++C+ + C+N G C D I+DY C C  +F G+ C+ ++   A ++ P C+NG  C      Y+C C  G+ G +C      C    C  GA C      FYC C K   G  C           H+   C           SC + Y         D C        +GI  N  G Y                            G+CL  +   F C CMPGF G  CEIDID+C++NPC N G C D IN F+C C  GF G  C+   D C   PC N G+C     +    + CEC   + G  C +  +  CDSNPC  G     +  +N F+C C+ G+ G +C  Q    +  PC+    C++           + C C+ G  GK+C++N NEC+ NPC NG  CID +NSY+C C  GF G +C+ N DEC S PCA   +C+D+++ ++C CP G
Sbjct:  134 LCEIAVPNACDHVTCLNGGTCQ--LKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTC-VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLS---YECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLD-DPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC----HDSIAGYSCECPPGYTGTSCEININD-CDSNPCHRGKC---IDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDR-------VGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRG 744          

HSP 10 Score: 294.278 bits (752), Expect = 9.903e-81
Identity = 214/697 (30.70%), Postives = 315/697 (45.19%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK---------------------------------------GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS---CQNGGQCGKDENGNRRCICQQGYKGSEC--------------------------------------HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID---FQPCRR--------------------------------KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   +  C ++NPCK GG C N       Y+C+CP+G+ G+DC+    PC P+PC+                                        GTC+    ++ C+C   +TG+ C  D   C Q     CQNG  C  + +G+  CIC  G+ G +C                                      HL   C ++ C     C   S   G Y C C  GY G  C ++I+EC   +PC++NG+C ++   Y+CNCS  F G  CE NI  C++ PC+N G C +    + C C  G+TGT CEI    C  NPCLN   C+     F C C   F G RC+ +   C ++ C              + GI H+    Y            C C PG+ G SCEI+I+DC +NPC   G CID +N+F+C+CD G+ G  C+++ + C  +PC   G    H  +    + C+C+    G+ C +  +  C SNPC NG +C  +  +N ++C C  G+ G  C+  ++D     PC                                   N C NEG C + G N+F CHC PG+ GK C+++ +EC+ NPC +GG C DKLN++ C C  G+ G  C+ N D+C + PC  G  C+D+++ ++C C     G+ C+
Sbjct:  209 FTGDTCSYDIEEC-QSNPCKYGGTCVNTHGS---YQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATC-TNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDT-SPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCR-------------NRGICHDSIAGYS-----------CECPPGYTGTSCEININDCDSNPCHR-GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDG----HCQDRVGSYYCQCQAGTSGKNCEVNVNE-CHSNPCNNGATC--IDGINSYKCQCVPGFTGQHCE-KNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCED-GINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCE 865          

HSP 11 Score: 275.404 bits (703), Expect = 1.056e-74
Identity = 205/614 (33.39%), Postives = 294/614 (47.88%), Query Frame = 2
Query:  860 NYCAENNPC-----KNGGICENLLSEVQP-YKCICPSGFEGRDCEIDPCFPNPCKKGTC-------MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNR-RCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNP---CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYC----GKYG-------TCLSHE------------KEKFICRCMPGFEGDSCEIDIDDC-KTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID---FQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            +YC   NPC     +NGG C+      +P   C CP GF+   CEI    PN C   TC       +K+  E+ C C   +TG+ C+   ++C  + C+NG  C      +   C C  G+ G  C +    C+++ CK+   C       G Y+C+C  GYTGK CD +   C P+PC+N G+C  +   Y+C C   F+GKNCE N   C    C+NGG C +  + YTC+C   +TG  C+     C+      C NGA C   +  + C C   + G  C ++   C   +C   Y A  +       G+   YC    GK G        C S+                + C C  G++G  C  DID+C + +PC++ GIC+++  ++ C C  GF G  CE   + C   PC N G CL         F C C   + G  C +     C SNPCLN G+C     +NGF+C C  G+ G  CQ ++ID    QPCR + +C +           ++C C PG+ G  C+IN N+C+ NPC   GKCID +NS++C+C  G+ G  CQ   +EC S PC +   C DR+  + C+C  G  GK C+
Sbjct:   92 DYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEI--AVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCET-KNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTC---VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAAC--FYGATCI------DGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDP----GTFRCVCMPGFTGTQCEIDIDE-CQSNPCLNDGTCH--DKINGFKCSCALGFTGARCQ-INIDDCQSQPCRNRGICHDS-------IAGYSCECPPGYTGTSCEININDCDSNPCHR-GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCE 675          

HSP 12 Score: 266.929 bits (681), Expect = 5.000e-72
Identity = 205/636 (32.23%), Postives = 287/636 (45.13%), Query Frame = 2
Query: 1010 GTCMKS-KGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNR---RCICQQGYKGSECHLAAP--CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTD--SINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDC--KTNP-CKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPCGVWTCLQANGTDDPYA----CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            GTC+    G+ YC C   + G  C+   + C+   CQNGG C       R    C C  G+  S C +A P  C++  C +   CQ+++  L +Y C C  GYTG+ C+ + N C  +PC+N   CT     + + C+C   F G  C  +I  CQ+ PCK GG C      Y C C TGYTG +C+     CSP+PC NG  C +    + C C K F GK CE +            YD C          + H  C   GTC+    + + CRC P F G  C+ D+D+C  + +P C+NG  C ++  ++ CIC NG+ G  C   TD C ++ C     C+    +    F C+C     G LCHL     C SNPC     C        + C C  G+ G  C     D   C + + C++ G+C+N     + C+C  GF G  C+ N NEC  +PC N G C+D   ++RC+C  GF G+ C+++ DEC S PC     C D+I+ F+C C  G  G  C    ++   QP  C       DS   +S  C       +C+     C+S PC    C+     DD  +    C PG   Y        C   PC     C      Y
Sbjct:   71 GTCVTQLNGKTYCACDSHYVGDYCEH-RNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKT--LEEYTCACANGYTGERCETK-NLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQN------------YDDC----------LGH-LCQNGGTCIDGISD-YTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCI----DGVGSFYCQCTKGKTGLLCHL--DDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSE---DIDECDQGSPCEHNGICVNT-PGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQP--CRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCI-----DDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSY 661          

HSP 13 Score: 174.866 bits (442), Expect = 1.871e-43
Identity = 156/521 (29.94%), Postives = 229/521 (43.95%), Query Frame = 2
Query: 1334 CVPNPCKNNGVCTDSINDYK-CNCSTSFKGKNCELNIACQNQPCKNGGVCQEV----DTGYTCKCKTGYTGTNCEI-YKTGCSPNPCLNGAYCYTIN-QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKN--LCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRI--DDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNC----ACDRGKVTCESVPC-GVWTCLQANGTDDPY----ACKPGEMCYSFPFNPKRCFVPPCVPKARC 2836
            C    C+N G C   +N    C C + + G  CE    C +  C+NGG CQ        G +CKC  G+  + CEI     C    CLNG  C     +++ C C   + G+RCE ++  C +  C +                     G   T L+     F C C PGF GD+C  DI++C++NPCK GG C+++  +++C+C  G+ GK C+ +   C  SPC N G+C   S+ L   + C+C   + G+ C    +  C  + C NGG+C  +  ++ + C C   + G  CQ    D   C +++  +C+N   C N  +  ++C C  G+ G  C  NT++C    CF G  CID + S+ C C KG  G  C L+ D C S PC   AIC        + C C  G  G  C     +E  Q   C +     ++  ++  NC        C+     CES PC    +CL     DDP      C PG        +   C   PC+    C
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCE-TKNLCASSPCRN---------------------GATCTALAG-SSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGIC--RSNGL--SYECKCPKGFEGKNCEQ-NYDDCLGHLCQNGGTC--IDGISDYTCRCPPNFTGRFCQ---DDVDECAQRDHPVCQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSE-DIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCL-----DDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTC 541          

HSP 14 Score: 159.844 bits (403), Expect = 7.140e-39
Identity = 118/370 (31.89%), Postives = 174/370 (47.03%), Query Frame = 2
Query: 1529 GTNCEIYKTGCSPNPCLNGAYCYT-INQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD------------ACSMPQMLNSS--------GIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC--IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNP---CFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            GT+  +    C+   C NG  C T +N   YC C+  + G  CEH  P C +  C++               +C  P   + S           H  C   GTC     E++ C C  G+ G+ CE   + C ++PC+NG  C  +   ++F C C  GF G TC    + C  +PC   G C+      +  + C C   + G+ C   K+  C  +PC NGG C R + L+ ++C C +G+ G  C+  + D       +LC+N G CI+ G +D+TC C P F G+ C  + +EC       C NG  C +   SY CIC  G+ G +C  N D+C    C YGA C+D +  F C+C +G+ G LC
Sbjct:   52 GTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNP-CNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVN----THGSYQCMCPTGYTGKDCDT-KYKPCSPSPCQNGGIC-RSNGLS-YECKCPKGFEGKNCEQNYDDC----LGHLCQNGGTCID-GISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC 407          

HSP 15 Score: 102.834 bits (255), Expect = 1.659e-21
Identity = 72/242 (29.75%), Postives = 114/242 (47.11%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENL-----------------------------------LSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG---TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKE-INECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL 1435
            GQ C+ +++ CA N PC+NGG C +                                    +  V  ++C+C  GF G  CE  I+ C  NPC       C++    ++C C     G+ C+     C Q+ CQNGG C   ++G+  CIC  G+ G  C L+   C+++ C+   +C +     G Y+C C  G  G++C+ + ++EC PNPC     C D + DY+C C + +KGK C++
Sbjct: 1215 GQNCELNIDDCAPN-PCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHH-CICNNGFYGKNCELSGQDCDSNPCRVG-NCVVADEGFG-YRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDI 1452          
BLAST of Delta-like protein vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 334.339 bits (856), Expect = 2.136e-95
Identity = 238/685 (34.74%), Postives = 334/685 (48.76%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENN--PCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDE-NGNRRCICQQGYKG-------SECHLAAPCENS---------------------QCKHALD------CQIQSTAL---GDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCE----------SAYDACSMPQM-----LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ-------------------------------FLHID----FQPCRRKNLCKNEGVCI-NVGYNDFTCHCKPGFEGKHCDINTNECN-PNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            N+ G+FC   ++ CA+ +   C+NG  C N       Y CIC +G+ G DC    D C    C  G TC+   G FYCQC +  TG LC  D + C  N C     C     NG+  C C  GYKG        EC   +PCE++                     +C+  ++      CQ + + L   G ++C+C PG+TG  C+ +I+EC  NPC N+G C D IN +KC+C+  F G  C++NI  CQ+QPC+N G+C +   GY+C+C  GYTGT+CEI    C  NPC  G     +N  F C C+  + G  C+     C +  C+          S Y  C          +N +    N C    TC+      + C+C+PGF G  CE ++D+C ++PC N G+CID +N ++C C  GF+   C    D C  +PC+N G C    ++  N+FIC C   + G+ C L     C SNPC +GG+C     LN F C C  G+ G  C+                               F   D      PC   N CKNE  C  +  + DF+C CK G+ G++CD + +EC+  +PC NG  C++   SYRC+C KG+ G +C +N D+CASFPC  G  C+D I D+ C C +G DGK C+   N    QP
Sbjct:  322 NFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGS---YSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDA-CTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCIDDVNS-FKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDG-INSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRC----EDGINEFICHCPPGYTGKRCELDIDE-CSSNPCQHGGTC--YDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPC-ASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQP 992          

HSP 2 Score: 36.965 bits (84), Expect = 2.136e-95
Identity = 31/94 (32.98%), Postives = 45/94 (47.87%), Query Frame = 3
Query:  573 CKNNGGHYKCDINGEKVCDYGWMGSDCNNT--ICQPGCHRIHGYCENPG---ECRCRAGWQGTFC----DECMKYPGCKHGTCVD--SPWTCSC 821
            C N  G Y+C      +C  G+ G DC+     C P   +  G C + G   EC+C  G++G  C    D+C+ +     GTC+D  S +TC C
Sbjct:  232 CVNTHGSYQC------MCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRC 319          

HSP 3 Score: 331.257 bits (848), Expect = 1.215e-92
Identity = 225/624 (36.06%), Postives = 314/624 (50.32%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCK-KGTCMKSKG--EFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCGKY---------------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGV--CINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGA-ICVDRIDDFECRCPEGRDGKLCDHVKNNE-SPQP 2593
            + GQ C+ +++ C   NPC NGG C   + +V  YKC+C   F GRDCE  +DPC  N CK +  C  S    +F C C   +TG+ CD+D   C  +S C+NG  C  +  G+ RC+C +GY+G +C +    C +  C++   C      +GDY CLC  G+ GK+C+ +INEC+  PC+N   C+  +N Y C C   F G NC+ N   C    C NGG C +   GY C C  GY+G NC+     C  NPCLNGA C+  N ++ CHC   F GK+C     +CG   CE+      M    +   S+G     C                        GTC  +     +C C  G+ G  C+ +ID+C++ PC+NGG C D I  +EC C  GF G+ CE   D C  +PC N G C    D + N F C C     G +C + K   C    C N GSC  +  + GF+C C  G++G  C+    D   C   N C N G   C+ +  N++ C+C+PG  G+HC+   + C  +PC NGG C  + + + CIC  GFYG NC+L+  +C S PC  G  +  D    + C CP G  G+ C+    +E SP P
Sbjct:  821 YTGQKCETNIDDCV-TNPCGNGGTC---IDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC-LNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCL---DGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDY-GNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTC---HDRVMN-FSCSCPPGTMGIICEINKDD-CKPGACHNNGSC--IDRVGGFECVCQPGFVGARCEG---DINECL-SNPCSNAGTLDCVQL-VNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQDCDSNPCRVGNCVVADEGFGYRCECPRGTLGEHCEIDTLDECSPNP 1423          

HSP 4 Score: 309.686 bits (792), Expect = 1.377e-86
Identity = 245/771 (31.78%), Postives = 346/771 (44.88%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPC--------------------------------------FNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN--NESP--QPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQA---NGTDDPYA------CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNN-QISWPGES----HKDCQPNSIKNHNYCAKIILTFN 2959
            + G  C+  ++ C ++NPC N G C +   ++  +KC C  GF G  C+I  D C   PC+ +G C  S   + C+C   +TG  C+ + + CD N C  G +C  D N + +C+C  GY G  C      CE++ C+    CQ +   +G Y C CQ G +GK C+  +NEC  NPC N   C D IN YKC C   F G++CE N+  C + PC N GVC +   GY C+C  G+   +C      C+ NPC+N   C     +F CHC   + GKRCE     C +  C+                         GTC   +   F C+CMPG+ G  CE +IDDC TNPC NGG CID +N ++C+C   F G+ CE + D C  + C N   C   S+ L  DF C CK  + GR C         S+PC NG SC  L+    ++C C +G+ G  C    I+   C     C+N G C++ G  D++C C  GF+GKHC+ + NEC   PC                                       NGG CID +N Y C C  G+ G+NCQ   ++C S PC  GA C ++ +++ C CP G  GK C    +   +SP     +C      F    +  +  +   CD   ++C+         L+    NGT   Y       C  G            C   PC     C      Y    +  + G++      DC PN  +N   C   ++ F+
Sbjct:  518 FTGTQCEIDIDEC-QSNPCLNDGTCHD---KINGFKCSCALGFTGARCQINIDDCQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRG-KCIDDVN-SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDR---VGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHG-----------------------GTCYD-KLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFL--DFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASC--LNVPGSYRCLCTKGYEGRDCA---INTDDCASF-PCQNGGTCLD-GIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGK--LCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFS 1244          

HSP 5 Score: 32.3426 bits (72), Expect = 1.377e-86
Identity = 37/103 (35.92%), Postives = 45/103 (43.69%), Query Frame = 3
Query:  564 DRYCKNNGGHYK--CD---INGEKVCD--YGWMGSDCNNTI--CQPGCHRIH-GYCEN-PG--ECRCRAGWQGTFCD----ECMKYPGCKHGTCVDSPWTCSC 821
            D  C +N  H    CD   ING   C    G+ G DC+  I  C  G    H G C N PG   C C  G+ G  C+    EC  +P    G+C+D P T  C
Sbjct:  410 DDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRC 512          

HSP 6 Score: 298.13 bits (762), Expect = 1.330e-82
Identity = 219/690 (31.74%), Postives = 324/690 (46.96%), Query Frame = 2
Query:  845 CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSI----------------------------------------------CDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAI--CVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGET-------WSYNCQNCACDRGKVTCESVPCGVWTCLQAN 2731
            C   ++ CA +NPC N G CE+ ++E   + C CP G+ G+ CE  ID C  NPC+ G TC      F CQC+  +TG+ C+ +   C  N C NGG C    NG  +C+C+  + G +C     PC +++CK+   C   S  L D+ C C+ GYTG+YCD++I+EC + +PC+N   C +    Y+C C+  ++G++C +N   C + PC+NGG C +    Y+C C  G+ G +CE     C   PC NGA C      + C C   F G  C+ +   C   SC            LN            G+C+      + C C+ G+ G +C+  ++ C +NPC NG  C +  N + C C +GF GK C E  D+C +SPC N   C     ++ + F C+C   W G+LC +   S                                               C S PC NGG+C  L  +  ++C C QG+ G  C+    D  P    N C+N G C +   N F+C C PG  G  C+IN ++C P  C N G CID++  + C+C  GF G+ C+ + +EC S PC+      CV  ++++ C C  G  G+ C+H  +  +  P        I  SG         +  NC+    D     C+S PC V  C+ A+
Sbjct:  750 CLSDVDECA-SNPCVNEGRCEDGINE---FICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNG-YKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFL-DFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSC------------LNG-----------GSCIDG-INGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSPCENGATC----SQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDL--IGAYECQCRQGFQGQNCELNIDDCAP----NPCQNGGTCHDRVMN-FSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGFYGKNCELSGQD-----CDSNPCRVGNCVVAD 1393          

HSP 7 Score: 30.4166 bits (67), Expect = 1.330e-82
Identity = 32/119 (26.89%), Postives = 44/119 (36.97%), Query Frame = 3
Query:  519 SMNLICKPDYYGEFC--------------DRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTI-------CQPGCHRIHGYCENPGECRCRAGWQGTFC----DECMKYPGCKHGTCVD 800
            S   +C P Y G  C              D +C++  G Y C       C  G  G +C   +       C  G   I G   N  +C+C  G+ G  C    DEC+  P   +G C+D
Sbjct:  622 SFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQ------CQAGTSGKNCEVNVNECHSNPCNNGATCIDGI--NSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCID 732          

HSP 8 Score: 299.671 bits (766), Expect = 1.668e-82
Identity = 206/600 (34.33%), Postives = 295/600 (49.17%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIN--DYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI------DFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESP 2587
            + GQ C+++++ C  ++PC N G+C   + +V  YKC CP GF    C  ++D C  NPC  +G C     EF C C   +TGK C+ D   C  N CQ+GG C  D+     C C  GY G +C      C  + C +   C  +   +  YKC+C+  +TG+ C+ +++ C  N CKN   CT S N  D+ C C   + G+ C+ +I     + PC+NG  C  V   Y C C  GY G +C I    C+  PC NG  C     D+ C C   F GK CE     C ++ C++    CS  Q +NS                     + C C  GF G +C+ + +DC  + C NGG CID IN + C C  G+ G  C+ + + C  +PC+N   C     E  N++ C C + + G+ C       C  +PC NG +CS++   + F C C+ GW G +C    I      D +    + LC N G C + G N   C+C  G+ G +C    +EC   PC NGG C D + +Y C C +GF G NC+LN D+CA  PC  G  C DR+ +F C CP G  G +C+  K++  P
Sbjct:  707 FTGQHCEKNVDECI-SSPCANNGVC---IDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTC-YDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDK---VNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSNFLDFSCTCKLGYTGRYCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEGRDCAINTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLSQPCQNGA-TCS--QYVNS---------------------YTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGYNCSCLAGYSGANCQYKLNKCDSNPCLNGATC----HEQNNEYTCHCPSGFTGKQCS-EYVDWCGQSPCENGATCSQMK--HQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNN-GTCKDYG-NSHVCYCSQGYAGSYCQKEIDECQSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKP 1265          

HSP 9 Score: 298.13 bits (762), Expect = 5.889e-82
Identity = 206/633 (32.54%), Postives = 296/633 (46.76%), Query Frame = 2
Query:  842 FCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI-DPCFPNPCKKG---TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI---ACQNQP-CKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE----------HSRPYCGNE--------SCESAY---------DACSMPQMLNSSGIKHNYCGKY----------------------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEG 2542
             C+ ++    ++  C NGG C+  L  ++ Y C C +G+ G  CE  + C  +PC+ G   T +     F C C   +TG  C  D   C  N C+ GG C  + +G+ +C+C  GY G +C     PC  S C++   C+    +   Y+C C  G+ GK C++  ++C+ + C+N G C D I+DY C C  +F G+ C+ ++   A ++ P C+NG  C      Y+C C  G+ G +C      C    C  GA C      FYC C K   G  C           H+   C           SC + Y         D C        +GI  N  G Y                            G+CL  +   F C CMPGF G  CEIDID+C++NPC N G C D IN F+C C  GF G  C+   D C   PC N G+C     +    + CEC   + G  C +  +  CDSNPC  G     +  +N F+C C+ G+ G +C  Q    +  PC+    C++           + C C+ G  GK+C++N NEC+ NPC NG  CID +NSY+C C  GF G +C+ N DEC S PCA   +C+D+++ ++C CP G
Sbjct:  134 LCEIAVPNACDHVTCLNGGTCQ--LKTLEEYTCACANGYTGERCETKNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTC-VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLS---YECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLD-DPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCRNRGIC----HDSIAGYSCECPPGYTGTSCEININD-CDSNPCHRGKC---IDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDR-------VGSYYCQCQAGTSGKNCEVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRG 744          

HSP 10 Score: 294.278 bits (752), Expect = 9.903e-81
Identity = 214/697 (30.70%), Postives = 315/697 (45.19%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK---------------------------------------GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS---CQNGGQCGKDENGNRRCICQQGYKGSEC--------------------------------------HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID---FQPCRR--------------------------------KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   +  C ++NPCK GG C N       Y+C+CP+G+ G+DC+    PC P+PC+                                        GTC+    ++ C+C   +TG+ C  D   C Q     CQNG  C  + +G+  CIC  G+ G +C                                      HL   C ++ C     C   S   G Y C C  GY G  C ++I+EC   +PC++NG+C ++   Y+CNCS  F G  CE NI  C++ PC+N G C +    + C C  G+TGT CEI    C  NPCLN   C+     F C C   F G RC+ +   C ++ C              + GI H+    Y            C C PG+ G SCEI+I+DC +NPC   G CID +N+F+C+CD G+ G  C+++ + C  +PC   G    H  +    + C+C+    G+ C +  +  C SNPC NG +C  +  +N ++C C  G+ G  C+  ++D     PC                                   N C NEG C + G N+F CHC PG+ GK C+++ +EC+ NPC +GG C DKLN++ C C  G+ G  C+ N D+C + PC  G  C+D+++ ++C C     G+ C+
Sbjct:  209 FTGDTCSYDIEEC-QSNPCKYGGTCVNTHGS---YQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATC-TNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDT-SPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQPCR-------------NRGICHDSIAGYS-----------CECPPGYTGTSCEININDCDSNPCHR-GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDG----HCQDRVGSYYCQCQAGTSGKNCEVNVNE-CHSNPCNNGATC--IDGINSYKCQCVPGFTGQHCE-KNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCED-GINEFICHCPPGYTGKRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCE 865          

HSP 11 Score: 275.404 bits (703), Expect = 1.056e-74
Identity = 205/614 (33.39%), Postives = 294/614 (47.88%), Query Frame = 2
Query:  860 NYCAENNPC-----KNGGICENLLSEVQP-YKCICPSGFEGRDCEIDPCFPNPCKKGTC-------MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNR-RCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNP---CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYC----GKYG-------TCLSHE------------KEKFICRCMPGFEGDSCEIDIDDC-KTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID---FQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            +YC   NPC     +NGG C+      +P   C CP GF+   CEI    PN C   TC       +K+  E+ C C   +TG+ C+   ++C  + C+NG  C      +   C C  G+ G  C +    C+++ CK+   C       G Y+C+C  GYTGK CD +   C P+PC+N G+C  +   Y+C C   F+GKNCE N   C    C+NGG C +  + YTC+C   +TG  C+     C+      C NGA C   +  + C C   + G  C ++   C   +C   Y A  +       G+   YC    GK G        C S+                + C C  G++G  C  DID+C + +PC++ GIC+++  ++ C C  GF G  CE   + C   PC N G CL         F C C   + G  C +     C SNPCLN G+C     +NGF+C C  G+ G  CQ ++ID    QPCR + +C +           ++C C PG+ G  C+IN N+C+ NPC   GKCID +NS++C+C  G+ G  CQ   +EC S PC +   C DR+  + C+C  G  GK C+
Sbjct:   92 DYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEI--AVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCET-KNLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTC---VNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAAC--FYGATCI------DGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSEDIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDP----GTFRCVCMPGFTGTQCEIDIDE-CQSNPCLNDGTCH--DKINGFKCSCALGFTGARCQ-INIDDCQSQPCRNRGICHDS-------IAGYSCECPPGYTGTSCEININDCDSNPCHR-GKCIDDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSYYCQCQAGTSGKNCE 675          

HSP 12 Score: 266.929 bits (681), Expect = 5.000e-72
Identity = 205/636 (32.23%), Postives = 287/636 (45.13%), Query Frame = 2
Query: 1010 GTCMKS-KGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNR---RCICQQGYKGSECHLAAP--CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTD--SINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDC--KTNP-CKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPCGVWTCLQANGTDDPYA----CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            GTC+    G+ YC C   + G  C+   + C+   CQNGG C       R    C C  G+  S C +A P  C++  C +   CQ+++  L +Y C C  GYTG+ C+ + N C  +PC+N   CT     + + C+C   F G  C  +I  CQ+ PCK GG C      Y C C TGYTG +C+     CSP+PC NG  C +    + C C K F GK CE +            YD C          + H  C   GTC+    + + CRC P F G  C+ D+D+C  + +P C+NG  C ++  ++ CIC NG+ G  C   TD C ++ C     C+    +    F C+C     G LCHL     C SNPC     C        + C C  G+ G  C     D   C + + C++ G+C+N     + C+C  GF G  C+ N NEC  +PC N G C+D   ++RC+C  GF G+ C+++ DEC S PC     C D+I+ F+C C  G  G  C    ++   QP  C       DS   +S  C       +C+     C+S PC    C+     DD  +    C PG   Y        C   PC     C      Y
Sbjct:   71 GTCVTQLNGKTYCACDSHYVGDYCEH-RNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKT--LEEYTCACANGYTGERCETK-NLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQN------------YDDC----------LGH-LCQNGGTCIDGISD-YTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCI----DGVGSFYCQCTKGKTGLLCHL--DDACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSE---DIDECDQGSPCEHNGICVNT-PGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCLDDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQSQP--CRNRGICHDSIAGYSCECPPGYTGTSCEININDCDSNPCHRGKCI-----DDVNSFKCLCDPGYTGYICQKQINECESNPCQFDGHCQDRVGSY 661          

HSP 13 Score: 174.866 bits (442), Expect = 1.871e-43
Identity = 156/521 (29.94%), Postives = 229/521 (43.95%), Query Frame = 2
Query: 1334 CVPNPCKNNGVCTDSINDYK-CNCSTSFKGKNCELNIACQNQPCKNGGVCQEV----DTGYTCKCKTGYTGTNCEI-YKTGCSPNPCLNGAYCYTIN-QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKN--LCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRI--DDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNC----ACDRGKVTCESVPC-GVWTCLQANGTDDPY----ACKPGEMCYSFPFNPKRCFVPPCVPKARC 2836
            C    C+N G C   +N    C C + + G  CE    C +  C+NGG CQ        G +CKC  G+  + CEI     C    CLNG  C     +++ C C   + G+RCE ++  C +  C +                     G   T L+     F C C PGF GD+C  DI++C++NPCK GG C+++  +++C+C  G+ GK C+ +   C  SPC N G+C   S+ L   + C+C   + G+ C    +  C  + C NGG+C  +  ++ + C C   + G  CQ    D   C +++  +C+N   C N  +  ++C C  G+ G  C  NT++C    CF G  CID + S+ C C KG  G  C L+ D C S PC   AIC        + C C  G  G  C     +E  Q   C +     ++  ++  NC        C+     CES PC    +CL     DDP      C PG        +   C   PC+    C
Sbjct:   62 CTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNPCNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCE-TKNLCASSPCRN---------------------GATCTALAG-SSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGIC--RSNGL--SYECKCPKGFEGKNCEQ-NYDDCLGHLCQNGGTC--IDGISDYTCRCPPNFTGRFCQ---DDVDECAQRDHPVCQNGATCTNT-HGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLD-DACTSNPCHADAICDTSPINGSYACSCATGYKGVDCSE-DIDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNINECESHPCQNEGSCL-----DDPGTFRCVCMPGFTGTQCEIDIDECQSNPCLNDGTC 541          

HSP 14 Score: 159.844 bits (403), Expect = 7.140e-39
Identity = 118/370 (31.89%), Postives = 174/370 (47.03%), Query Frame = 2
Query: 1529 GTNCEIYKTGCSPNPCLNGAYCYT-INQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD------------ACSMPQMLNSS--------GIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGIC--IDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNP---CFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            GT+  +    C+   C NG  C T +N   YC C+  + G  CEH  P C +  C++               +C  P   + S           H  C   GTC     E++ C C  G+ G+ CE   + C ++PC+NG  C  +   ++F C C  GF G TC    + C  +PC   G C+      +  + C C   + G+ C   K+  C  +PC NGG C R + L+ ++C C +G+ G  C+  + D       +LC+N G CI+ G +D+TC C P F G+ C  + +EC       C NG  C +   SY CIC  G+ G +C  N D+C    C YGA C+D +  F C+C +G+ G LC
Sbjct:   52 GTDTALVAASCTSVGCQNGGTCVTQLNGKTYCACDSHYVGDYCEHRNP-CNSMRCQNGGTCQVTFRNGRPGISCKCPLGFDESLCEIAVPNACDHVTCLNGGTCQLKTLEEYTCACANGYTGERCETK-NLCASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQSNPCKYGGTCVN----THGSYQCMCPTGYTGKDCDT-KYKPCSPSPCQNGGIC-RSNGLS-YECKCPKGFEGKNCEQNYDDC----LGHLCQNGGTCID-GISDYTCRCPPNFTGRFCQDDVDECAQRDHPVCQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLC 407          

HSP 15 Score: 102.834 bits (255), Expect = 1.659e-21
Identity = 72/242 (29.75%), Postives = 114/242 (47.11%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENL-----------------------------------LSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG---TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKE-INECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL 1435
            GQ C+ +++ CA N PC+NGG C +                                    +  V  ++C+C  GF G  CE  I+ C  NPC       C++    ++C C     G+ C+     C Q+ CQNGG C   ++G+  CIC  G+ G  C L+   C+++ C+   +C +     G Y+C C  G  G++C+ + ++EC PNPC     C D + DY+C C + +KGK C++
Sbjct: 1215 GQNCELNIDDCAPN-PCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHH-CICNNGFYGKNCELSGQDCDSNPCRVG-NCVVADEGFG-YRCECPRGTLGEHCEIDTLDECSPNPCAQGAACEDLLGDYECLCPSKWKGKRCDI 1452          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083739)

HSP 1 Score: 159.458 bits (402), Expect = 7.793e-77
Identity = 104/291 (35.74%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFP--NPCKK-GTCM---KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNG----GQCGKDENGN-RRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE 1657
            WGG +C+Q LNYC  + PCKNGG C N    +  Y C C  G+ G DC  EI  C    NPC+  GTC+    +K  + C C   W+GK+C++    C    C  G     + G    G   +C C  GY G  C L    C  + C +   CQ         KC+C  G++G  C+  I++C+ + C+N G C D +N Y+C C   F G +C   +  C  +PC NGG C  ++  Y C C+ G+TG +C +    CS  PC NG  C      F C C   F GK+C+
Sbjct:  283 WGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSG------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 2 Score: 149.828 bits (377), Expect = 7.793e-77
Identity = 91/286 (31.82%), Postives = 140/286 (48.95%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-------NKESTHSYKFTIKSSWPGSITLIIEAY-DTSETNPYR--KAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            L    CF  I    V S   F L++  +     +  +G+CC          C   C  RF +CL++Y A++        T  C YG  +T I G++S+         NK  T+  +F    SWPG+ +LI+EA+ DT+ +   R  K +I R++ +  L+ S   S W      +  +  ++   + C  +YYG  C ++C+   ++ GH  C   GE +C  GW G  C+   C  GC   HG+C+ P +C C+ GW+G  C+EC+  P C HGTC + PWTC C
Sbjct:    8 LTAFICFTVIVQ--VHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATID------TTSQCTYGDVITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVS---SEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCE--HGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTC-NKPWTCIC 279          

HSP 3 Score: 174.096 bits (440), Expect = 4.136e-44
Identity = 127/361 (35.18%), Postives = 176/361 (48.75%), Query Frame = 2
Query: 1505 CKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCK--TNPCKNGGICID---SINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYND---FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            C C+ G+ G  C   +    PN C++G    T N+ + C CN+ + G  C     YC N                      H  C   GTC +  +  + C+C PG+ GD CE +I  C    NPC+NGG CID   +   ++C C NG+ GK CEE+   C   PC + G+C      L +    + CEC   + G  C L   + C  NPC+NGGSC         +C C  G+ GT C+    +   C   + C+N G CI++  N + C C PGF G HC    + C   PC NGG C++  N Y+C C  GF G +C ++ DEC+S PC  G  C++R++ FEC C  G  GK CD
Sbjct:  246 CVCQLGWKGALCN--ECVLEPN-CIHG----TCNKPWTCICNEGWGGLYCNQDLNYCTN----------------------HRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPC-HQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDN-CSPNPCINGGSCQPSG-----KCICPAGFSGTRCE---TNIDDCL-GHQCENGGTCIDM-VNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 4 Score: 163.696 bits (413), Expect = 9.302e-41
Identity = 129/403 (32.01%), Postives = 178/403 (44.17%), Query Frame = 2
Query:  926 QPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSIC-DQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVP--NPCKNNGVCTD---SINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEV-------DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCGKY------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLR-HSDELYNDFI 2044
            +P +C+C  G++G  C      PN C  GTC K    + C C E W G  C+QD + C +   C+NGG C                                         +T  G Y C C PGY+G  C+ EI  C    NPC+N G C D   +   YKC+C+  + GK CE  +  C ++PC  G +C+ V         GY C+C  GY+G NC++    CSPNPC+NG  C    +   C C   F G RCE +   C    CE+      M          G    +C               GTCL+   + + C C  GF G  C +DID+C + PC NGG C++ +N+FEC+C NGF GK C+E +   +      YG   +  +D L N  +
Sbjct:  242 KPNQCVCQLGWKGALCNECVLEPN-CIHGTCNK---PWTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTC----------------------------------------FNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK---CICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNND-YQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNAQV 595          

HSP 5 Score: 110.923 bits (276), Expect = 2.671e-24
Identity = 75/215 (34.88%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICEN----LLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE 1432
            N W G+ C++ +  C++  PC   GIC N    L S+ Q Y+C CP G+ G +C  ++D C PNPC  G   +  G+  C C   ++G  C+ +   C  + C+NGG C  D     RC C  G+ G+ C       L  PC N      L+         DY+C C+ G+TGK C  +I+EC   PC N G C + +N ++C C+  F+GK C+
Sbjct:  364 NGWSGKMCEEKVLTCSD-KPCHQ-GICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK--CICPAGFSGTRCETNIDDCLGHQCENGGTC-IDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLN--------NDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 6 Score: 83.9593 bits (206), Expect = 1.544e-18
Identity = 63/191 (32.98%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPY-KCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND 1387
            + G  CD  L+ C+ N PC NGG C       QP  KCICP+GF G  CE  ID C  + C+ G TC+    ++ CQC+  + G  C     +C    C NGG C  + N + +C C+ G+ G +C +    C +  C +   C      +  ++C+C  G+ GK CD+E  + V       G  T +  D
Sbjct:  410 YSGPNCDLQLDNCSPN-PCINGGSC-------QPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTC-LNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCM---NRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARAD 588          

HSP 7 Score: 30.0314 bits (66), Expect = 1.544e-18
Identity = 36/116 (31.03%), Postives = 45/116 (38.79%), Query Frame = 3
Query:  531 ICKPDYYGEFCDR---YCKN-----NGGHYKCDINGEKV----CDYGWMGSDCNNTICQPGCHRIHGYCENPG------------ECRCRAGWQGTFCDECMKYPGCKHGTCVDSP 806
            IC   + G +C++   YC N     NGG   C   GE +    C  G+ G DC N I    C      C+N G            +C C  GW G  C+E       K  TC D P
Sbjct:  278 ICNEGWGGLYCNQDLNYCTNHRPCKNGG--TCFNTGEGLYTCKCAPGYSGDDCENEI--YSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEE-------KVLTCSDKP 382          

HSP 8 Score: 92.0485 bits (227), Expect = 1.834e-18
Identity = 81/265 (30.57%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 1910 NFECICDNGFFG----KTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPK------HSICDS---------------NPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNP--NPCFNGGKCIDKLNS---YRCICAKGFYGSNCQLNYDECASFPCAYGAICVD-------RIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            +F   CD  ++G    K C  R D    S C   G  +             C   W G  CH+PK      H  CD                N C+   +C   +    + C CN+GW G  C   + D   C     CKN G C N G   +TC C PG+ G  C+     C+   NPC NGG CID+ ++   Y+C CA G+ G  C+     C+  PC  G IC +       +   ++C CP G  G  CD   +N SP P
Sbjct:  179 DFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEII-------------CLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYC---NQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNP 426          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0083740)

HSP 1 Score: 159.458 bits (402), Expect = 7.793e-77
Identity = 104/291 (35.74%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFP--NPCKK-GTCM---KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNG----GQCGKDENGN-RRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE 1657
            WGG +C+Q LNYC  + PCKNGG C N    +  Y C C  G+ G DC  EI  C    NPC+  GTC+    +K  + C C   W+GK+C++    C    C  G     + G    G   +C C  GY G  C L    C  + C +   CQ         KC+C  G++G  C+  I++C+ + C+N G C D +N Y+C C   F G +C   +  C  +PC NGG C  ++  Y C C+ G+TG +C +    CS  PC NG  C      F C C   F GK+C+
Sbjct:  283 WGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSG------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 2 Score: 149.828 bits (377), Expect = 7.793e-77
Identity = 91/286 (31.82%), Postives = 140/286 (48.95%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-------NKESTHSYKFTIKSSWPGSITLIIEAY-DTSETNPYR--KAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            L    CF  I    V S   F L++  +     +  +G+CC          C   C  RF +CL++Y A++        T  C YG  +T I G++S+         NK  T+  +F    SWPG+ +LI+EA+ DT+ +   R  K +I R++ +  L+ S   S W      +  +  ++   + C  +YYG  C ++C+   ++ GH  C   GE +C  GW G  C+   C  GC   HG+C+ P +C C+ GW+G  C+EC+  P C HGTC + PWTC C
Sbjct:    8 LTAFICFTVIVQ--VHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATID------TTSQCTYGDVITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVS---SEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCE--HGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTC-NKPWTCIC 279          

HSP 3 Score: 174.096 bits (440), Expect = 4.136e-44
Identity = 127/361 (35.18%), Postives = 176/361 (48.75%), Query Frame = 2
Query: 1505 CKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCK--TNPCKNGGICID---SINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYND---FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            C C+ G+ G  C   +    PN C++G    T N+ + C CN+ + G  C     YC N                      H  C   GTC +  +  + C+C PG+ GD CE +I  C    NPC+NGG CID   +   ++C C NG+ GK CEE+   C   PC + G+C      L +    + CEC   + G  C L   + C  NPC+NGGSC         +C C  G+ GT C+    +   C   + C+N G CI++  N + C C PGF G HC    + C   PC NGG C++  N Y+C C  GF G +C ++ DEC+S PC  G  C++R++ FEC C  G  GK CD
Sbjct:  246 CVCQLGWKGALCN--ECVLEPN-CIHG----TCNKPWTCICNEGWGGLYCNQDLNYCTN----------------------HRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPC-HQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDN-CSPNPCINGGSCQPSG-----KCICPAGFSGTRCE---TNIDDCL-GHQCENGGTCIDM-VNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 4 Score: 163.696 bits (413), Expect = 9.302e-41
Identity = 129/403 (32.01%), Postives = 178/403 (44.17%), Query Frame = 2
Query:  926 QPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSIC-DQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVP--NPCKNNGVCTD---SINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEV-------DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCGKY------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLR-HSDELYNDFI 2044
            +P +C+C  G++G  C      PN C  GTC K    + C C E W G  C+QD + C +   C+NGG C                                         +T  G Y C C PGY+G  C+ EI  C    NPC+N G C D   +   YKC+C+  + GK CE  +  C ++PC  G +C+ V         GY C+C  GY+G NC++    CSPNPC+NG  C    +   C C   F G RCE +   C    CE+      M          G    +C               GTCL+   + + C C  GF G  C +DID+C + PC NGG C++ +N+FEC+C NGF GK C+E +   +      YG   +  +D L N  +
Sbjct:  242 KPNQCVCQLGWKGALCNECVLEPN-CIHGTCNK---PWTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTC----------------------------------------FNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK---CICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNND-YQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNAQV 595          

HSP 5 Score: 110.923 bits (276), Expect = 2.671e-24
Identity = 75/215 (34.88%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICEN----LLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE 1432
            N W G+ C++ +  C++  PC   GIC N    L S+ Q Y+C CP G+ G +C  ++D C PNPC  G   +  G+  C C   ++G  C+ +   C  + C+NGG C  D     RC C  G+ G+ C       L  PC N      L+         DY+C C+ G+TGK C  +I+EC   PC N G C + +N ++C C+  F+GK C+
Sbjct:  364 NGWSGKMCEEKVLTCSD-KPCHQ-GICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK--CICPAGFSGTRCETNIDDCLGHQCENGGTC-IDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLN--------NDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 6 Score: 83.9593 bits (206), Expect = 1.544e-18
Identity = 63/191 (32.98%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPY-KCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND 1387
            + G  CD  L+ C+ N PC NGG C       QP  KCICP+GF G  CE  ID C  + C+ G TC+    ++ CQC+  + G  C     +C    C NGG C  + N + +C C+ G+ G +C +    C +  C +   C      +  ++C+C  G+ GK CD+E  + V       G  T +  D
Sbjct:  410 YSGPNCDLQLDNCSPN-PCINGGSC-------QPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTC-LNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCM---NRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARAD 588          

HSP 7 Score: 30.0314 bits (66), Expect = 1.544e-18
Identity = 36/116 (31.03%), Postives = 45/116 (38.79%), Query Frame = 3
Query:  531 ICKPDYYGEFCDR---YCKN-----NGGHYKCDINGEKV----CDYGWMGSDCNNTICQPGCHRIHGYCENPG------------ECRCRAGWQGTFCDECMKYPGCKHGTCVDSP 806
            IC   + G +C++   YC N     NGG   C   GE +    C  G+ G DC N I    C      C+N G            +C C  GW G  C+E       K  TC D P
Sbjct:  278 ICNEGWGGLYCNQDLNYCTNHRPCKNGG--TCFNTGEGLYTCKCAPGYSGDDCENEI--YSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEE-------KVLTCSDKP 382          

HSP 8 Score: 92.0485 bits (227), Expect = 1.834e-18
Identity = 81/265 (30.57%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 1910 NFECICDNGFFG----KTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPK------HSICDS---------------NPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNP--NPCFNGGKCIDKLNS---YRCICAKGFYGSNCQLNYDECASFPCAYGAICVD-------RIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            +F   CD  ++G    K C  R D    S C   G  +             C   W G  CH+PK      H  CD                N C+   +C   +    + C CN+GW G  C   + D   C     CKN G C N G   +TC C PG+ G  C+     C+   NPC NGG CID+ ++   Y+C CA G+ G  C+     C+  PC  G IC +       +   ++C CP G  G  CD   +N SP P
Sbjct:  179 DFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEII-------------CLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYC---NQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNP 426          
BLAST of Delta-like protein vs. Ensembl Fly
Match: Dl (gene:FBgn0000463 transcript:FBtr0304658)

HSP 1 Score: 159.458 bits (402), Expect = 7.793e-77
Identity = 104/291 (35.74%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFP--NPCKK-GTCM---KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNG----GQCGKDENGN-RRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE 1657
            WGG +C+Q LNYC  + PCKNGG C N    +  Y C C  G+ G DC  EI  C    NPC+  GTC+    +K  + C C   W+GK+C++    C    C  G     + G    G   +C C  GY G  C L    C  + C +   CQ         KC+C  G++G  C+  I++C+ + C+N G C D +N Y+C C   F G +C   +  C  +PC NGG C  ++  Y C C+ G+TG +C +    CS  PC NG  C      F C C   F GK+C+
Sbjct:  283 WGGLYCNQDLNYCTNHRPCKNGGTCFNTGEGL--YTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSG------KCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 2 Score: 149.828 bits (377), Expect = 7.793e-77
Identity = 91/286 (31.82%), Postives = 140/286 (48.95%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-------NKESTHSYKFTIKSSWPGSITLIIEAY-DTSETNPYR--KAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            L    CF  I    V S   F L++  +     +  +G+CC          C   C  RF +CL++Y A++        T  C YG  +T I G++S+         NK  T+  +F    SWPG+ +LI+EA+ DT+ +   R  K +I R++ +  L+ S   S W      +  +  ++   + C  +YYG  C ++C+   ++ GH  C   GE +C  GW G  C+   C  GC   HG+C+ P +C C+ GW+G  C+EC+  P C HGTC + PWTC C
Sbjct:    8 LTAFICFTVIVQ--VHSSGSFELRLKYFSNDHGRDNEGRCCSGESDGATGKCLGSCKTRFRVCLKHYQATID------TTSQCTYGDVITPILGENSVNLTDAQRFQNKGFTNPIQFPFSFSWPGTFSLIVEAWHDTNNSGNARTNKLLIQRLLVQQVLEVS---SEWKTNKSESQYTSLEYDFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEIICLTGWQGDYCHIPKCAKGCE--HGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTC-NKPWTCIC 279          

HSP 3 Score: 174.096 bits (440), Expect = 4.136e-44
Identity = 127/361 (35.18%), Postives = 176/361 (48.75%), Query Frame = 2
Query: 1505 CKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCK--TNPCKNGGICID---SINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYND---FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            C C+ G+ G  C   +    PN C++G    T N+ + C CN+ + G  C     YC N                      H  C   GTC +  +  + C+C PG+ GD CE +I  C    NPC+NGG CID   +   ++C C NG+ GK CEE+   C   PC + G+C      L +    + CEC   + G  C L   + C  NPC+NGGSC         +C C  G+ GT C+    +   C   + C+N G CI++  N + C C PGF G HC    + C   PC NGG C++  N Y+C C  GF G +C ++ DEC+S PC  G  C++R++ FEC C  G  GK CD
Sbjct:  246 CVCQLGWKGALCN--ECVLEPN-CIHG----TCNKPWTCICNEGWGGLYCNQDLNYCTN----------------------HRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPC-HQGICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDN-CSPNPCINGGSCQPSG-----KCICPAGFSGTRCE---TNIDDCL-GHQCENGGTCIDM-VNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 4 Score: 163.696 bits (413), Expect = 9.302e-41
Identity = 129/403 (32.01%), Postives = 178/403 (44.17%), Query Frame = 2
Query:  926 QPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSIC-DQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVP--NPCKNNGVCTD---SINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEV-------DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCGKY------------GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLR-HSDELYNDFI 2044
            +P +C+C  G++G  C      PN C  GTC K    + C C E W G  C+QD + C +   C+NGG C                                         +T  G Y C C PGY+G  C+ EI  C    NPC+N G C D   +   YKC+C+  + GK CE  +  C ++PC  G +C+ V         GY C+C  GY+G NC++    CSPNPC+NG  C    +   C C   F G RCE +   C    CE+      M          G    +C               GTCL+   + + C C  GF G  C +DID+C + PC NGG C++ +N+FEC+C NGF GK C+E +   +      YG   +  +D L N  +
Sbjct:  242 KPNQCVCQLGWKGALCNECVLEPN-CIHGTCNK---PWTCICNEGWGGLYCNQDLNYCTNHRPCKNGGTC----------------------------------------FNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK---CICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLNND-YQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARADGLTNAQV 595          

HSP 5 Score: 110.923 bits (276), Expect = 2.671e-24
Identity = 75/215 (34.88%), Postives = 110/215 (51.16%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICEN----LLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE 1432
            N W G+ C++ +  C++  PC   GIC N    L S+ Q Y+C CP G+ G +C  ++D C PNPC  G   +  G+  C C   ++G  C+ +   C  + C+NGG C  D     RC C  G+ G+ C       L  PC N      L+         DY+C C+ G+TGK C  +I+EC   PC N G C + +N ++C C+  F+GK C+
Sbjct:  364 NGWSGKMCEEKVLTCSD-KPCHQ-GICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNPCINGGSCQPSGK--CICPAGFSGTRCETNIDDCLGHQCENGGTC-IDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTCLNLN--------NDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCMNRVNSFECVCANGFRGKQCD 565          

HSP 6 Score: 83.9593 bits (206), Expect = 1.544e-18
Identity = 63/191 (32.98%), Postives = 92/191 (48.17%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPY-KCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND 1387
            + G  CD  L+ C+ N PC NGG C       QP  KCICP+GF G  CE  ID C  + C+ G TC+    ++ CQC+  + G  C     +C    C NGG C  + N + +C C+ G+ G +C +    C +  C +   C      +  ++C+C  G+ GK CD+E  + V       G  T +  D
Sbjct:  410 YSGPNCDLQLDNCSPN-PCINGGSC-------QPSGKCICPAGFSGTRCETNIDDCLGHQCENGGTCIDMVNQYRCQCVPGFHGTHCSSKVDLCLIRPCANGGTC-LNLNNDYQCTCRAGFTGKDCSVDIDECSSGPCHNGGTCM---NRVNSFECVCANGFRGKQCDEESYDSVTFDAHQYGATTQARAD 588          

HSP 7 Score: 30.0314 bits (66), Expect = 1.544e-18
Identity = 36/116 (31.03%), Postives = 45/116 (38.79%), Query Frame = 3
Query:  531 ICKPDYYGEFCDR---YCKN-----NGGHYKCDINGEKV----CDYGWMGSDCNNTICQPGCHRIHGYCENPG------------ECRCRAGWQGTFCDECMKYPGCKHGTCVDSP 806
            IC   + G +C++   YC N     NGG   C   GE +    C  G+ G DC N I    C      C+N G            +C C  GW G  C+E       K  TC D P
Sbjct:  278 ICNEGWGGLYCNQDLNYCTNHRPCKNGG--TCFNTGEGLYTCKCAPGYSGDDCENEI--YSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEE-------KVLTCSDKP 382          

HSP 8 Score: 92.0485 bits (227), Expect = 1.834e-18
Identity = 81/265 (30.57%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 1910 NFECICDNGFFG----KTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPK------HSICDS---------------NPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNP--NPCFNGGKCIDKLNS---YRCICAKGFYGSNCQLNYDECASFPCAYGAICVD-------RIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            +F   CD  ++G    K C  R D    S C   G  +             C   W G  CH+PK      H  CD                N C+   +C   +    + C CN+GW G  C   + D   C     CKN G C N G   +TC C PG+ G  C+     C+   NPC NGG CID+ ++   Y+C CA G+ G  C+     C+  PC  G IC +       +   ++C CP G  G  CD   +N SP P
Sbjct:  179 DFRVTCDLNYYGSGCAKFCRPRDDSFGHSTCSETGEII-------------CLTGWQGDYCHIPKCAKGCEHGHCDKPNQCVCQLGWKGALCNECVLEPNCIHGTCNKPWTCICNEGWGGLYC---NQDLNYCTNHRPCKNGGTCFNTGEGLYTCKCAPGYSGDDCENEIYSCDADVNPCQNGGTCIDEPHTKTGYKCHCANGWSGKMCEEKVLTCSDKPCHQG-ICRNVRPGLGSKGQGYQCECPIGYSGPNCDLQLDNCSPNP 426          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag1a (jagged canonical Notch ligand 1a [Source:NCBI gene;Acc:140421])

HSP 1 Score: 473.011 bits (1216), Expect = 4.960e-172
Identity = 317/926 (34.23%), Postives = 470/926 (50.76%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKE--KFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARC-IKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERNISNST 3562
            NWGGQ CD+ LN C    PC NGG C N   +   Y C CP G+ G++CE   + C   PC   G C++S   F CQC   WTG  C+ +   C  N C + G C    +G  +CIC   + G  C + A  CE S C +A  C+     +G Y C C PG+TG+ CD  +N+C    C N G+C D +N Y+C C+  F G  CE ++  C ++PC NGG CQ+   G+ C C  G++G  C++    C   PC NGA C+++  D+YC C +++ GK C   + +C    C+   D+C++  + NS+      I  + CG +G C SH      F C C  GF G  C  +I+DC+++PC +GG CID IN ++CIC +G+ G  CE   D C  +PC + GVC     +L NDF CEC+N W G+ CH  + S CD + C NGG+CS     + F+C C+ GW G  C   +I        N C+N   C+  G + FTC CK G+EG  C  N+N+CNP PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ CVD I+ + C CP GR G  C  V          CV   RI   G  W+ +C  C C +G VTC  + CG   C +  +G  D   C  G+MC   P   ++CFV PC  +  C +K  S       +        CQP+S     +CA +  TFNK  +P G+T++ +C  ++ L   +++       S+ +SC+++   S  ++VAI+     I+        P       +I   L+     N++    + ++ +      + + D   ++  L+  + A  VL L   + +  +     R++ +++T IN  +  S P     +           +HL +  N  E+N SN +
Sbjct:  288 NWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPD--KYHCACPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDG-FKCICPVQWTGKTCLIDANECEESPCVNAHSCR---NLIGGYFCECLPGWTGQNCDINVNDC-HGQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRCQDTLNGFQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQ-VIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCR----DLVNDFYCECENGWKGKTCH-SRESQCDEDTCNNGGTCSDEG--DSFKCLCSPGWEGATC---NIAKNSSCLPNPCENGATCVVTG-DGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCVDGDNWYRCECASGFAGPDCRININECQSSPCAFGSTCVDEINGYRCLCPPGRTGPRCQEVTGR------PCVIGGRIAVDGAKWAEDCNTCYCHKGIVTCTKLFCGPKACRMLGSGRGD---CPTGQMC--VPVRDEQCFVKPCSSQGECFVKPCSSQGECWSAHRPTVRTHCQPDS-----HCANVTFTFNKDTMPQGVTVEQVCRELRHLYVTKNVTSE---FSISVSCELSSAASNEIHVAIHVTENGIH-----GRVPVKEITDNII--DLVSKHSANSSVIGSIAEVRVQRKQPQNPNVDY--MVPLLVSVVTAIWVLALASVFLWCIRHH---RKQSSSATAINPTSPFSTPEENTANN--------AREHLNQIKNHIEKNASNGS 1155          

HSP 2 Score: 153.68 bits (387), Expect = 4.960e-172
Identity = 88/270 (32.59%), Postives = 135/270 (50.00%), Query Frame = 3
Query:   48 ESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDS--SMKFNKESTHSYKFTIKSS--WPGSITLIIEAYD---TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            E+   F +++      + +  +G CC       + +C    C   F +CL+ Y + VS   P      C+YG   T + G +  S+K   ++    +  +  S  WP S TLI+EA D    S T      VI++ V    + P+     W  +  +   + +Q+ + + C   Y+G  C+++C+      GHY CD NG K C  GW G +CN  IC+ GC   HG C+ PG CRC  GWQG +CD+C+ +PGC HGTC++ PW C C+
Sbjct:   27 EASGHFEMQVLSMQNVNGELQNGACCDGARDPAERSCAADQCDTFFRVCLKEYQSRVSSGGP------CSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFNNDSSTGSINGQVIEKAVQSGMINPNR---QWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTAICKQGCSIEHGSCKVPGNCRCLYGWQGEYCDQCIPHPGCVHGTCIE-PWQCLCD 286          

HSP 3 Score: 277.715 bits (709), Expect = 4.372e-76
Identity = 206/641 (32.14%), Postives = 306/641 (47.74%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNP-CKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQ-NSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCM---------------------------NYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYD-ECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ 2656
            W G  C+ ++        CK G   E+   +V P  C C  G++G  C  D C P+P C  GTC++    + C C   W G+LCD+D + C     C NGG C         C C +GY G  C  A   C +  C +   C    ++LG ++C C  G+TG  C+   ++C PNPC ++GVC D ++ +KC C   + GK C ++   C+  PC N   C+ +  GY C+C  G+TG NC+I    C    CLNG  C  +   + C C   F G RCE     C +  C            LN    +    G            F C C PGF G +C++D+D C++ PC+NG  C    +++ C C   + GK C +  D+C+ +PC                             +G C  HS      F C+C++ + G  CH    + C+S+PCL+GG+C  +  +N +QC C  GW G  C+    +   C R N C++ GVC ++  NDF C C+ G++GK C    ++C+ + C NGG C D+ +S++C+C+ G+ G+ C +  +  C   PC  GA CV   D F C C EG +G  C    N+ +PQP    Y +     G+ W Y C+
Sbjct:  225 WAGPECNTAI--------CKQGCSIEHGSCKV-PGNCRCLYGWQGEYC--DQCIPHPGCVHGTCIEP---WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCERADNACLSEPCLNGGLC--VESSLG-FECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSCRNLIGGYFCECLPGWTGQNCDINVNDCH-GQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPC------------LNGGRCQDTLNG------------FQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHS-HAGGHFSCDCQDGFTGTYCH-ENINDCESSPCLSGGTC--IDKINAYQCICADGWEGPNCE---TNIDDC-RTNPCRDRGVCRDL-VNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQP---CYNSGTCVDGDNW-YRCE 810          

HSP 4 Score: 258.84 bits (660), Expect = 5.705e-70
Identity = 178/532 (33.46%), Postives = 252/532 (47.37%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGY--NDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C+E W G  C+  T+IC Q      G C    N    C C  G++G  C    P  +  C H        T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y C C   + G+NCE  + AC ++PC NGG+C E   G+ C+C  G+TG +C I +  CSPNPC +   C  +   F C C  ++ GK C      C    C +A+                N  G Y            C C+PG+ G +C+I+++DC    C NGG+C D +N + C+C  GF G  CE   D C   PC+N G C     +  N F C C   + G  C L     C+S PC NG  C  L++   + C C + + G  C  L  H    PC+                       ++C   G C +  +    F+C C+ GF G +C  N N+C  +PC +GG CIDK+N+Y+CICA G+ G NC+ N D+C + PC    +C D ++DF C C  G  GK C
Sbjct:  221 CLEGWAGPECN--TAICKQGCSIEHGSCKVPGN----CRCLYGWQGEYCDQCIP--HPGCVHG-------TCIEPWQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSC-------------RNLIGGY-----------FCECLPGWTGQNCDINVNDCHGQ-CLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRC----QDTLNGFQCLCPPGFSGATCQL-DLDYCESGPCQNGAQCFSLAS--DYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCRDLVNDFYCECENGWKGKTC 705          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag1a (jagged canonical Notch ligand 1a [Source:NCBI gene;Acc:140421])

HSP 1 Score: 472.626 bits (1215), Expect = 5.858e-172
Identity = 315/925 (34.05%), Postives = 467/925 (50.49%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKE--KFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERNISNST 3562
            NWGGQ CD+ LN C    PC NGG C N   +   Y C CP G+ G++CE   + C   PC   G C++S   F CQC   WTG  C+ +   C  N C + G C    +G  +CIC   + G  C + A  CE S C +A  C+     +G Y C C PG+TG+ CD  +N+C    C N G+C D +N Y+C C+  F G  CE ++  C ++PC NGG CQ+   G+ C C  G++G  C++    C   PC NGA C+++  D+YC C +++ GK C   + +C    C+   D+C++  + NS+      I  + CG +G C SH      F C C  GF G  C  +I+DC+++PC +GG CID IN ++CIC +G+ G  CE   D C  +PC + GVC     +L NDF CEC+N W G+ CH  + S CD + C NGG+CS     + F+C C+ GW G  C   +I        N C+N   C+  G + FTC CK G+EG  C  N+N+CNP PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ CVD I+ + C CP GR G  C  V          CV   RI   G  W+ +C  C C +G VTC  + CG   C +  +G  D   C  G+MC   P   ++CFV PC  +  C   +                 CQP+S     +CA +  TFNK  +P G+T++ +C  ++ L   +++       S+ +SC+++   S  ++VAI+     I+        P       +I   L+     N++    + ++ +      + + D   ++  L+  + A  VL L   + +  +     R++ +++T IN  +  S P     +           +HL +  N  E+N SN +
Sbjct:  288 NWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPD--KYHCACPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDG-FKCICPVQWTGKTCLIDANECEESPCVNAHSCR---NLIGGYFCECLPGWTGQNCDINVNDC-HGQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRCQDTLNGFQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQ-VIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCR----DLVNDFYCECENGWKGKTCH-SRESQCDEDTCNNGGTCSDEG--DSFKCLCSPGWEGATC---NIAKNSSCLPNPCENGATCVVTG-DGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCVDGDNWYRCECASGFAGPDCRININECQSSPCAFGSTCVDEINGYRCLCPPGRTGPRCQEVTGR------PCVIGGRIAVDGAKWAEDCNTCYCHKGIVTCTKLFCGPKACRMLGSGRGD---CPTGQMC--VPVRDEQCFVKPCSSQGECWSAHRPTVRTH----------CQPDS-----HCANVTFTFNKDTMPQGVTVEQVCRELRHLYVTKNVTSE---FSISVSCELSSAASNEIHVAIHVTENGIH-----GRVPVKEITDNII--DLVSKHSANSSVIGSIAEVRVQRKQPQNPNVDY--MVPLLVSVVTAIWVLALASVFLWCIRHH---RKQSSSATAINPTSPFSTPEENTANN--------AREHLNQIKNHIEKNASNGS 1144          

HSP 2 Score: 154.066 bits (388), Expect = 5.858e-172
Identity = 88/270 (32.59%), Postives = 135/270 (50.00%), Query Frame = 3
Query:   48 ESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVP-CIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDS--SMKFNKESTHSYKFTIKSS--WPGSITLIIEAYD---TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            E+   F +++      + +  +G CC       + +C    C   F +CL+ Y + VS   P      C+YG   T + G +  S+K   ++    +  +  S  WP S TLI+EA D    S T      VI++ V    + P+     W  +  +   + +Q+ + + C   Y+G  C+++C+      GHY CD NG K C  GW G +CN  IC+ GC   HG C+ PG CRC  GWQG +CD+C+ +PGC HGTC++ PW C C+
Sbjct:   27 EASGHFEMQVLSMQNVNGELQNGACCDGARDPAERSCAADQCDTFFRVCLKEYQSRVSSGGP------CSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFNNDSSTGSINGQVIEKAVQSGMINPNR---QWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTAICKQGCSIEHGSCKVPGNCRCLYGWQGEYCDQCIPHPGCVHGTCIE-PWQCLCD 286          

HSP 3 Score: 277.715 bits (709), Expect = 4.153e-76
Identity = 206/641 (32.14%), Postives = 306/641 (47.74%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNP-CKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQ-NSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCM---------------------------NYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYD-ECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ 2656
            W G  C+ ++        CK G   E+   +V P  C C  G++G  C  D C P+P C  GTC++    + C C   W G+LCD+D + C     C NGG C         C C +GY G  C  A   C +  C +   C    ++LG ++C C  G+TG  C+   ++C PNPC ++GVC D ++ +KC C   + GK C ++   C+  PC N   C+ +  GY C+C  G+TG NC+I    C    CLNG  C  +   + C C   F G RCE     C +  C            LN    +    G            F C C PGF G +C++D+D C++ PC+NG  C    +++ C C   + GK C +  D+C+ +PC                             +G C  HS      F C+C++ + G  CH    + C+S+PCL+GG+C  +  +N +QC C  GW G  C+    +   C R N C++ GVC ++  NDF C C+ G++GK C    ++C+ + C NGG C D+ +S++C+C+ G+ G+ C +  +  C   PC  GA CV   D F C C EG +G  C    N+ +PQP    Y +     G+ W Y C+
Sbjct:  225 WAGPECNTAI--------CKQGCSIEHGSCKV-PGNCRCLYGWQGEYC--DQCIPHPGCVHGTCIEP---WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCERADNACLSEPCLNGGLC--VESSLG-FECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSCRNLIGGYFCECLPGWTGQNCDINVNDCH-GQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPC------------LNGGRCQDTLNG------------FQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHS-HAGGHFSCDCQDGFTGTYCH-ENINDCESSPCLSGGTC--IDKINAYQCICADGWEGPNCE---TNIDDC-RTNPCRDRGVCRDL-VNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQP---CYNSGTCVDGDNW-YRCE 810          

HSP 4 Score: 258.455 bits (659), Expect = 5.917e-70
Identity = 178/532 (33.46%), Postives = 252/532 (47.37%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGY--NDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C+E W G  C+  T+IC Q      G C    N    C C  G++G  C    P  +  C H        T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y C C   + G+NCE  + AC ++PC NGG+C E   G+ C+C  G+TG +C I +  CSPNPC +   C  +   F C C  ++ GK C      C    C +A+                N  G Y            C C+PG+ G +C+I+++DC    C NGG+C D +N + C+C  GF G  CE   D C   PC+N G C     +  N F C C   + G  C L     C+S PC NG  C  L++   + C C + + G  C  L  H    PC+                       ++C   G C +  +    F+C C+ GF G +C  N N+C  +PC +GG CIDK+N+Y+CICA G+ G NC+ N D+C + PC    +C D ++DF C C  G  GK C
Sbjct:  221 CLEGWAGPECN--TAICKQGCSIEHGSCKVPGN----CRCLYGWQGEYCDQCIP--HPGCVHG-------TCIEPWQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPEGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSC-------------RNLIGGY-----------FCECLPGWTGQNCDINVNDCHGQ-CLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRC----QDTLNGFQCLCPPGFSGATCQL-DLDYCESGPCQNGAQCFSLAS--DYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCRDLVNDFYCECENGWKGKTC 705          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag1b (jagged canonical Notch ligand 1b [Source:NCBI gene;Acc:140423])

HSP 1 Score: 467.618 bits (1202), Expect = 2.556e-171
Identity = 296/881 (33.60%), Postives = 440/881 (49.94%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNN---TFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWY--HRKKMVEIREKYANST 3424
            NWGGQ CD+ LNYC  + PC NGG C N   +   Y+C C  G+ G +CE     C  NPC  G TC ++   + C C   W+G  C+ +   C  N C++GG C    NG  +C C   + G  C + A  CE+  C +A  C      +G Y C C PG++G+ CD  IN+C    C N G C D +N Y+C C   + G+ CE ++  C + PC NGG CQ+   G+ C C  G++G  C++    C PNPC NGA C+ +  D++C C  ++ GK C H + +C   SC+   D+C++    NS+      I  N CG +G C S    +F C C  GF G  C  +I+DC++NPC+NGG CID +N ++CIC +G+ G  CE   D C  +PC+N G C     +L NDF CEC+N W G+ CH  + S CD   C NGG+C      + F+C C+ GW G  C   +I        N C+N G C+ V  + F C CK G+EG  C  NTN+CNP+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ CVD I+ + C CP GR G  C  V          C+   ++   G  W  +C  C C  G++ C  + CG  +C           C   + C   P   ++CFV PC     C       P+            C  +     + CA I  TFNK+N+P G++++ +C+ ++    +++L+      ++ ISC+ + + S  ++++I +         +K+           I   +ID++  +N   T    +  + +H +      +    L+  L    I   +  L  A+ +  HR++        A S 
Sbjct:  284 NWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPD--KYQCSCEDGYSGVNCERAEHACLSNPCANGGTCKETSQGYECHCAIGWSGTSCEINVDDCTPNQCKHGGTCQDLVNG-FKCACPPHWTGKTCQIDANECEDKPCVNAKSCH---NLIGAYFCECLPGWSGQNCDININDC-KGQCLNGGTCKDLVNGYRCLCPPGYTGEQCEKDVDECASSPCLNGGRCQDEVNGFQCLCPAGFSGQLCQLDIDYCKPNPCQNGAQCFNLASDYFCKCPDDYEGKNCSHLKDHCRTTSCQ-VIDSCTVAVASNSTPEGVRYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCRNGGTCIDKVNVYQCICADGWEGVHCEINIDDCSLNPCLNKGAC----QDLVNDFYCECRNGWKGKTCH-SRDSQCDEATCNNGGTCHDEG--DTFKCRCSPGWEGATC---NIAKNSSCLPNPCENGGTCV-VNGDSFNCVCKEGWEGSTCTENTNDCNPHPCYNSGTCVDGENWYRCECAPGFAGPDCRININECQSSPCAFGSTCVDEINGYRCLCPPGRIGPDCQEVVGR------PCIANGQVTADGAKWEEDCNICQCQNGRIHCTMMWCGPKSCRTGKARG---GCPASQSC--VPIKEEQCFVKPCPSLGECWPSAPPPPSK-----------CHASFSYQDDSCANITFTFNKENMPQGLSVEHVCNELRHWYLLKNLSTE---YAVSISCEPSSSASNEIHISISTEEPRTDRSPIKD-----------ITVQIIDLVSKHNGNSTIIKAITGVRVHQIPSPKTDY----LVPLLSSIFIVLWIFALASAFLWCIHRRRKQNTHSNTATSA 1105          

HSP 2 Score: 157.147 bits (396), Expect = 2.556e-171
Identity = 91/268 (33.96%), Postives = 137/268 (51.12%), Query Frame = 3
Query:   48 ESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTI----KSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            ++   F L+I      + +  +G CC    +     CT   C   F +CL+ Y + VS        G C++G   T + G +  KF+ + T S K  I      +WP S TLI+EA D  +ET      +I++  +   + P+     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GW G DCN  IC+ GC   HG C+ PG C+C  GWQG +CD+C+ +PGC HGTCV+ PW C C+
Sbjct:   27 DASGHFELEILSMQNANGELQNGACCDGARNPADRKCTRDECDTYFKVCLKEYQSRVS------SAGACSFGTGSTPVLGGN--KFSTKGTRSEKSRIVLPFSFAWPRSYTLIVEALDFNNETASESGKLIEKAYHSGMINPNR---QWQRLTHNGPVAQFEYQIRVTCLEHYYGFGCNKFCRPRDEFFGHYTCDQNGNKTCLEGWTGPDCNTAICRQGCSTEHGSCKQPGGCKCLYGWQGPYCDKCIPHPGCVHGTCVE-PWQCLCD 282          

HSP 3 Score: 273.092 bits (697), Expect = 8.458e-75
Identity = 211/634 (33.28%), Postives = 293/634 (46.21%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E WTG  C+  T+IC Q      G C K   G   C C  G++G  C    P  +  C H        T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE    AC + PC NGG C+E   GY C C  G++GT+CEI    C+PN C +G  C  +   F C C   + GK C+     C ++ C +A                HN  G Y            C C+PG+ G +C+I+I+DCK   C NGG C D +N + C+C  G+ G+ CE+  D C  SPC+N G C    DE+ N F C C   + G+LC L     C  NPC NG  C  L++   + C C   + G  C  L  H     C+                       N+C   G C +     FTC C+ GF G +C  N N+C  NPC NGG CIDK+N Y+CICA G+ G +C++N D+C+  PC     C D ++DF C C  G  GK C H ++++  +  +C       D G+T+   C    +   C+  K  +C   PC        NG      CK G    +   N   C   PC     C+   + Y
Sbjct:  217 CLEGWTGPDCN--TAICRQGCSTEHGSC-KQPGG---CKCLYGWQGPYCDKCIP--HPGCVHG-------TCVEPWQCLCDTNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCEDGYSGVNCERAEHACLSNPCANGGTCKETSQGYECHCAIGWSGTSCEINVDDCTPNQCKHGGTCQDLVNGFKCACPPHWTGKTCQIDANECEDKPCVNAKSC-------------HNLIGAY-----------FCECLPGWSGQNCDININDCKGQ-CLNGGTCKDLVNGYRCLCPPGYTGEQCEKDVDECASSPCLNGGRC---QDEV-NGFQCLCPAGFSGQLCQL-DIDYCKPNPCQNGAQCFNLAS--DYFCKCPDDYEGKNCSHLKDHCRTTSCQVIDSCTVAVASNSTPEGVRYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCRNGGTCIDKVNVYQCICADGWEGVHCEINIDDCSLNPCLNKGACQDLVNDFYCECRNGWKGKTC-HSRDSQCDE-ATCNNGGTCHDEGDTFKCRCSPGWEGATCNIAKNSSCLPNPCENGGTCVVNGDSFNCVCKEGWEGSTCTENTNDCNPHPCYNSGTCVDGENWY 801          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 454.907 bits (1169), Expect = 7.257e-170
Identity = 299/829 (36.07%), Postives = 416/829 (50.18%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI----YKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSS--GIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITI 3265
            NWGG  CD+ LNYC  ++PC NGG C N  SE   Y C CP G+ G++CEI    C  NPC  G TC +    F C C   W G  C +D   C  + C  GG C   ENG   C+C   + G  C + A  C    C +A  C+     +G Y C C  G+ G+ CD  +N C    C+N   C + ++  Y C C   F G +CE++   C + PC+NGG C  +   + C+C + Y G  CE+    +   C PNPC N A CY++  DFYC C +++ GK CE+ + +C    C+   D+C++    NSS  G++H   N CG +G C+S     F C C  GF G  C  +++DC +NPC+NGG CID I++F+C C +G+ G  C    + C +SPC N G C+    +L NDF CEC N W G+ CH  + S CDS+ C NGG+C      + F+C C  GW G+ C               C N G C+  G + FTC CK G+EG  C  NTN+CNP+PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ F C CP GR G  C            +C Y    F  G  W   C  C C  GKV C  V CG   C L      + + C  G  C    F    C  PPC     C    +         P      C+PNS+     CA+I L FN+  +P G T++++C  ++ +   + L    +   L + CD++  N   V VAI     +   DE  +        S +++       ++N+T    ++++ +
Sbjct:  290 NWGGLLCDKDLNYCGTHHPCVNGGTCMN--SEPDEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPTGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENG-FECVCPPQWVGKTCQIDANECMGKPCVNAHSCK---NMIGGYHCDCFQGWAGQNCDINLNGC-HGQCQNGATCKELVHGGYHCQCPAGFVGLHCEVSRNKCASGPCQNGGRCHVILDSFVCECPSNYAGMLCEVESLSHPNPCEPNPCQNTALCYSLPGDFYCACPEDYEGKTCENRKDHCKMTPCQ-VIDSCTIAVASNSSDGGVRHINSNVCGPHGRCISQPGGNFTCTCELGFTGTYCHENVNDCVSNPCRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV----DLVNDFYCECANGWKGKTCH-SRESQCDSSTCSNGGTC--YDHGDAFRCACPPGWEGSTCNTAK---NSTCASGPCLNGGTCVG-GGDTFTCICKDGWEGATCAQNTNDCNPHPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCVCPLGRTGPQCQEFIGIGK----TCHYAGLQFPHGSRWEEECNTCQCVNGKVECTKVVCGRKPCLLPGTPGRELHYCPGGRECLEHNF--LTCLSPPCHQWGFCSSPET---------PPTLQTKCEPNSVYLDKSCARITLIFNRDKLPTGTTVENVCSELRYMPATRSL---AKDHKLLVLCDLSYKNQDAVEVAI-----SFQQDEQPSHSQIQEAASTIVS---TLSKRHNSTVMLAVIEVKV 1073          

HSP 2 Score: 164.851 bits (416), Expect = 7.257e-170
Identity = 97/288 (33.68%), Postives = 141/288 (48.96%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGD-HGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYK--------FTIKSSWPGSITLIIEAYD--TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            L I    L ++    +S   F L++      + +  DG+CC     S  Q      C   F +CL+ Y + V+       TG C +G   T++ G + + F        K             +WP S TLI+EA+D   S  N   + +I+R ++ + + P      W  +      +  ++ + + C  +YYG  C++ C+      GHY+CD +G  VC  GWMG DC   IC+ GC+ IHG C  PGEC+C  GWQG FCDEC+ YPGC HGTCV  PW C+CE
Sbjct:   11 LPIACLLLTMWTKVSQSSGYFELQLIAVENVNGELWDGECCDSTRNSQDQRCVRDECDTYFKVCLKEYQSEVT------TTGQCTFGSGSTDVLGGNIISFKTAKNSPSKTSDVGKIIIPFHFAWPRSYTLILEAWDWDNSTQNNGEENLIERHIHASMVNPG---DHWQSIRHPGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAICKQGCNLIHGGCAVPGECKCNYGWQGQFCDECLPYPGCLHGTCV-MPWQCTCE 288          

HSP 3 Score: 232.261 bits (591), Expect = 1.415e-61
Identity = 183/587 (31.18%), Postives = 262/587 (44.63%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSIN-NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS---ICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPC 2704
            C++ W G+ C   T+IC Q      G C         C C  G++G  C    P     C H        T +  ++C C+  + G  CDK++N C   +PC N G C +S  D Y C C   + GKNCE+   AC + PC NGG C EV TG+ C C  G+ G  C      C+ +PC  G  C  +   F C C  ++ GK C+     C  + C +A+   S   M+                       + C C  G+ G +C+I+++ C    C+NG  C + ++  + C C  GF G  CE   + C   PC N G C      + + F+CEC +N+ G LC +   S    C+ NPC N   C  L     F C C + + G  C+    H    PC+                       N+C   G CI+    +FTC C+ GF G +C  N N+C  NPC NGG CID ++S++C C  G+ G  C +N +EC+  PC  G  CVD ++DF C C  G  GK C H + ++     +C      +D G+ +   C    +   C+  K  TC S PC
Sbjct:  223 CLDGWMGEDCR--TAICKQGCNLIHGGCAVP----GECKCNYGWQGQFCDECLP--YPGCLHG-------TCVMPWQCTCEKNWGGLLCDKDLNYCGTHHPCVNGGTCMNSEPDEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPTGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENGFECVCPPQWVGKTCQIDANECMGKPCVNAH---SCKNMIGG---------------------YHCDCFQGWAGQNCDINLNGCHGQ-CQNGATCKELVHGGYHCQCPAGFVGLHCEVSRNKCASGPCQNGGRC----HVILDSFVCECPSNYAGMLCEVESLSHPNPCEPNPCQNTALCYSLP--GDFYCACPEDYEGKTCENRKDHCKMTPCQVIDSCTIAVASNSSDGGVRHINSNVCGPHGRCISQPGGNFTCTCELGFTGTYCHENVNDCVSNPCRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCVDLVNDFYCECANGWKGKTC-HSRESQC-DSSTCSNGGTCYDHGDAFRCACPPGWEGSTCNTAKNSTCASGPC 761          
BLAST of Delta-like protein vs. Ensembl Zebrafish
Match: jag2b (jagged canonical Notch ligand 2b [Source:ZFIN;Acc:ZDB-GENE-011128-3])

HSP 1 Score: 454.521 bits (1168), Expect = 1.389e-169
Identity = 299/829 (36.07%), Postives = 416/829 (50.18%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI----YKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSS--GIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITI 3265
            NWGG  CD+ LNYC  ++PC NGG C N  SE   Y C CP G+ G++CEI    C  NPC  G TC +    F C C   W G  C +D   C  + C  GG C   ENG   C+C   + G  C + A  C    C +A  C+     +G Y C C  G+ G+ CD  +N C    C+N   C + ++  Y C C   F G +CE++   C + PC+NGG C  +   + C+C + Y G  CE+    +   C PNPC N A CY++  DFYC C +++ GK CE+ + +C    C+   D+C++    NSS  G++H   N CG +G C+S     F C C  GF G  C  +++DC +NPC+NGG CID I++F+C C +G+ G  C    + C +SPC N G C+    +L NDF CEC N W G+ CH  + S CDS+ C NGG+C      + F+C C  GW G+ C               C N G C+  G + FTC CK G+EG  C  NTN+CNP+PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ F C CP GR G  C            +C Y    F  G  W   C  C C  GKV C  V CG   C L      + + C  G  C    F    C  PPC     C    +         P      C+PNS+     CA+I L FN+  +P G T++++C  ++ +   + L    +   L + CD++  N   V VAI     +   DE  +        S +++       ++N+T    ++++ +
Sbjct:  290 NWGGLLCDKDLNYCGTHHPCVNGGTCMN--SEPDEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPTGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENG-FECVCPPQWVGKTCQIDANECMGKPCVNAHSCK---NMIGGYHCDCFQGWAGQNCDINLNGC-HGQCQNGATCKELVHGGYHCQCPAGFVGLHCEVSRNKCASGPCQNGGRCHVILDSFVCECPSNYAGMLCEVESLSHPNPCEPNPCQNTALCYSLPGDFYCACPEDYEGKTCENRKDHCKMTPCQ-VIDSCTIAVASNSSDGGVRHINSNVCGPHGRCISQPGGNFTCTCELGFTGTYCHENVNDCVSNPCRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCV----DLVNDFYCECANGWKGKTCH-SRESQCDSSTCSNGGTC--YDHGDAFRCACPPGWEGSTCNTAK---NSTCASGPCLNGGTCVG-GGDTFTCICKDGWEGATCAQNTNDCNPHPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCVCPLGRTGPQCQEFIGIGK----TCHYAGLQFPHGSRWEEECNTCQCVNGKVECTKVVCGRKPCLLPGTPGRELHYCPGGRECLEHNF--LTCLSPPCHQWGFCSSPET---------PPTLQTKCEPNSVYLDKSCARITLIFNRDKLPTGTTVENVCSELRYMPATRSL---AKDHKLLVLCDLSYKNQDAVEVAI-----SFQQDEQPSHSQIQEAASTIVS---TLSKRHNSTVMLAVIEVKV 1073          

HSP 2 Score: 164.081 bits (414), Expect = 1.389e-169
Identity = 96/288 (33.33%), Postives = 140/288 (48.61%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYK--------FTIKSSWPGSITLIIEAYD--TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            L I    L ++    +S   F L++      + +  DG+CC    +     C    C   F +CL+ Y + V+       TG C +G   T++ G +   F        K             +WP S TLI+EA+D   S  N   + +I+R ++ + + P      W  +      +  ++ + + C  +YYG  C++ C+      GHY+CD +G  VC  GWMG DC   IC+ GC+ IHG C  PGEC+C  GWQG FCDEC+ YPGC HGTCV  PW C+CE
Sbjct:   11 LPIACLLLTMWTKVSQSSGYFELQLIAVENVNGELWDGECCDSTRNSQDQRCVRDECDTYFKVCLKEYQSEVT------TTGQCTFGSGSTDVLGGNIFSFKTAKNSPSKTSDVGKIIIPFHFAWPRSYTLILEAWDWDNSTQNNGEENLIERHIHASMVNPG---DHWQSIRHPGITAHIEYRIRVRCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLDGWMGEDCRTAICKQGCNLIHGGCAVPGECKCNYGWQGQFCDECLPYPGCLHGTCV-MPWQCTCE 288          

HSP 3 Score: 232.261 bits (591), Expect = 1.572e-61
Identity = 183/587 (31.18%), Postives = 262/587 (44.63%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSIN-NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS---ICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPC 2704
            C++ W G+ C   T+IC Q      G C         C C  G++G  C    P     C H        T +  ++C C+  + G  CDK++N C   +PC N G C +S  D Y C C   + GKNCE+   AC + PC NGG C EV TG+ C C  G+ G  C      C+ +PC  G  C  +   F C C  ++ GK C+     C  + C +A+   S   M+                       + C C  G+ G +C+I+++ C    C+NG  C + ++  + C C  GF G  CE   + C   PC N G C      + + F+CEC +N+ G LC +   S    C+ NPC N   C  L     F C C + + G  C+    H    PC+                       N+C   G CI+    +FTC C+ GF G +C  N N+C  NPC NGG CID ++S++C C  G+ G  C +N +EC+  PC  G  CVD ++DF C C  G  GK C H + ++     +C      +D G+ +   C    +   C+  K  TC S PC
Sbjct:  223 CLDGWMGEDCR--TAICKQGCNLIHGGCAVP----GECKCNYGWQGQFCDECLP--YPGCLHG-------TCVMPWQCTCEKNWGGLLCDKDLNYCGTHHPCVNGGTCMNSEPDEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPTGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENGFECVCPPQWVGKTCQIDANECMGKPCVNAH---SCKNMIGG---------------------YHCDCFQGWAGQNCDINLNGCHGQ-CQNGATCKELVHGGYHCQCPAGFVGLHCEVSRNKCASGPCQNGGRC----HVILDSFVCECPSNYAGMLCEVESLSHPNPCEPNPCQNTALCYSLP--GDFYCACPEDYEGKTCENRKDHCKMTPCQVIDSCTIAVASNSSDGGVRHINSNVCGPHGRCISQPGGNFTCTCELGFTGTYCHENVNDCVSNPCRNGGTCIDGISSFQCFCPDGWEGDLCSINVNECSRSPCKNGGHCVDLVNDFYCECANGWKGKTC-HSRESQC-DSSTCSNGGTCYDHGDAFRCACPPGWEGSTCNTAKNSTCASGPC 761          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 485.337 bits (1248), Expect = 7.702e-179
Identity = 315/876 (35.96%), Postives = 455/876 (51.94%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSR-PFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANS 3421
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC  G +C+++   F CQC   WTG  C  +   C  N C  GG C +D     +CIC   + G  C + A  CE   C +A  C+     +G Y C C PG+TG+ CD  IN+C+   C+N G C D +N ++C C   + G+ CE ++  C + PC NGG CQ+   G+ C C  G++G  C++    C P+PC NGA C+ +  D++C+C++++ GK C H + +C    CE   D+C++    NS+      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C K+PC N G C     +L NDF CECKN W G+ CH  + S CD   C NGG+C      + F+C C  GW G  C   +I        N C N G C+  G + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA C+D I+ + C CP GR G  C  V          C+    +   G  W  +C +C C  GKVTC  V CG   C   +G+ +   C  G+ C   P     CFVPPC     C      +P NQ   P    K C  N+      CA I  TFNK+ +  G+T + IC+ ++ L  +++++      S+ I+C+++ + +  ++VA       I ++E  + R P       +I   L+     NNTF   + ++ +      + +     L+  +L   +A+   ++   YW  RK+  +    +  S
Sbjct:  287 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTC-QDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCR---NLIGSYYCNCLPGWTGQNCDININDCL-GQCQNGGTCRDLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFNLATDYFCNCSEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCR----DLVNDFYCECKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDTFKCICPAGWEGATC---NIARNSSCLPNPCFNGGTCVVRG-DSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCTCPPGRSGPRCQEVTGR------PCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRC-DIHGSSE---CPAGQTC--VPIRDNHCFVPPCTGVGEC------WPTNQ---PPVKTK-CNANASYQDASCANITFTFNKEMMSPGLTTESICNELRNLNILKNVSAE---YSIYITCELSPSANNEIHVA-------ISVEENGDGRNPVKDITERII--DLVSKRDANNTFIASVAEVRVQRRQAKNGTDFLVPLLSSILT--VAWVCCLVTAFYWCIRKRRKQSSHSHTAS 1107          

HSP 2 Score: 164.851 bits (416), Expect = 7.702e-179
Identity = 91/281 (32.38%), Postives = 143/281 (50.89%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSS--MKFNKESTHS-YKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
              +I   L +      +  QF L+I      + +   G CC    +     C+   C   F +CL+ Y + VS        G C++G   T + G +S  +K+++ +  +        +WP S TL++EA+D +        +ID+ ++   + PS     W  +  +   + +++ + +IC   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PGECRC+ GWQG +CD+C+ +PGC HGTC + PW C CE
Sbjct:   15 FRLIIALLCLRLKVSIASGQFELEILSMQNPNGELQSGNCCDGQRNPTDRKCSRDECDTYFKVCLKEYQSRVSAG------GACSFGTGYTPVIGGNSFNLKYSRNNERNRIVLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPS---RQWQTLKQNAGMTHFEYQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSSKHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTC-NEPWQCLCE 285          

HSP 3 Score: 262.692 bits (670), Expect = 3.037e-71
Identity = 215/654 (32.87%), Postives = 292/654 (44.65%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHN----YCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCS--------------------------RLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E W G  C++  +IC Q      G C         C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC NGG C E   G+ C+C  G+TG  C I    CSPNPC  G  C  +   F C C  ++ GK C+       ++P     SC     S Y  C       +  I  N     C   GTC       F C C PG+ G+ CE D+++C +NPC NGG C D IN F+C+C  GF G  C+   DYC   PC N   C      L  D+ C C  ++ G+ C HL  H  C + PC    SC+                          R  +   F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG +C+ N N+C+ NPC+NGG C D +N + C C  G+ G  C     +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C         G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A CI E + Y
Sbjct:  220 CLEGWMGPECNK--AICRQGCSSKHGTCKTPG----ECRCQYGWQGQYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCRNLIGSYYCNCLPGWTGQNCDININDCLGQCQNGGTCRDL-VNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFN----LATDYFCNCSEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYC---HENINDC-ESNPCKNGGTCID-GVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCN-IARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGY 842          

HSP 4 Score: 90.5077 bits (223), Expect = 1.309e-17
Identity = 90/304 (29.61%), Postives = 120/304 (39.47%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG-VCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQ 1609
            + W G +C+ ++N C++ NPC NGG C +L++                                   E   +KCICP+G+EG  C I     C PNPC   GTC+     F C C E W G  C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C C PG +G  C     E    PC  NG +  D    D  CN      GK     + C  Q C   G   E   G TC            I    C   PC     C+  NQ
Sbjct:  657 DGWEGIYCETNINDCSK-NPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCIDE---INGYRCTCPPGRSGPRCQ----EVTGRPCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRCDIHGS-SECPAGQTC----------VPIRDNHCFVPPCTGVGECWPTNQ 940          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 465.307 bits (1196), Expect = 1.795e-171
Identity = 310/878 (35.31%), Postives = 433/878 (49.32%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQ---DTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANS 3421
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC  G +C+++   F CQC   WTG  C+    D   C  N C  GG C +D     +CIC   + G  C + A  CE   C +A  C+     +G Y C C PG+TG+ CD  IN+C+   C+N G C D +N ++C C   + G+ CE ++  C + PC NGG CQ+   G+ C C  G++G  C++    C P+PC NGA C+ +  D++C+C++++ GK C H + +C    CE   D+C++    NS+      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C K+PC N G C     +L NDF CECKN W G+ CH  + S CD   C NGG+C      + F+C C  GW G  C   +I        N C N G C+  G + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA C+D I+ + C CP GR G  C  V          C+    +   G  W  +C +C C  GKVTC  V CG   C   +G+ +   C  G+ C   P     CFVPPC     C      +P NQ   P    K C  N+      CA I  TFNK+ +                                +S  I  N+  +++V + +  E   + E K     +   + +I    I +    N F   LVD  +              L+  +L   +A+   ++   YW  RK+  +    +  S
Sbjct:  278 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCNLLFLDIDECSPNPCGYGGTC-QDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCR---NLIGSYYCNCLPGWTGQNCDININDCL-GQCQNGGTCRDLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFNLATDYFCNCSEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCR----DLVNDFYCECKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDTFKCICPAGWEGATC---NIARNSSCLPNPCFNGGTCVVRG-DSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCTCPPGRSGPRCQEVTGR------PCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRC-DIHGSSE---CPAGQTC--VPIRDNHCFVPPCTGVGEC------WPTNQ---PPVKTK-CNANASYQDASCANITFTFNKEMMSP------------------------------VSQTIKSNDLNVLSVIVVAKAERHQL-EGKTPACSSQLTTHLICSDFISI----NIFSRSLVDFLV-------------PLLSSILT--VAWVCCLVTAFYWCIRKRRKQSSHSHTAS 1064          

HSP 2 Score: 160.614 bits (405), Expect = 1.795e-171
Identity = 88/262 (33.59%), Postives = 137/262 (52.29%), Query Frame = 3
Query:   63 FSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSS--MKFNKESTHS-YKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            F L+I      + +   G CC    +     C+   C   F +CL+ Y + VS        G C++G   T + G +S  +K+++ +  +        +WP S TL++EA+D +        +ID+ ++   + PS     W  +  +   + +++ + +IC   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PGECRC+ GWQG +CD+C+ +PGC HGTC + PW C CE 
Sbjct:   26 FELEILSMQNPNGELQSGNCCDGQRNPTDRKCSRDECDTYFKVCLKEYQSRVSAG------GACSFGTGYTPVIGGNSFNLKYSRNNERNRIVLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPS---RQWQTLKQNAGMTHFEYQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSSKHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTC-NEPWQCLCET 277          

HSP 3 Score: 257.299 bits (656), Expect = 1.316e-69
Identity = 214/657 (32.57%), Postives = 292/657 (44.44%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTG---CSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHN----YCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCS--------------------------RLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E W G  C++  +IC Q      G C         C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC NGG C E   G+ C+C  G+TG  C +       CSPNPC  G  C  +   F C C  ++ GK C+       ++P     SC     S Y  C       +  I  N     C   GTC       F C C PG+ G+ CE D+++C +NPC NGG C D IN F+C+C  GF G  C+   DYC   PC N   C      L  D+ C C  ++ G+ C HL  H  C + PC    SC+                          R  +   F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG +C+ N N+C+ NPC+NGG C D +N + C C  G+ G  C     +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C         G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A CI E + Y
Sbjct:  211 CLEGWMGPECNK--AICRQGCSSKHGTCKTP----GECRCQYGWQGQYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCNLLFLDIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCRNLIGSYYCNCLPGWTGQNCDININDCLGQCQNGGTCRDL-VNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFN----LATDYFCNCSEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYC---HENINDC-ESNPCKNGGTCID-GVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCN-IARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGY 836          

HSP 4 Score: 90.5077 bits (223), Expect = 1.298e-17
Identity = 90/304 (29.61%), Postives = 120/304 (39.47%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG-VCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQ 1609
            + W G +C+ ++N C++ NPC NGG C +L++                                   E   +KCICP+G+EG  C I     C PNPC   GTC+     F C C E W G  C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C C PG +G  C     E    PC  NG +  D    D  CN      GK     + C  Q C   G   E   G TC            I    C   PC     C+  NQ
Sbjct:  651 DGWEGIYCETNINDCSK-NPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCIDE---INGYRCTCPPGRSGPRC----QEVTGRPCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRCDIHGS-SECPAGQTC----------VPIRDNHCFVPPCTGVGECWPTNQ 934          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 442.965 bits (1138), Expect = 6.140e-166
Identity = 306/869 (35.21%), Postives = 425/869 (48.91%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANS 3421
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC   G+C+++   F CQC   WTG  C  +   C  N C  GG C +D     +CIC   + G  C +       QC++   C+     +  ++C+C PGY G+ C+K++NECV NPC N G C D IN ++C C   F G  C+L+I  C+  PC+NG  C  + T Y C C   Y G NC   K  C   P      C  I                          +SC  A  + S P+ +    I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C K+PC N G C     +L NDF CECKN W G+ CH  K+S CD   C NGG+C      + F+C C  GW G  C   +I        N C N G C+  G + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA C+D I+ + C CP GR G  C  V          C+    +   G  W  +C +C C  GKVTC  V CG   C   +G+ +   C  G+ C   P     CFVPPC     C      +P NQ   P    K C  N+      CA I  TFNK+ +  G+T + IC+ ++ L  +++++      S+ I+C+++ + +  ++VAI S +   Y          A  ++   +    D I + N F   LVD  +              L+  +L   +A+   ++   YW  RK+  +    +  S
Sbjct:  282 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTC-QDLVDGFKCICPSQWTGKTCQIDINDCLGQCQNGGTCR---DLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFNLATDYFCNCSEDYEGKNCSHLKDHCRTTP------CEVI--------------------------DSCTVAVASNSTPEGVRY--ISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCR----DLVNDFYCECKNGWKGKTCHSRKYSQCDEATCNNGGTC--YDEGDTFKCICPAGWEGATC---NIARNSSCLPNPCFNGGTCVVRG-DSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCTCPPGRSGPRCQEVTGR------PCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRC-DIHGSSE---CPAGQTC--VPIRDNHCFVPPCTGVGEC------WPTNQ---PPVKTK-CNANASYQDASCANITFTFNKEMMSPGLTTESICNELRNLNILKNVSAE---YSIYITCELSPSANNEIHVAIVSNVHGTYP---------ALNIAAAESLSKHDFI-SINIFSRSLVDFLV-------------PLLSSILT--VAWVCCLVTAFYWCIRKRRKQSSHSHTAS 1050          

HSP 2 Score: 164.466 bits (415), Expect = 6.140e-166
Identity = 90/265 (33.96%), Postives = 139/265 (52.45%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSS--MKFNKESTHS-YKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            S  QF L+I      + +   G CC    +     C+   C   F +CL+ Y + VS        G C++G   T + G +S  +K+++ +  +        +WP S TL++EA+D +        +ID+ ++   + PS     W  +  +   + +++ + +IC   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PGECRC+ GWQG +CD+C+ +PGC HGTC + PW C CE
Sbjct:   26 SSGQFELEILSMQNPNGELQSGNCCDGQRNPTDRKCSRDECDTYFKVCLKEYQSRVSAG------GACSFGTGYTPVIGGNSFNLKYSRNNERNRIVLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPS---RQWQTLKQNAGMTHFEYQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSSKHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTC-NEPWQCLCE 280          

HSP 3 Score: 244.202 bits (622), Expect = 2.070e-65
Identity = 204/642 (31.78%), Postives = 277/642 (43.15%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKY-------------------------------CDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCS--------------------------RLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQ-LNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            D+NGN+ C+  +G+ G EC+ A   +    KH        T     +C CQ G+ G+Y                               CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC NGG C E   G+ C+C  G+TG  C I    CSPNPC  G  C  +   F C C  ++ GK C+     C  +                        C   GTC       F C C PG+ G+ CE D+++C +NPC NGG C D IN F+C+C  GF G  C+   DYC   PC N   C      L  D+ C C  ++ G+ C HL  H  C + PC    SC+                          R  +   F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG +C+ N N+C+ NPC+NGG C D +N + C C  G+ G  C    Y +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C         G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A CI E + Y
Sbjct:  208 DQNGNKTCL--EGWMGPECNKAICRQGCSSKHG-------TCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDINDCLGQ------------------------CQNGGTCRDL-VNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFN----LATDYFCNCSEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYC---HENINDC-ESNPCKNGGTCID-GVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRKYSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCN-IARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGY 800          

HSP 4 Score: 91.2781 bits (225), Expect = 2.200e-20
Identity = 86/269 (31.97%), Postives = 108/269 (40.15%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI---DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG-VCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQ 1609
            N W G+ C        +   C NGG C     E   +KCICP+G+EG  C I     C PNPC   GTC+     F C C E W G  C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C C PG +G  C     E    PC  NG +  D    D  CN      GK     + C  Q C   G   E   G TC            I    C   PC     C+  NQ
Sbjct:  652 NGWKGKTCHSRKYSQCDEATCNNGGTC---YDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCIDE---INGYRCTCPPGRSGPRCQ----EVTGRPCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRCDIHGS-SECPAGQTC----------VPIRDNHCFVPPCTGVGECWPTNQ 898          

HSP 5 Score: 30.0314 bits (66), Expect = 2.200e-20
Identity = 26/83 (31.33%), Postives = 38/83 (45.78%), Query Frame = 3
Query:  585 GGHYKCDINGEKVCDYGWMGS-------DCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCD----ECMKYPGCKHGTCVD 800
            GG + C+      C+ G+ G+       DC +  C+ G   I G   N  +C C  GW+G +C+    +C K P    GTC D
Sbjct:  567 GGKFTCE------CNKGFTGTYCHENINDCESNPCKNGGTCIDGV--NSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRD 641          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 429.098 bits (1102), Expect = 6.746e-162
Identity = 301/877 (34.32%), Postives = 434/877 (49.49%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQL-NYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSR-PFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANS 3421
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC   G+C+++   F CQC   WTG  C  +   C  N C  GG C +D     +CIC   + G  C + A  CE   C +A  C+     +G Y C C PG+TG+ CD  IN+C+   C+N G C D +N ++C C   + G+ CE ++  C + PC NGG CQ+   G+ C C  G++G  C++    C P+PC NGA C+ +  D++C+C++++ GK C H + +C    CE   D+C++    NS+      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C K+PC N G C     +L NDF CECKN W G+ CH  + S CD   C NGG+C      + F+C C  GW G  C   +I        N C N G C+  G + FTC CK G+EG  C  N NEC  +PC  G  CID++N YRC C  G  G  CQ  N  +C S P  Y    +         CP      L        +     C+    +   G  W  +C +C C  GKVTC  V CG   C   +G+ +   C  G+ C   P     CFVPPC     C      +P NQ   P    K C  N+      CA I  TFNK+ +  G+T + IC+ ++ L  +++++      S+ I+C+++ + +  ++VA       I ++E  + R P       +I   L+     NNTF   + ++ +      + +     L+  +L   +A+   ++   YW  RK+  +    +  S
Sbjct:  287 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTC-QDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCR---NLIGSYYCNCLPGWTGQNCDININDCL-GQCQNGGTCRDLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQCFNLATDYFCNCSEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCR----DLVNDFYCECKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDTFKCICPAGWEGATC---NIARNSSCLPNPCFNGGTCVVRG-DSFTCVCKEGWEGPTCSQNINECQSSPCAFGATCIDEINGYRCTCPPGRSGPRCQEGNEKQCVSPPLCYQITSL---------CPALVMMVLPYTNTTICAVTGRPCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQRC-DIHGSSE---CPAGQTC--VPIRDNHCFVPPCTGVGEC------WPTNQ---PPVKTK-CNANASYQDASCANITFTFNKEMMSPGLTTESICNELRNLNILKNVSAE---YSIYITCELSPSANNEIHVA-------ISVEENGDGRNPVKDITERII--DLVSKRDANNTFIASVAEVRVQRRQAKNGTDFLVPLLSSILT--VAWVCCLVTAFYWCIRKRRKQSSHSHTAS 1105          

HSP 2 Score: 164.851 bits (416), Expect = 6.746e-162
Identity = 91/281 (32.38%), Postives = 143/281 (50.89%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSS--MKFNKESTHS-YKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
              +I   L +      +  QF L+I      + +   G CC    +     C+   C   F +CL+ Y + VS        G C++G   T + G +S  +K+++ +  +        +WP S TL++EA+D +        +ID+ ++   + PS     W  +  +   + +++ + +IC   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PGECRC+ GWQG +CD+C+ +PGC HGTC + PW C CE
Sbjct:   15 FRLIIALLCLRLKVSIASGQFELEILSMQNPNGELQSGNCCDGQRNPTDRKCSRDECDTYFKVCLKEYQSRVSAG------GACSFGTGYTPVIGGNSFNLKYSRNNERNRIVLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPS---RQWQTLKQNAGMTHFEYQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSSKHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTC-NEPWQCLCE 285          

HSP 3 Score: 251.521 bits (641), Expect = 1.414e-67
Identity = 203/635 (31.97%), Postives = 288/635 (45.35%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKY-------------------------------CDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            D+NGN+ C+  +G+ G EC+ A   +    KH        T     +C CQ G+ G+Y                               CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC NGG C E   G+ C+C  G+TG  C I    CSPNPC  G  C  +   F C C  ++ GK C+     C  + C +A ++C             N  G Y            C C+PG+ G +C+I+I+DC    C+NGG C D +N F CIC  G+ G+ CE+  + C+ +PC+N G C    DE+ N F C C   + G LC L     C+ +PC NG  C  L+T   + C+C++ + G  C  L  H    PC                        N+C   G C +     FTC C  GF G +C  N N+C  NPC NGG CID +NSY+CIC+ G+ G  C+ N ++C+  PC  G  C D ++DF C C  G  GK C H ++++  +  +C      +D G+T+   C    +   C+  +  +C   PC         G      CK G    +   N   C   PC   A CI E + Y
Sbjct:  213 DQNGNKTCL--EGWMGPECNKAICRQGCSSKHG-------TCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNA-NSC------------RNLIGSY-----------YCNCLPGWTGQNCDININDC-LGQCQNGGTCRDLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHC---QDEI-NGFQCLCPAGFSGNLCQL-DIDYCEPDPCQNGAQCFNLAT--DYFCNCSEDYEGKNCSHLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTC-HSRDSQCDE-ATCNNGGTCYDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCSQNINECQSSPCAFGATCIDEINGY 804          
BLAST of Delta-like protein vs. Ensembl Xenopus
Match: plpp7 (phospholipid phosphatase 7 (inactive) [Source:Xenbase;Acc:XB-GENE-977766])

HSP 1 Score: 425.631 bits (1093), Expect = 4.931e-161
Identity = 294/894 (32.89%), Postives = 422/894 (47.20%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTG---CSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDG-KLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYID------------ELKNSRPFAHYLSGVIAKGLIDVIKN---NNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANS 3421
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC   G+C+++   F CQC   WTG  C  +   C  N C  GG C +D     +CIC   + G  C + A  CE   C +A  C+     +G Y C C PG+TG+ CD  IN+C+   C+N G C D +N ++C C   + G+ CE ++  C + PC NGG CQ+   G+ C C  G++G  C++       C P+PC NGA C+ +  D++C+C++++ GK C H + +C    CE   D+C++    NS+      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C K+PC N G C     +L NDF CECKN W G+ CH  + S CD   C NGG+C      + F+C C  GW G  C   +I        N C N G C+  G + FTC CK G+EG  C  +         +N G C+D  N YRC CA GF G +C++N +EC S PCA+GA C+D I+ + C CP GR G  LC  +                                C  GKVTC  V        + +    P+ C  G+ C   P     CFVPPC     C      +P NQ   P    K C  N+      CA I  TFNK+ +                                +S  I  N+  +++V + +  E   ++            +  + +P  H     I + +ID++     NNTF   + ++ + ++ + S S     +     +  +A+   ++   YW  RK+  +    +  S
Sbjct:  287 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTC-QDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCR---NLIGSYYCNCLPGWTGQNCDININDCL-GQCQNGGTCRDLVNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQVSPLDIDYCEPDPCQNGAQCFNLATDYFCNCSEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCR----DLVNDFYCECKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDTFKCICPAGWEGATC---NIARNSSCLPNPCFNGGTCVVRG-DSFTCVCKEGWEGPTCSQSN--------YNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCTCPPGRSGPSLCPAL--------------------------------CLNGKVTCSKV-------RECSLMYLPFECPAGQTC--VPIRDNHCFVPPCTGVGEC------WPTNQ---PPVKTK-CNANASYQDASCANITFTFNKEMMSP------------------------------VSQTIKSNDLNVLSVIVVAKAERHQLEGKTPACSSQQLLDPFSMKPHIHEQFKDITERIIDLVSKRDANNTFIASVAEVRVQSINIFSRSLVDFLVPLLSSILTVAWVCCLVTAFYWCIRKRRKQSSHSHTAS 1072          

HSP 2 Score: 165.236 bits (417), Expect = 4.931e-161
Identity = 91/281 (32.38%), Postives = 143/281 (50.89%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSS--MKFNKESTHS-YKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
              +I   L +      +  QF L+I      + +   G CC    +     C+   C   F +CL+ Y + VS        G C++G   T + G +S  +K+++ +  +        +WP S TL++EA+D +        +ID+ ++   + PS     W  +  +   + +++ + +IC   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PGECRC+ GWQG +CD+C+ +PGC HGTC + PW C CE
Sbjct:   15 FRLIIALLCLRLKVSIASGQFELEILSMQNPNGELQSGNCCDGQRNPTDRKCSRDECDTYFKVCLKEYQSRVSAG------GACSFGTGYTPVIGGNSFNLKYSRNNERNRIVLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPS---RQWQTLKQNAGMTHFEYQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSSKHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTC-NEPWQCLCE 285          

HSP 3 Score: 258.455 bits (659), Expect = 6.197e-70
Identity = 215/654 (32.87%), Postives = 290/654 (44.34%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHN----YCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEER---TDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCS--------------------------RLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRG--KVTCESVPCGVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E W G  C++  +IC Q      G C         C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC NGG C E   G+ C+C  G+TG  C I    CSPNPC  G  C  +   F C C  ++ GK C+       ++P     SC     S Y  C       +  I  N     C   GTC       F C C PG+ G+ CE D+++C +NPC NGG C D IN F+C+C  GF G  C+      DYC   PC N   C      L  D+ C C  ++ G+ C HL  H  C + PC    SC+                          R  +   F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG +C+ N N+C+ NPC+NGG C D +N + C C  G+ G  C     +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C         G++++     C C  G    TC        TC+     D+ Y C+  PG        N   C   PC   A CI E + Y
Sbjct:  220 CLEGWMGPECNK--AICRQGCSSKHGTCKTPG----ECRCQYGWQGQYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFECQCARGWTGPTCSINIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDANECEAKPCVNANSCRNLIGSYYCNCLPGWTGQNCDININDCLGQCQNGGTCRDL-VNGFRCICPPGYAGERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQVSPLDIDYCEPDPCQNGAQCFN----LATDYFCNCSEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCRSQSGGKFTCECNKGFTGTYC---HENINDCE-SNPCKNGGTCID-GVNSYKCICSDGWEGIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCN-IARNSSCLPNPCFNGGTCVVRGDSFT-----CVCKEGWEGPTCSQSNYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGY 837          

HSP 4 Score: 85.8853 bits (211), Expect = 3.813e-16
Identity = 67/205 (32.68%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCD-QDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGD--YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKG 1420
            + W G +C+ ++N C++ NPC NGG C +L+++   + C C +G++G+ C      C    C   GTC      F C C   W G  C+    S C  N C NGG C      +  C+C++G++G  C  +    N      +D        GD  Y+C C PG+ G  C   INEC  +PC     C D IN Y+C C     G
Sbjct:  660 DGWEGIYCETNINDCSK-NPCYNGGTCRDLVND---FYCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTC-VVRGDSFTCVCKEGWEGPTCSQS----NYNSGTCVD--------GDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCTCPPGRSG 847          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag1 (jagged 1 [Source:MGI Symbol;Acc:MGI:1095416])

HSP 1 Score: 467.618 bits (1202), Expect = 3.553e-173
Identity = 306/864 (35.42%), Postives = 444/864 (51.39%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC  + PC N G C N   +   Y+C CP G+ G +CEI    C  +PC  +G+C ++   F C+C   WTG  C  +   C  N+C +GG C    NG  +C+C   + G  C L A  CE   C +A  C+     +  Y C C PG+ G+ CD  IN+C+   C+N+  C D +N Y+C C   + G +CE +I  C + PC NGG CQ     + C C TG++G  C++    C PNPC NGA CY    D++C C +++ GK C H + +C   +CE   D+C++    N +      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C ++PC   G C     +L NDF C+CKN W G+ CH  + S CD   C NGG+C     ++ F+C C  GW GT C   +I        N C N G C+ V  + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ ++C CP G  G  C  V         SC+   R+   G  W  +C  C C  G+V C  V CG   C      ++   C  G+ C   P    +CFV PC     C +  S+ P             C  +S    N CA I  TFNK+ +  G+T + IC  ++ L  +++++      S+ I+C+ + + +  ++VAI +  E+I  D      P       +I   L+     N++    + ++ +    L + +     L+  +L   +A+   ++   YW  RK+
Sbjct:  287 NWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPD--KYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNG-FKCVCPPQWTGKTCQLDANECEAKPCVNARSCK---NLIASYYCDCLPGWMGQNCDININDCL-GQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTTCE-VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCR----DLVNDFYCDCKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEVDTFKCMCPGGWEGTTC---NIARNSSCLPNPCHNGGTCV-VNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQCICPPGHSGAKCHEVSGR------SCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKSHNE---CPSGQSC--IPVLDDQCFVRPCTGVGEC-RSSSLQP---------VKTKCTSDSYYQDN-CANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAE---YSIYIACEPSLSANNEIHVAISA--EDIRDD----GNPVKEITDKII--DLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLT--VAWVCCLVTAFYWCVRKR 1096          

HSP 2 Score: 163.31 bits (412), Expect = 3.553e-173
Identity = 87/266 (32.71%), Postives = 136/266 (51.13%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKS---SWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L+I      + +  +G CCG   +     CT   C   F +CL+ Y + V+   P      C++G   T + G ++        +     +     +WP S TL++EA+D+S       ++I++  +   + PS     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GWMG DCN  IC+ GC   HG C+ PG+CRC+ GWQG +CD+C+ +PGC HGTC + PW C CE 
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGP------CSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSR---QWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTC-NEPWQCLCET 286          

HSP 3 Score: 257.299 bits (656), Expect = 1.667e-69
Identity = 221/689 (32.08%), Postives = 311/689 (45.14%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEK-----EKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKH---SICD----------------------SNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNK 2962
            C+E W G  C++  +IC Q      G C    +    C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC N G C+E  +G+ C+C  G+TG  C      CSPN C +G  C  +   F C C  ++ GK C+       ++P     SC+    S Y  C    M  +  I  N C   G C +          + C C PG+ GD CE DID+C +NPC NGG C + IN F+C+C  GF G  C+   DYC  +PC N   C   +    +D+ C+C  ++ G+ C HL  H   + C+                      SN C   G C   S    F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG HC+ N N+C+ NPC  GG C D +N + C C  G+ G  C     +C    C  G  C D +D F+C CP G +G  C+ +  N S  P  C        +G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A C+ E + Y    I  PG S   C   S ++     ++IL   K
Sbjct:  220 CMEGWMGPDCNK--AICRQGCSPKHGSCKLPGD----CRCQYGWQGLYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSCKNLIASYYCDCLPGWMGQNCDININDC--LGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA----SDYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSG-GKFTCDCNKGFTGTYC---HENINDC-ESNPCKNGGTCID-GVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCN-IARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGY--QCICPPGHSGAKCHEVSGRSCITMGRVILDGAK 875          

HSP 4 Score: 89.3521 bits (220), Expect = 2.436e-17
Identity = 76/270 (28.15%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG--VCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTC 1507
            + W G  C+ ++N C++ NPC  GG C +L++                                   EV  +KC+CP G+EG  C I     C PNPC   GTC+ +   F C C E W G +C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C+C PG++G  C    +E     C   G  +   +  D  CN      G+     + C  +PC+      E  +G +C
Sbjct:  657 DGWEGAHCENNINDCSQ-NPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCVDE---INGYQCICPPGHSGAKC----HEVSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKSHNECPSGQSC 917          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Jag2 (jagged 2 [Source:MGI Symbol;Acc:MGI:1098270])

HSP 1 Score: 469.159 bits (1206), Expect = 5.270e-172
Identity = 312/864 (36.11%), Postives = 432/864 (50.00%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIK-HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYA-CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPII--AFGVL----VLIGAYW 3373
             NWGG  CD+ LNYC  ++PC NGG C N  +E   Y C CP G+ G++CE     C  NPC  G +C +    F C C   W G  C  D   C  N C  GG C  D+     CIC + + G+ C L A  CE   C +A  C+     +G Y C C PG+ G  C   IN+C    C++ G C D +N Y+C C   F G++CEL    C + PC+ GG+C+++  G+ C C  G +G +CE+    C P+PCLNGA CY +  D+YC C ++F GK C   R  C   +C    D C       + G+     CG +G C+S     F C C  GF G  C  +IDDC   PC+NGG CID +++F C C +G+ G+ C+   + C+  PC + G C     +L NDF C C + W G+ CH  +   CD+  C NGG+C    + + F+C C  GW G+ C    I        N C N G C+  G + F+C C+ G+EG+ C  NTN+CNP PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ + C CP GR G  C  V     P    C      F  G +W  +C +C C  G   C  V CG   CL +    DP A C PG+ C        +C  PPC     C  E  + P+            CQP S    N CA++ L FN+  VP G T+  IC GI+ L   +        R L + CD   + ++ V VA+ +SP  ++    L  S   AH +   I +      + N++    + ++ + T+++   S         LLVP++   F VL    V+I  +W
Sbjct:  297 TNWGGLLCDKDLNYCGSHHPCVNGGTCIN--AEPDQYLCACPDGYLGKNCERAEHACASNPCANGGSCHEVPSGFECHCPSGWNGPTCALDIDECASNPCAAGGTC-VDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCK---NLIGGYYCDCLPGWKGINCQININDCH-GQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACR-VIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSGWEGELCDINPNDCLPDPCHSRGRCY----DLVNDFYCACDDGWKGKTCH-SREFQCDAYTCSNGGTC--YDSGDTFRCACPPGWKGSTCT---IAKNSSCVPNPCVNGGTCVGSG-DSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQEVVIFTRP----CWSRGMSFPHGSSWMEDCNSCRCLDGHRDCSKVWCGWKPCLLSGQPSDPSAQCPPGQQCQEKAVG--QCLQPPCENWGECTAEEPLPPSTP----------CQPRSSHLDNNCARLTLRFNRDQVPQGTTVGAICSGIRALPATR---AAAHDRLLLLLCDRASSGASAVEVAVSFSPARDLPDSSLIQST--AHAIVAAITQ------RGNSSLLLAVTEVKVETVVMGGSSTG-------LLVPVLCSVFSVLWLACVVICVWW 1107          

HSP 2 Score: 157.532 bits (397), Expect = 5.270e-172
Identity = 93/277 (33.57%), Postives = 135/277 (48.74%), Query Frame = 3
Query:   63 FSLKITKYIKYSFQRLDGKCC-GDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-----------------NKESTHSYKFTIKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            F L+++     + + L G CC GD  +     C    C     +CL+ Y A V+P      TG C+YG   T + G +S                      +         + +WP S TLI+EA+D  ++T P  + +I+RV +   + P      W  +  S   +  +  + + C  +YY   C+++C+      GHY CD  G K C  GWMG +C   +C+ GC+ +HG C  PGECRC  GWQG FCDEC+ YPGC HG+CV+ PW C CE
Sbjct:   30 FELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTP------TGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPE---DRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSCVE-PWHCDCE 296          

HSP 3 Score: 118.627 bits (296), Expect = 2.907e-26
Identity = 128/459 (27.89%), Postives = 176/459 (38.34%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC---------HLP------------------------------KHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCIN-------------VG---------------YNDFTCH---------CKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFD-SGETW-----SYNCQNCACDRGKV---TCESVP-CGVWTCLQANGTDDPYACKPGEMCYSFPF------------------NPKRCFVPPCVPKARCIKEYSIY----PNNQISWPGE----SHKDCQPNSIKNHNYCAKIILTF 2956
            EC C  G+ GK C+E    C+  P   +G C+         + C+C+ NWGG LC         H P                                  C SNPC NGGSC  + +  GF+CHC  GW G  C    +D   C   N C   G C++             VG                N F+C          C PG++G +C IN N+C+   C +GG C D +N Y+C+C +GF G +C+L YD+CAS PC  G IC D +D F C CP G  G  C+   +   P P  C+   R ++  G+ +      +  +NC+  R       C  +  CG     +A G      C P   C S P                   N   C   PC     CI E   +    P+    W GE    +  DC P+   +   C  ++  F
Sbjct:  261 ECRCSYGWQGKFCDE----CVPYPGCVHGSCVE-------PWHCDCETNWGGLLCDKDLNYCGSHHPCVNGGTCINAEPDQYLCACPDGYLGKNCERAEHACASNPCANGGSCHEVPS--GFECHCPSGWNGPTCA---LDIDEC-ASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGINCQININDCH-GQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSP--CLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSG---WEGELCDINPNDCLPDPCHSRGRCYDLVNDF 696          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Notch1 (notch 1 [Source:MGI Symbol;Acc:MGI:97363])

HSP 1 Score: 340.502 bits (872), Expect = 1.345e-95
Identity = 220/606 (36.30%), Postives = 308/606 (50.83%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC-EIDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS--CQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQP--CKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE----------------HSRPYCGNE--SCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ--FLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   L+     NPC+NGG C+  L  +  YKC CP G+ G+ C + DPC  NPC   G C+  +  + C+C   + G  C QD + C QN   C++GG C  +E G+ RC C+  + G  C L   PC  S C++   C  + T    ++C C PG+ G+ C++ +++C  N CKN G C D +N Y C C   + G+ C  ++  CQ  P  C+NGG C     GY C C  G+TG +C      C+   C  GA C+     FYC C     G  C                  + P  G    +C S Y   +  Q ++   +  N C   G CL +    F C+C+ G+ G  CEID+++C +NPC+N   C+D I  F+CIC  G+ G  CE  TD C  SPC++ G C+    +  N+F C+C   + G LC       C S PC NG  C  L   N + C C +G+ GT C+      D  PC   + CK+       G   FTC C+PG+ G HC+ N NEC+  PC +GG C D+ NSY C+C KG  G NC++N D+CAS PC  G  C+D+ID +EC C  G  G +C+
Sbjct:   93 FSGPLCLTPLDNACLANPCRNGGTCD--LLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTC-HNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTC--RPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCL-NTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCM----DKINEFQCQCPKGFNGHLCQYDVDE-CASTPCKNGAKC--LDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGS-CKD-------GVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSG-TCLDKIDGYECACEPGYTGSMCN 676          

HSP 2 Score: 310.842 bits (795), Expect = 5.384e-86
Identity = 200/590 (33.90%), Postives = 286/590 (48.47%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIN--DYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKN------LCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C+ +++ CA  +PC NGG CE+ ++    + C CP G+    C  E++ C  NPC  G C      + C C   W+G  CD + + C+ N C NGG C KD      C C++G+ G  C      C ++ C +   C I   A   YKC C   YTG  C+  +  C  +PCKN+GVC +S +   + C C T ++G+ CE++I  C   PC++G  CQ  +  Y C C+ GYTG NCE     C PNPC NG  C       +C C   F G  CE     C +  C++                        G   +   + + C C  GF G  CE +  DC  + C NGG C+D IN+F C+C  GF G  C+   + C   PC++ G C     + Y  + C C   + G  C       CDS PC NGG C + +T   + C C  GW G  C  L +  +   +K       LC++ G+C++ G   + CHC+ G+ G +C+   +EC+PNPC NG  C D L  + C C  G++GSNC    +EC S PC  G  C+D  + ++C CP G  G  C+
Sbjct:  670 YTGSMCNVNIDECA-GSPCHNGGTCEDGIAG---FTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTC-KDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTC-IDDVA--GYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQN------------------------GANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTC----QDSYGTYKCTCPQGYTGLNCQNLVR-WCDSAPCKNGGRCWQTNTQ--YHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHY-CHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCE 1219          

HSP 3 Score: 310.842 bits (795), Expect = 6.671e-86
Identity = 232/713 (32.54%), Postives = 320/713 (44.88%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESC--------ESAYDACSMPQM------LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPC--------------------------------------FNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ-NCACDRG--KVTCESVPCGVWTCLQANGTDDPYACKPGEMC 2773
            + G  C+  +N C  +NPC+N   C   L ++  ++CIC  G+EG  CEI  D C  +PC   G CM    EF CQC + + G LC  D   C    C+NG +C    N    C+C +GY G+ C +        PC    CK  +           + CLCQPGYTG +C+  INEC   PC++ G C D  N Y C C     G NCE+N+  C + PC +G    ++D GY C C+ GYTG+ C +    C+ +PC NG  C      F C C + +    C      C +  C         + Y     P        +N++  + N C   GTC       ++C C  GF G +C+ +I++C +NPC N G CID +  ++C C   + G TCE     C  SPC N GVC    D  Y  F C C   W G+ C +  +  C  +PC +G SC   +T   ++C C  G+ G  C+    D   CR  N C N G C + G N   C C PGF+G  C+ + NEC  NPC                                      FNGG C+D +NS+ C+C  GF GS CQ + +EC S PC +G  C D    ++C CP+G  G  C ++       P          + G  W  N Q +C C  G   V C+ +        Q  G D    C+ G +C
Sbjct:  444 YTGPRCEIDVNECI-SNPCQNDATC---LDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPN-TYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGV---------ATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID-GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTC-KDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESED--YESFSCVCPTGWQGQTCEVDINE-CVKSPCRHGASCQ--NTNGSYRCLCQAGYTGRNCES---DIDDCR-PNPCHNGGSCTD-GINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAP--------CKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLC 1122          

HSP 4 Score: 298.13 bits (762), Expect = 7.901e-82
Identity = 201/590 (34.07%), Postives = 292/590 (49.49%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI-DPCFPNPCKKGTCMKS---KGEFYCQCIERWTGKLCDQDTSIC--DQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID--DFECRCPEGRDGKLCD 2563
            N W G+ C ++++ CA +  C  G  C +    V  + C CP G  G  C + D C  NPC +G+   +    G+  C C   +TG  C QD   C    N C++ G+C  +  G+  C C QGY G  C +    C ++ C++   C  Q   +G+++C+C PGY G YC+   +EC  +PC +NG C D IN+++C C   F G  C+ ++  C + PCKNG  C +    YTC C  GYTGT+CE+    C P+PC  G+ C      F C C   + G  CE +   C ++ C                          GTC   +   ++C C+ G  G +CEI++DDC +NPC + G C+D I+ +EC C+ G+ G  C    D C  SPC N G C    ++    F C C   +    C L + + C+SNPC++G        LNG++C C  GW GT C    I+   C   N C N G C ++  + + C C+ GF G +C  N NEC  NPC N G CID +  Y+C C   + G+ C++    CA+ PC    +C +  D   F C CP G  G+ C+
Sbjct:  325 NGWTGEDCSENIDDCA-SAACFQGATCHD---RVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGANPCEHAGKC-LNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQ---IGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGS-CKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHG-----------------------GTCQDRDN-SYLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTC----EDGIAGFTCRCPEGYHDPTC-LSEVNECNSNPCIHGAC---RDGLNGYKCDCAPGWSGTNCD---INNNEC-ESNPCVNGGTCKDM-TSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKNSGVCKESEDYESFSCVCPTGWQGQTCE 867          

HSP 5 Score: 297.745 bits (761), Expect = 8.869e-82
Identity = 200/604 (33.11%), Postives = 292/604 (48.34%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPC--FPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECV--PNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLN---SSGIKHNYCG-----------KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHV 2569
            + GQ C+++++ C  NN CKNGG C   +  V  Y C CP  + G+ C  ++D C   PN C+ G TC  + G + C C+  WTG+ C ++   C   +C  G  C  D   +  C C  G  G  CHL   C ++ C    +C       G   C C  GYTG  C ++++EC    NPC++ G C +++  ++C C   + G  CE+++  C + PC+N   C +    + C C  GY G  CEI    C+ +PCL+  +C     +F C C K F G  C++    C +  C++       P       + G    +C             YG+C       F C C PG+ G  CE +I++C + PC++GG C D  N++ C+C  G  G  CE   D C  +PC + G CL   D     + C C+  + G +C++     C  +PC NGG+C     + GF C C +G+    C  +    +  PC         G C + G N + C C PG+ G +CDIN NEC  NPC NGG C D  + Y C C +GF G NCQ N +ECAS PC     C+D +  ++C CP    G  C+ V
Sbjct:  249 FAGQNCEENVDDCPGNN-CKNGGAC---VDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATC-HDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVN-GKAICTCPSGYTGPACSQDVDECALGANPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSC-KDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPC-DSGTCLDKID----GYECACEPGYTGSMCNV-NIDECAGSPCHNGGTCE--DGIAGFTCRCPEGYHDPTCLSEVNECNSNPCIH-------GACRD-GLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVV 829          

HSP 6 Score: 273.478 bits (698), Expect = 1.012e-76
Identity = 193/618 (31.23%), Postives = 279/618 (45.15%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-------HLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGV--CINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYR---CICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSG 2632
            + G  C+  L  CA  +PCKN G+C+    + + + C+CP+G++G+ CE+D   C  +PC+ G +C  + G + C C   +TG+ C+ D   C  N C NGG C  D      C C  G++G+ C      C ++ C++  +C   +  +  Y C C  G+ G +C+    +C  + C N G C D IN + C C   F G  C+ ++  C ++PC +GG CQ+    Y C C  GYTG NC+     C   PC NG  C+  N  ++C C   + G  C+       + SCE A             GI      ++G     E +K  C C  G+ G  CE ++D+C  NPC+NG  C D +  F C C  G+ G  C E  + C+  PC N G C+    +L N + C C     G  C       H P      S  C N G+C  +  + G+ C C  G++G  C+    D   C   N C   G   C+    NDF C C+ G  G+ C+   N C   PC NGG C    N+ R   C C  GF G+ C+ +   C S  C  G  C+       C C     G  C      + P    CV  N  ++ G
Sbjct:  821 YTGATCEVVLAPCA-TSPCKNSGVCKES-EDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDDCRPNPCHNGGSC-TDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC---TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCD-----VLSVSCEVA---------AQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCI----DLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTC--VDQVGGYTCTCPPGFVGERCEG---DVNECL-SNPCDPRGTQNCVQR-VNDFHCECRAGHTGRRCESVINGCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPEC------QFPASSPCVGSNPCYNQG 1401          

HSP 7 Score: 35.8094 bits (81), Expect = 1.012e-76
Identity = 33/102 (32.35%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  573 CKNNGGHYKCDINGEKVCDYGWMGSDC--NNTICQPGCHRIHGYCENPGE---CRCRAGWQGTFC----DECMKYPGCKHGTCVD--SPWTCSCEI--TGAV 839
            C++    YKCD      C  GW G++C  NN  C+       G C++      C CR G+ G  C    +EC   P    GTC+D  + + C+C +  TGA 
Sbjct:  730 CRDGLNGYKCD------CAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGAT 825          

HSP 8 Score: 272.322 bits (695), Expect = 1.278e-73
Identity = 201/606 (33.17%), Postives = 274/606 (45.21%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNP----------CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC-------IKSP-CMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVG--YNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDE--CASFPCAYGAICVDRIDD--FECRCPEGRDGKLC 2560
            W GQ C+  +N C ++ PC++G  C+N       Y+C+C +G+ GR+CE  ID C PNPC  G +C       +C C+  + G  C++D + C  N CQNG  C  D   +  C C  G+ G  C    P C  S C +   C      +  + CLC PG+TG YC  ++NEC   PC + G C DS   YKC C   + G NC+ L   C + PCKNGG C + +T Y C+C++G+TG NC++    C              C +G  C       YCHC   + G  CE               D CS            N C    TC  +    F C+C+ G+ G +C  +I++C + PC+NGG CID  N+++C C  G  G  CE   D C        +SP C N G C+    +    + C C   + G  C    +  C SNPC   G+ + +  +N F C C  G  G  C+ +      CR K  CKN GVC         F C C  GFEG  C+ +   C    C NGG CI    S  C+C   F G  CQ         S PC     C    ++  + C CP   +G LC
Sbjct:  861 WQGQTCEVDINECVKS-PCRHGASCQNTNGS---YRCLCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC-TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTC---VDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCE------------DEVDECSP-----------NPCQNGATCTDYLG-GFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCV----DQVGGYTCTCPPGFVGERCEGDVNE-CLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESV---INGCRGKP-CKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLC 1425          

HSP 9 Score: 260.766 bits (665), Expect = 5.927e-70
Identity = 194/635 (30.55%), Postives = 278/635 (43.78%), Query Frame = 2
Query: 1109 SCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQI-QSTALGDYKCLCQPGYTGKYCDKEI-NECVPNPCKNNGVC-TDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNP--CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINN----------------------------------------FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRR-KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWS------YNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            +C NGG+C +  NG   C+C   + G  C  + PC ++ CK+A  C +       DY C C  G++G  C   + N C+ NPC+N G C   ++ +YKC C   + GK+C+    C + PC NGG C   ++ Y C+C  G+ G  C      CS NP  C +G  C+     + C C       R  H+ P+C     E  Y  CS            + C   GTC         C C+PGF G +CE ++DDC  N CKNGG C+D +N                                         + C+C NG+ G+ C E  D C  + C     C     +    F CEC +   G LCHL  +  C SNPC  G +C          C C  G+ G  C     D   C    N C++ G C+N     F C C  G+ G  C+I+ NEC  NPC N   C+D++  ++CIC  G+ G  C++N DECAS PC +   C+D+I++F+C+CP+G +G LC +  +  +  P  C    +  D   T++      Y   +C  D  +  C+  PC   +C     T     C+PG   +    N   C   PC     C    + Y
Sbjct:   30 TCLNGGRC-EVANGTEACVCSGAFVGQRCQDSNPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCAC-------RATHTGPHC-----ELPYVPCSP-----------SPCQNGGTCRPTGDTTHECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATC----HDRVASFYCECPHGRTGLLCHL--NDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACS---QDVDECALGANPCEHAGKCLNT-LGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTP--CKNGAKCLDGPNTYTCVCTEGYTGTHCEVDIDE--CDPDPCHYGSCKDGVATFT-CLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSY 625          

HSP 10 Score: 199.134 bits (505), Expect = 2.444e-56
Identity = 186/617 (30.15%), Postives = 260/617 (42.14%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKHALDCQI--QSTAL----GD-YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSP--NP------CLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCE-------------------SAYDACSMPQMLNSSGIKHNYCGKYGTCL--SHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCE-ERTDYCIKS-PCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPN--------PCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFEC 2527
            + G  C+ +   C E++ C NGG C   +  +  + C+CP GF G  C+ D   C   PC   GTC  S G + C C + +TG  C      CD   C+NGG+C +  N    C C+ G+ G  C  L+  CE +  K  +D  +  Q   L    GD + C CQ GYTG YC+ E++EC PNPC+N   CTD +  + C C   + G NC   I  C +QPC+NGG C ++   Y C C  G  G +CEI    C P  +P      C N   C      + C C   F G+RCE     C +  C+                   + +       ++N  G +   C   G C   S+    FICRC  GFEG +CE D   C +  C NGG CI    +  C+C   F G  C+   +  C+ S PC N G C   S+  +  + C C   + G LCH+  +S         GG+   +              I   C+          +        VC N+  N+  C    G++G  C +N N+   N          F+ G C  + NS  C+    F G +CQL   +C      Y   C D   D  C
Sbjct:  975 FNGIHCENNTPDCTESS-CFNGGTC---VDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQ-TNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFVGERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVIN--GCRGKPCKNGGVCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQGTCEPTSENPF--YRCLCPAKFNGLLCHILDYS-------FTGGAGRDIPPPQ----------IEEACELPECQVDAGNK--------VC-NLQCNNHAC----GWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCL----FDGFDCQLTEGQCNPL---YDQYCKDHFSDGHC 1545          

HSP 11 Score: 41.9726 bits (97), Expect = 2.444e-56
Identity = 48/169 (28.40%), Postives = 67/169 (39.64%), Query Frame = 3
Query:  402 PYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCD--------------RYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTI--CQPGCHRIHGYCE---NPGECRCRAGWQGTFCD----ECMKYPGCKHGT----CVDSPWTCSCEI 827
            PY  A  + V     L P   S   N  V         FS   +C   + G+ C+                C+N  G Y+C      +C  G+ G +C + I  C+P      G C    N   C C  G+QG FC+    EC   P C++G     CVDS +TC+C +
Sbjct:  820 PYTGATCEVV-----LAPCATSPCKNSGVCKESEDYESFS--CVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRC------LCQAGYTGRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNP-CQNGANCTDCVDS-YTCTCPV 973          

HSP 12 Score: 82.0333 bits (201), Expect = 5.086e-15
Identity = 94/292 (32.19%), Postives = 112/292 (38.36%), Query Frame = 2
Query: 2108 SNPCLNGGSCSRLSTLNGFQ-CHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINV---GYNDFTCHCKPGFEGKHCDINT-NECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCES--VPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFN 2959
            S  CLNGG C      NG + C C+  ++G  CQ    D  PC     CKN G C  V   G  D+ C C  GF G  C     N C  NPC NGG C +  L  Y+C C  G+ G +CQ   D CAS PCA G  C+     + CRCP G  G  C    N  S  P  C +     +  E  SY C  C        CE   VPC             P  C+ G  C         C   P      C                E+  DC  N+ KN   C   + T+N
Sbjct:   28 SGTCLNGGRCE---VANGTEACVCSGAFVGQRCQ----DSNPCL-STPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQ-QADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHN--EIGSYRCA-CRATHTGPHCELPYVPC------------SPSPCQNGGTCRPTGDTTHECACLPGFAGQNCE---------------ENVDDCPGNNCKNGGACVDGVNTYN 280          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Notch2 (notch 2 [Source:MGI Symbol;Acc:MGI:97364])

HSP 1 Score: 327.405 bits (838), Expect = 2.839e-91
Identity = 227/648 (35.03%), Postives = 307/648 (47.38%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTIN--QDFYCHCNKEFWGKRCEH------SRPYCGNESCESAYDA--CSMPQMLNSSGIKH-------NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCRRK------------------------------------------NLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C   ++ C  ++PC N G C +L   V  Y+C C  G  G +CEI  D C  NPC  G C+     + C C   +TG+ C+ D   C  N C+ G  C  D NG  RCIC +G     C+      L+ PC +  C         +  L  YKCLC  G+ G  C+ + NEC+ NPC+N G C + +N Y+C C   FKG NC++NI  C + PC N G C +  +GYTC C   YTG NC+     CSPNPC N A C      + F C C   + GKRC        S+P   N  C +   +  C  P   +    +        N C   G+C+ H    F C+C PGF GD C+ D+++C + PCKNGG C D +N++ C C  GF G  CE   D C +S C N G C+    +  N F C C   + G  C L   + C SNPCLN G+C  +  L  ++C C  G+ G  CQ L       PC+ K                                          +LC++ G+CIN G N   C C  G+ G +C+   +EC  NPC +G  C D +  YRC C  G+ G NC+   DEC + PC  G  C+D ++ F+C CP G  G LC+
Sbjct:  599 YMGAICSDQIDECY-SSPCLNDGRCIDL---VNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNG-FRCICPEGPHHPSCYSQVNECLSNPCIHGNC---------TGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDH-VNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCV----DGINSFSCLCPVGFTGPFC-LHDINECSSNPCLNAGTC--VDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAG-NTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCE 1223          

HSP 2 Score: 299.286 bits (765), Expect = 2.919e-82
Identity = 214/654 (32.72%), Postives = 300/654 (45.87%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH------LAAPCENS----------QC-----KHALDCQIQ--------------STALGDYKCLCQPGYTGKYCDKEINECVPNPCKN-------------------------------------NGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C+  +N C ++NPC N G C   + +V  ++C+CP GF G  C+ID   C   PC  G  C+     + CQC   +TG LCD++   CD + C +G QC +D   +  CIC  GY G+ C        ++PC N           QC        L+C+I                  +  Y C+C PG+TG+ C+ +I+EC  NPC+                                      +G CT  ++ YKC C   + G NCE++   C + PC+NGG C  +  GY C CK G+ G NC++    C+ NPCLN   C+     + CHC   + GK C+     C    CE+A      P                        E F C C PG++G  C +D+D+C + PC N G+C ++  ++ C C  GF G  CEE  + C+ +PC N G C+ H     N F C+C   + G  C    +  C S PC NGG+CS    +N + C C  G+ G  C+    +   C   + C N G C++ G N F+C C  GF G  C  + NEC+ NPC N G C+D L +YRCIC  G+ G NCQ   + C+  PC     CV       C CP G DG  CD
Sbjct:  486 FKGVHCELEVNEC-QSNPCVNNGQC---VDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHG-QC-QDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNF----------------------ESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDH----VNTFSCQCHPGFIGDKCQTDMNE-CLSEPCKNGGTCSDY--VNSYTCTCPAGFHGVHCEN---NIDECTESS-CFNGGTCVD-GINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCD 1099          

HSP 3 Score: 293.893 bits (751), Expect = 1.531e-80
Identity = 223/674 (33.09%), Postives = 308/674 (45.70%), Query Frame = 2
Query:  830 WGGQFCDQSLNYC-AENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDE-NGNRRCICQQGYKGS-------ECHLA--APCENS---------------------QCK------HALDCQIQSTAL---GDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCESAYDACSMPQMLNSSG----IKHNYCGK----YGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECI-------------------------------------CDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINV-GYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            W GQFC + ++ C  + N C+NGG C N       Y C+C +G+ G DC   ID C    C  G TC+     F C C E   G LC  D + C  N C  G  C  +  NG   C C QGYKG+       EC +A   PCE++                     +C+      H+  CQ  +T L   G + CLC PG+ G +C+ E+NEC  NPC NNG C D +N ++C C   F G  C+++I  C + PC NG  C +   GY C+C TG+TG  C+     C P+PC +G  C      + C CN  + G  C       +S P   +  C    +         +SG    I  + C      +G C+     ++ C C PGF G  C IDID+C +NPC+ G  CI+ +N F CI                                     CD G+ G  CE   + C+ +PC N G C    + L N + C CK  + G  C +     C SNPCLN G+C     ++G+ CHC   + G  CQ +     PC   N C+N  VC     +  F+C C PG++GK C ++ +EC   PC N G C +   SY C C  GF G +C+ + ++C + PC  G  CVD ++ F C+C  G  G  C
Sbjct:  290 WTGQFCTEDVDECLLQPNACQNGGTCTNRNGG---YGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDA-CISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHG-QCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCVD-GINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTC----NNLVNGYRCTCKKGFKGYNCQV-NIDECASNPCLNQGTC--FDDVSGYTCHCMLPYTGKNCQTV---LAPC-SPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKC 946          

HSP 4 Score: 293.893 bits (751), Expect = 1.615e-80
Identity = 237/749 (31.64%), Postives = 343/749 (45.79%), Query Frame = 2
Query:  830 WGGQFCDQSLNY-CAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE-IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICD-QNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQP--CKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE----------HSRPYCGNESCESAYDACSMPQMLNSSG----------IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ--FLHIDFQPCRR-------------------------------KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKV---------TCESVPC-GVWTCLQANGTDDPY--ACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            + G+ C  S ++ C  + PC+NGG C  L  +   Y+C C  GF G+ C+  D C  +PC+ G TC     +F C+C    TG+ C+ D + CD    CQ+GG C  +  G+ RC C QG+ G  C     PC  S C +   C  + T    ++C C PG+ G  C++ I++C  + C+N GVC D +N Y C C   + G+ C  ++  C  QP  C+NGG C   + GY C C  G++G +C      C+   C  G+ C      F C C +   G  C           H    C        Y  C+ PQ    +              N C   G C++ +   F C C+ G+ G  CE+DI++C ++PC+N   C+D I  F C+C  GF G  CE   + C  +PC+N G C+    +  N F C C   + G +C +     C S PCLNG  C  +   NG++C C  G+ G +C     + D  PC                                  + C N+G CI++  N + C+C+PG  G +C+IN ++C  NPC + G C+D +N Y C+C+ GF G  C ++ DECAS PC  GA C++ ++ F C CPEG     C + + NE    P C++ N       T   +   C CD G V          C S PC    TC   N   + Y   CK G   Y+   N   C   PC+ +  C  + S Y
Sbjct:   96 FTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDT--YECTCQVGFTGKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTC-LNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTC--RQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQY-ICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDG-AFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCV----DKVNRFQCLCPPGFTGPVCQIDIDD-CSSTPCLNGAKC--IDHPNGYECQCATGFTGILCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDL-VNGYQCNCQPGTSGLNCEINFDDCASNPCMH-GVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSC-YSQVNECLSNP-CIHGNC------TGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTC---NNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGY 817          

HSP 5 Score: 291.197 bits (744), Expect = 1.066e-79
Identity = 210/612 (34.31%), Postives = 286/612 (46.73%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESC--------ESAYD-ACSMPQM-----LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            + G  C+  +N C  ++PC+N   C   L ++  + C+C  GF+G  CE  ++ C  NPC   G C+     F C C   +TG +C  D   C    C NG +C    NG   C C  G+ G  C          PC + QC+  +D          Y C+C PGY G  C  +I+EC  +PC N+G C D +N Y+CNC     G NCE+N   C + PC +G VC +    Y+C C  G+TG  C I    C+ NPC  GA C      F C C +      C      C +  C         S Y   C    +     ++ +    N C   GTC ++    + C C  GF+G +C+++ID+C +NPC N G C D ++ + C C   + GK C+     C  +PC N  VC    +  +  F C C   W G+ C +     C S PC+N G C   +T   + C C  G+ G  C+    D   C   N C+N G C++   N F+C C PGF G  C  + NEC   PC NGG C D +NSY C C  GF+G +C+ N DEC    C  G  CVD I+ F C CP G  G  C H  N  S  P
Sbjct:  448 YAGPRCEMDINEC-HSDPCQNDATC---LDKIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNG-YECQCATGFTGILCDENIDNCDPDPCHHGQCQDGID---------SYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHG-VCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTC-NNLVNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPN--FESFSCLCAPGWQGKRCTVDVDE-CISKPCMNNGVCH--NTQGSYVCECPPGFSGMDCEE---DINDCL-ANPCQNGGSCVD-HVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNP 1033          

HSP 6 Score: 280.796 bits (717), Expect = 2.800e-76
Identity = 193/582 (33.16%), Postives = 283/582 (48.63%), Query Frame = 2
Query:  881 PCKNGGICENLLSEVQPYKCICPSGFEGRDCE-IDPCFPNPCKK-GTCMKSK--GEFYCQCIERWTGKLCDQDTS--ICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELN-IACQNQPCKNGGVCQEV-DTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC--HLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            PC N G C    +      C CP GF G  C+  DPC  N C+  GTC+     G+  C+C   +TG+ C   TS        CQNGG C         C CQ G+ G +C     C +  C++   C   ++    + C C  G TG+ C+ +INEC +P  C++ G C +    Y+C C   F G++C+   + C   PC NGG C++  D  + C C  G+ G+ CE     C  + C NG  C      + C C  ++ G+ C                D C +         + N C   GTC ++    + C C+ G+ GD C  +IDDC    C  G  CID + +F C+C  G  G  C    D CI +PC    +C   ++ L   +IC C   + G  C   + + ++ +SNPC + G C  ++T   F C C +G+ G  C+   +D   C   + C+N+  C++     FTC C PGF+G HC++  NEC  NPC N G+C+DK+N ++C+C  GF G  CQ++ D+C+S PC  GA C+D  + +EC+C  G  G LCD   +N  P P
Sbjct:   34 PCVNEGTCVTYHNGTG--FCRCPEGFLGEYCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFTGKQCQWTDACLSHPCENGSTC---TSVASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTED------------VDECLL---------QPNACQNGGTC-TNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASFSCLCPEGKAGLLC-HLDDACISNPCHKGALC--DTNPLNGQYICTCPQGYKGADCTEDVDECAMANSNPCEHAGKC--VNTDGAFHCECLKGYAGPRCE---MDINEC-HSDPCQNDATCLD-KIGGFTCLCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDP 578          

HSP 7 Score: 260.381 bits (664), Expect = 7.251e-70
Identity = 212/702 (30.20%), Postives = 295/702 (42.02%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNR-RCICQQGYKGSECH------LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCE-----------------------------IYKTG---------CSPNPCLNGAYCYTINQDFYCHCNKEFWGKRC--------------------EHSRPYC------GNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGV--CINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLN---SYRCICAKGFYGSNCQ-------------------------LNYDEC----ASFPCAYGAICVDRID--DFECRCPEGRDGKLCDHVKNNESPQPPSC 2602
            W G  C+   N C  +NPC+NGG C NL   V  Y+C C  GF+G +C+  ID C  NPC  +GTC      + C C+  +TGK C    + C  N C+N   C +  N     C+C  G++G  C       ++ PC N+   H           G Y C C PG++G  C+++IN+C+ NPC+N G C D +N + C C   F G  C+ ++  C ++PCKNGG C +    YTC C  G+ G +CE                             +  TG         CS NPCLN   C      + C C   + GK C                    E +RP+C          C+    +C    +     ++H  C   G C++       C+C  G+ G  CE  +D+C +NPC++G  C D I  + C C  G+ G  CE   D C   PC N G C+    +L N F C C     G LC            CLNGG C  +  + G+ C C  G+ G  C+    D   C   N C +EG   C+ +  N++ C C+  F G+HC+   + C   PC NGG C    N    + C C  GF G+ CQ                         LN  +C    AS PC +G  C  +     + CRCP    G  C+      S  P +C
Sbjct:  749 WVGVNCEVDKNECL-SNPCQNGGTCNNL---VNGYRCTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCH--------NTQGSYVCECPPGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEH-LCQHSGICINAGNTHH-CQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCI----DLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQC--VDRIGGYTCRCLPGFAGERCEG---DINECL-SNPCSSEGSLDCVQL-KNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATC 1425          

HSP 8 Score: 216.853 bits (551), Expect = 2.986e-56
Identity = 183/564 (32.45%), Postives = 246/564 (43.62%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCD--------KEINECVP--NPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGI--CIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCI-NVGYNDFTCHCKPGFEGKHCDINTNECNPNPCF-NGGKCIDKLNSYRCICAKGFYGSNCQLNYDECA 2470
            G  C   +N C  + PCKNGG C +    V  Y C CP+GF G  CE  ID C  + C   GTC+     F C C   +TG  C  D + C  N C N G C  D  G  RCIC  GY G  C  L   C  S CK+   C +Q  A     CLC PG+ G YCD          + + VP  + C+++G+C ++ N + C C   + G  CE  +  C + PC++G  C +   GY C+C  GY G NCE     C   PC NG  C  +   F C C     G  CE +   C              P  LN            G C+      + CRC+PGF G+ CE DI++C +NPC + G   C+   NN+ CIC + F G+ CE   D C + PC+N G C   S+ + + FIC C   + G  C     S C    C  G  C  + T +G +C C              D +     N C++ G C        ++C C P F G HC++ T   +  P       C DK      IC +      CQ +  +C+
Sbjct:  943 GDKCQTDMNECL-SEPCKNGGTCSDY---VNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTC-VDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTC-VQEKAR--PHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDECAGG-----------PHCLNG-----------GQCVD-RIGGYTCRCLPGFAGERCEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCAVASN-MPDGFICRCPPGFSGARC----QSSCGQVKCRRGEQC--IHTDSGPRCFC----------LNPKDCESGCASNPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDG--ICDEACNSHACQWDGGDCS 1456          
BLAST of Delta-like protein vs. Ensembl Mouse
Match: Dll1 (delta like canonical Notch ligand 1 [Source:MGI Symbol;Acc:MGI:104659])

HSP 1 Score: 172.555 bits (436), Expect = 1.493e-85
Identity = 102/278 (36.69%), Postives = 142/278 (51.08%), Query Frame = 3
Query:   45 VESKSQFSLKITKYIKYSFQRLDGKCC-GDHGSVIQHTCTVPCIQR--FSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKES------THSYKFTIKSSWPGSITLIIEAY------DTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            V S   F LK+ +++       +  CC G  G         PC  R  F +CL++Y ASVSP  P      C YG  +T + G  S      +      ++  +F    +WPG+ +LIIEA       D +  NP R  +I R+  +  L        W+  + S+ R+  ++S   +C   YYGE C  +C+      GH+ C   GEK+CD GW G  C + IC PGC   HGYC+ PGEC+CR GWQG +CDEC++YPGC HGTC   PW C+C+
Sbjct:   19 VWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGP--------PCACRTFFRVCLKHYQASVSPEPP------CTYGSAVTPVLGVDSFSLPDGAGIDPAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPER--LISRLTTQRHLT---VGEEWSQDLHSSGRTDLRYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGDRGEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGECKCRVGWQGRYCDECIRYPGCLHGTC-QQPWQCNCQ 276          

HSP 2 Score: 166.007 bits (419), Expect = 1.493e-85
Identity = 95/256 (37.11%), Postives = 134/256 (52.34%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGD-YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCL 1579
            WGG FC+Q LNYC  + PC+NG  C N  +    Y C C  G+ G +CE  +D C P+PCK G +C   +  F C C   + GK+C+     C    C NGG+C  + +G   C C  G+ G  C      C +S C +   C      LG+ Y C CQ G++G+YC+  +++C  +PC N G C DS+ND+ C C   + GKNC   ++ C++ PC NG  C +    Y C+C  GY G NC+       P P +
Sbjct:  279 WGGLFCNQDLNYCTHHKPCRNGATCTN--TGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKC----VDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMV 528          

HSP 3 Score: 152.91 bits (385), Expect = 1.673e-37
Identity = 111/348 (31.90%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  926 QPYKCICPSGFEGRDCEIDPCFPNP-CKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELN-IACQNQPCKNGGVCQE-VDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCE 1957
            +P +C C  G++GR C  D C   P C  GTC +    + C C E W G  C+QD + C  +  C+NG  C                                         +T  G Y C C+PGYTG  C+ E++EC P+PCKN   CTD  + + C C   F GK CEL+ + C + PC NGG C +  D GYTC C  G++G NCE     C  +PC NGA C  +   + C C   F G+ CE +   C +  C +                        GTC     + F C C PG+ G +C   +  C+  PC NG  C      + C C  G+ G  C+
Sbjct:  238 KPGECKCRVGWQGRYC--DECIRYPGCLHGTCQQP---WQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATC----------------------------------------TNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCTDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCVDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANG-----------------------GTCRDSVND-FSCTCPPGYTGKNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQ 516          

HSP 4 Score: 138.272 bits (347), Expect = 9.082e-33
Identity = 95/299 (31.77%), Postives = 140/299 (46.82%), Query Frame = 2
Query: 1757 CGKYGTCLSHE-KEKFICRCMPGFEGDSCEIDIDDCKTN-PCKNGGICIDS-INNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLC-----KNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDS 2629
            C +Y  CL    ++ + C C  G+ G  C  D++ C  + PC+NG  C ++   ++ C C  G+ G  CE   D C  SPC N   C     +L + F C C   + G++C L   + C   PC NGG CS  +   G+ CHC  G+ G  C+         ++ +LC      N   C+++G N + C C+ GF G++C+ N ++C  +PC NGG C D +N + C C  G+ G NC      C   PC  GA C  R   + C C +G  G  C  +     P P       R  +S
Sbjct:  256 CIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASCT----DLEDSFSCTCPPGFYGKVCELSAMT-CADGPCFNGGRCSD-NPDGGYTCHCPLGFSGFNCE---------KKMDLCGSSPCSNGAKCVDLG-NSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLPEPPPGPMVVDLSERHMES 538          

HSP 5 Score: 131.339 bits (329), Expect = 1.263e-30
Identity = 94/287 (32.75%), Postives = 137/287 (47.74%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCF---PNPCKKG-TCMKS-KGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRP 1669
            W G++CD+ + Y     P    G C+      QP++C C  G+ G  C  D  +     PC+ G TC  + +G + C C   +TG  C+ +   C  + C+NG  C  D   +  C C  G+ G  C L+A  C +  C +   C       G Y C C  G++G  C+K+++ C  +PC N   C D  N Y C C   F G+ CE N+  C + PC NGG C++    ++C C  GYTG NC    + C   PC NGA C+   Q + C C + + G  C+   P
Sbjct:  248 WQGRYCDECIRY-----PGCLHGTCQ------QPWQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSPCKNGASC-TDLEDSFSCTCPPGFYGKVCELSAMTCADGPCFNGGRCS--DNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCVDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNCSAPVSRCEHAPCHNGATCHQRGQRYMCECAQGYGGPNCQFLLP 520          

HSP 6 Score: 128.642 bits (322), Expect = 8.369e-30
Identity = 100/298 (33.56%), Postives = 137/298 (45.97%), Query Frame = 2
Query: 1676 GNESCESAYDA--CSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIK-SPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            G + C+  +    C+ P  L     +H YC K G C          +C  G++G  C    D+C   P    G C      ++C C  G+ G  C +  +YC    PC N   C   ++     + C C+  + G  C L +   C  +PC NG SC+ L   + F C C  G+ G VC+   +          C N G C +     +TCHC  GF G +C+   + C  +PC NG KC+D  NSY C C  GF G  C+ N D+CAS PCA G  C D ++DF C CP G  GK C
Sbjct:  207 GEKMCDPGWKGQYCTDPICLPGCDDQHGYCDKPGEC----------KCRVGWQGRYC----DECIRYPGCLHGTCQQP---WQCNCQEGWGGLFCNQDLNYCTHHKPCRNGATC---TNTGQGSYTCSCRPGYTGANCEL-EVDECAPSPCKNGASCTDLE--DSFSCTCPPGFYGKVCELSAMTCA----DGPCFNGGRCSDNPDGGYTCHCPLGFSGFNCEKKMDLCGSSPCSNGAKCVDLGNSYLCRCQAGFSGRYCEDNVDDCASSPCANGGTCRDSVNDFSCTCPPGYTGKNC 477          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q9QXX0|JAG1_MOUSE (Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 PE=1 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 2.170e-172
Identity = 306/864 (35.42%), Postives = 444/864 (51.39%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC  + PC N G C N   +   Y+C CP G+ G +CEI    C  +PC  +G+C ++   F C+C   WTG  C  +   C  N+C +GG C    NG  +C+C   + G  C L A  CE   C +A  C+     +  Y C C PG+ G+ CD  IN+C+   C+N+  C D +N Y+C C   + G +CE +I  C + PC NGG CQ     + C C TG++G  C++    C PNPC NGA CY    D++C C +++ GK C H + +C   +CE   D+C++    N +      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPCKNGG CID +N+++CIC +G+ G  CE   + C ++PC   G C     +L NDF C+CKN W G+ CH  + S CD   C NGG+C     ++ F+C C  GW GT C   +I        N C N G C+ V  + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ ++C CP G  G  C  V         SC+   R+   G  W  +C  C C  G+V C  V CG   C      ++   C  G+ C   P    +CFV PC     C +  S+ P             C  +S    N CA I  TFNK+ +  G+T + IC  ++ L  +++++      S+ I+C+ + + +  ++VAI +  E+I  D      P       +I   L+     N++    + ++ +    L + +     L+  +L   +A+   ++   YW  RK+
Sbjct:  287 NWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPD--KYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNG-FKCVCPPQWTGKTCQLDANECEAKPCVNARSCK---NLIASYYCDCLPGWMGQNCDININDCL-GQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTTCE-VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCR----DLVNDFYCDCKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEVDTFKCMCPGGWEGTTC---NIARNSSCLPNPCHNGGTCV-VNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQCICPPGHSGAKCHEVSGR------SCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKSHNE---CPSGQSC--IPVLDDQCFVRPCTGVGEC-RSSSLQP---------VKTKCTSDSYYQDN-CANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAE---YSIYIACEPSLSANNEIHVAISA--EDIRDD----GNPVKEITDKII--DLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLT--VAWVCCLVTAFYWCVRKR 1096          

HSP 2 Score: 163.31 bits (412), Expect = 2.170e-172
Identity = 87/266 (32.71%), Postives = 136/266 (51.13%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKS---SWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L+I      + +  +G CCG   +     CT   C   F +CL+ Y + V+   P      C++G   T + G ++        +     +     +WP S TL++EA+D+S       ++I++  +   + PS     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GWMG DCN  IC+ GC   HG C+ PG+CRC+ GWQG +CD+C+ +PGC HGTC + PW C CE 
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGP------CSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSR---QWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTC-NEPWQCLCET 286          

HSP 3 Score: 257.299 bits (656), Expect = 1.166e-68
Identity = 221/689 (32.08%), Postives = 311/689 (45.14%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEK-----EKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKH---SICD----------------------SNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNK 2962
            C+E W G  C++  +IC Q      G C    +    C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC N G C+E  +G+ C+C  G+TG  C      CSPN C +G  C  +   F C C  ++ GK C+       ++P     SC+    S Y  C    M  +  I  N C   G C +          + C C PG+ GD CE DID+C +NPC NGG C + IN F+C+C  GF G  C+   DYC  +PC N   C   +    +D+ C+C  ++ G+ C HL  H   + C+                      SN C   G C   S    F C CN+G+ GT C   H +   C   N CKN G CI+ G N + C C  G+EG HC+ N N+C+ NPC  GG C D +N + C C  G+ G  C     +C    C  G  C D +D F+C CP G +G  C+ +  N S  P  C        +G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A C+ E + Y    I  PG S   C   S ++     ++IL   K
Sbjct:  220 CMEGWMGPDCNK--AICRQGCSPKHGSCKLPGD----CRCQYGWQGLYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSCKNLIASYYCDCLPGWMGQNCDININDC--LGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA----SDYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSG-GKFTCDCNKGFTGTYC---HENINDC-ESNPCKNGGTCID-GVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCN-IARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGY--QCICPPGHSGAKCHEVSGRSCITMGRVILDGAK 875          

HSP 4 Score: 89.3521 bits (220), Expect = 1.704e-16
Identity = 76/270 (28.15%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG--VCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTC 1507
            + W G  C+ ++N C++ NPC  GG C +L++                                   EV  +KC+CP G+EG  C I     C PNPC   GTC+ +   F C C E W G +C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C+C PG++G  C    +E     C   G  +   +  D  CN      G+     + C  +PC+      E  +G +C
Sbjct:  657 DGWEGAHCENNINDCSQ-NPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCVDE---INGYQCICPPGHSGAKC----HEVSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKSHNECPSGQSC 917          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|P78504|JAG1_HUMAN (Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3)

HSP 1 Score: 469.159 bits (1206), Expect = 1.137e-171
Identity = 308/864 (35.65%), Postives = 444/864 (51.39%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC  + PC NGG C N   +   Y+C CP G+ G +CEI    C  +PC  +G+C ++   F C+C   WTG  C  +   C  N+C +GG C    NG  +C+C   + G  C L A  CE   C +A  C+     +  Y C C PG+ G+ CD  IN+C+   C+N+  C D +N Y+C C   + G +CE +I  C + PC NGG CQ     + C C TG++G  C++    C PNPC NGA CY    D++C C +++ GK C H + +C    CE   D+C++    N +      I  N CG +G C S    KF C C  GF G  C  +I+DC++NPC+NGG CID +N+++CIC +G+ G  CE   + C ++PC N G C     +L NDF C+CKN W G+ CH  + S CD   C NGG+C      + F+C C  GW GT C   +I        N C N G C+ V    FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ + C CP G  G  C  V    S +P  C+    +   G  W  +C  C C  G++ C  V CG   CL   G  +   C  G+ C   P    +CFV PC     C +  S+ P             C  +S    N CA I  TFNK+ +  G+T + IC  ++ L  +++++      S+ I+C+ + + +  ++VAI +  E+I  D      P       +I   L+     N++    + ++ +    L + +     L+  +L   +A+   ++   YW  RK+
Sbjct:  287 NWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPD--KYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNG-FKCVCPPQWTGKTCQLDANECEAKPCVNAKSCK---NLIASYYCDCLPGWMGQNCDININDCL-GQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCR----DLVNDFYCDCKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEGDAFKCMCPGGWEGTTC---NIARNSSCLPNPCHNGGTCV-VNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCVCPPGHSGAKCQEV----SGRP--CITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSE---CPSGQSC--IPILDDQCFVHPCTGVGEC-RSSSLQP---------VKTKCTSDSYYQDN-CANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAE---YSIYIACEPSPSANNEIHVAISA--EDIRDD----GNPIKEITDKII--DLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLT--VAWICCLVTAFYWCLRKR 1096          

HSP 2 Score: 159.073 bits (401), Expect = 1.137e-171
Identity = 85/266 (31.95%), Postives = 135/266 (50.75%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKS---SWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L+I      + +  +G CCG   +     CT   C   F +CL+ Y + V+   P      C++G   T + G ++        +     +     +WP S TL++EA+D+S       ++I++  +   + PS     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PG+CRC+ GWQG +CD+C+ +PGC HG C + PW C CE 
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGP------CSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSR---QWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGIC-NEPWQCLCET 286          

HSP 3 Score: 256.144 bits (653), Expect = 2.447e-68
Identity = 215/671 (32.04%), Postives = 303/671 (45.16%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEK-----EKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCSRLSTLNG--------------------------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQ 2905
            C+E W G  C++  +IC Q      G C    +    C CQ G++G  C    P  +  C H +           ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC N G C+E   G+ C+C  G+TG  C      CSPN C +G  C  +   F C C  ++ GK C+       ++P    +SC+    S Y  C    M  +  I  N C   G C +          + C C PG+ GD CE DID+C +NPC NGG C + IN F+C+C  GF G  C+   DYC  +PC N   C   +    +D+ C+C  ++ G+ C HL  H  C + PC    SC+     N                           F C CN+G+ GT C   H +   C   N C+N G CI+ G N + C C  G+EG +C+ N N+C+ NPC NGG C D +N + C C  G+ G  C     +C    C  G  C D  D F+C CP G +G  C+ +  N S  P  C        +GE+++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A C+ E + Y    +  PG S   CQ
Sbjct:  220 CMEGWMGPECNR--AICRQGCSPKHGSCKLPGD----CRCQYGWQGLYCDKCIP--HPGCVHGI-------CNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNAKSCKNLIASYYCDCLPGWMGQNCDININDC--LGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA----SDYFCKCPEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKGFTGTYC---HENINDC-ESNPCRNGGTCID-GVNSYKCICSDGWEGAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCN-IARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGY--RCVCPPGHSGAKCQ 856          

HSP 4 Score: 91.2781 bits (225), Expect = 4.900e-17
Identity = 79/270 (29.26%), Postives = 115/270 (42.59%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNG-VCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTC 1507
            + W G +C+ ++N C++ NPC NGG C +L++                                   E   +KC+CP G+EG  C I     C PNPC   GTC+ +   F C C E W G +C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C+C PG++G  C     E    PC   G V  D    D  CN      G+     + C  +PC       E  +G +C
Sbjct:  657 DGWEGAYCETNINDCSQ-NPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICAQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCVDE---INGYRCVCPPGHSGAKC----QEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPRPCLLHKGHSECPSGQSC 917          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q63722|JAG1_RAT (Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2)

HSP 1 Score: 465.307 bits (1196), Expect = 2.326e-171
Identity = 306/864 (35.42%), Postives = 441/864 (51.04%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC  + PC N G C N   +   Y+C CP G+ G +CEI    C  +PC  +G+C ++   F C+C   WTG  C  +   C  N+C +GG C    NG  +C+C   + G  C L A  CE   C +A  C+     +  Y C C PG+ G+ CD  IN+C+   C+N+  C D +N Y+C C   + G +CE +I  C + PC NGG CQ     + C C TG++G  C++    C PNPC NGA CY    D++C C +++ GK C H + +C    CE   D+C++    N +      I  N CG +G C S    KF C C  GF G  C  +I+DC+ NPC NGG CID +N+++CIC +G+ G  CE   + C ++PC   G C     +L NDF C+CKN W G+ CH  + S CD   C NGG+C     ++ F+C C  GW GT C   +I        N C N G C+ V  + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ ++C CP G  G  C  V         SC+   R+   G  W  +C  C C  G+V C  V CG   C    G  +   C  G+ C   P    +CFV PC     C +  S+ P             C  +S    N CA I  TFNK+ +  G+T + IC  ++ L  +++++      S+ I+C+ + + +  ++VAI +  E+I  D      P       +I   L+     N++    + ++ +    L + +     L+  +L   +A+   ++   YW  RK+
Sbjct:  287 NWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPD--KYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNG-FKCVCPPQWTGKTCQLDANECEAKPCVNARSCK---NLIASYYCDCLPGWMGQNCDININDCL-GQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCE-VIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSESGGKFTCDCNKGFTGTYCHENINDCEGNPCTNGGTCIDGVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCR----DLVNDFYCDCKNGWKGKTCH-SRDSQCDEATCNNGGTC--YDEVDTFKCMCPGGWEGTTC---NIARNSSCLPNPCHNGGTCV-VNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYQCICPPGHSGAKCHEVSGR------SCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPRPCRLHKGHGE---CPNGQSC--IPVLDDQCFVRPCTGAGEC-RSSSLQP---------VKTKCTSDSYYQDN-CANITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAE---YSIYIACEPSLSANNEIHVAISA--EDIRDD----GNPVKEITDKII--DLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLT--VAWVCCLVTAFYWCVRKR 1096          

HSP 2 Score: 162.155 bits (409), Expect = 2.326e-171
Identity = 86/266 (32.33%), Postives = 136/266 (51.13%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKS---SWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L+I      + +  +G CCG   +     CT   C   F +CL+ Y + V+   P      C++G   T + G ++        +     +     +WP S TL++EA+D+S       ++I++  +   + PS     W  +  +   + +++ + + C   YYG  C+++C+      GHY CD NG K C  GWMG +CN  IC+ GC   HG C+ PG+CRC+ GWQG +CD+C+ +PGC HGTC + PW C CE 
Sbjct:   31 ASGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGP------CSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSR---QWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTC-NEPWQCLCET 286          

HSP 3 Score: 257.299 bits (656), Expect = 1.025e-68
Identity = 219/690 (31.74%), Postives = 309/690 (44.78%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE------HSRPYCGNESCE----SAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEK-----EKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCSRLSTLNG--------------------------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK--PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNK 2962
            C+E W G  C++  +IC Q      G C    +    C CQ G++G  C    P  +  C H        T    ++CLC+  + G+ CDK++N C    PC N G C+++  D Y+C+C   + G NCE+   AC + PC N G C+E  +G+ C+C  G+TG  C      CSPN C +G  C  +   F C C  ++ GK C+       ++P     SC+    S Y  C    M  +  I  N C   G C +          + C C PG+ GD CE DID+C +NPC NGG C + IN F+C+C  GF G  C+   DYC  +PC N   C   +    +D+ C+C  ++ G+ C HL  H  C + PC    SC+     N                           F C CN+G+ GT C   H +   C   N C N G CI+ G N + C C  G+EG HC+ N N+C+ NPC  GG C D +N + C C  G+ G  C     +C    C  G  C D +D F+C CP G +G  C+ +  N S  P  C        +G++++  C    +   C +    C   PC    TC+     D+ Y C+  PG        N   C   PC   A C+ E + Y    I  PG S   C   S ++     ++IL   K
Sbjct:  220 CMEGWMGPECNK--AICRQGCSPKHGSCKLPGD----CRCQYGWQGLYCDKCIP--HPGCVHG-------TCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFECECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKPCVNARSCKNLIASYYCDCLPGWMGQNCDININDC--LGQCQNDASCRDLVNGYRCICPPGYAGDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCYNRA----SDYFCKCPEDYEGKNCSHLKDH--CRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSESGGKFTCDCNKGFTGTYC---HENINDC-EGNPCTNGGTCID-GVNSYKCICSDGWEGAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCN-IARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDG---DNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGY--QCICPPGHSGAKCHEVSGRSCITMGRVILDGAK 875          

HSP 4 Score: 88.9669 bits (219), Expect = 2.037e-16
Identity = 63/204 (30.88%), Postives = 93/204 (45.59%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLS-----------------------------------EVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYC 1315
            + W G  C+ ++N C++ NPC  GG C +L++                                   EV  +KC+CP G+EG  C I     C PNPC   GTC+ +   F C C E W G +C Q+T+ C  + C N G C   +N   RC C  G+ G +C +    C++S C     C  +   +  Y+C+C PG++G  C
Sbjct:  657 DGWEGAHCENNINDCSQ-NPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTCYDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNW-YRCECAPGFAGPDCRININECQSSPCAFGATCVDE---INGYQCICPPGHSGAKC 855          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q9QYE5|JAG2_MOUSE (Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2)

HSP 1 Score: 469.159 bits (1206), Expect = 3.218e-171
Identity = 312/864 (36.11%), Postives = 432/864 (50.00%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIK-HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYA-CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPII--AFGVL----VLIGAYW 3373
             NWGG  CD+ LNYC  ++PC NGG C N  +E   Y C CP G+ G++CE     C  NPC  G +C +    F C C   W G  C  D   C  N C  GG C  D+     CIC + + G+ C L A  CE   C +A  C+     +G Y C C PG+ G  C   IN+C    C++ G C D +N Y+C C   F G++CEL    C + PC+ GG+C+++  G+ C C  G +G +CE+    C P+PCLNGA CY +  D+YC C ++F GK C   R  C   +C    D C       + G+     CG +G C+S     F C C  GF G  C  +IDDC   PC+NGG CID +++F C C +G+ G+ C+   + C+  PC + G C     +L NDF C C + W G+ CH  +   CD+  C NGG+C    + + F+C C  GW G+ C    I        N C N G C+  G + F+C C+ G+EG+ C  NTN+CNP PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ + C CP GR G  C  V     P    C      F  G +W  +C +C C  G   C  V CG   CL +    DP A C PG+ C        +C  PPC     C  E  + P+            CQP S    N CA++ L FN+  VP G T+  IC GI+ L   +        R L + CD   + ++ V VA+ +SP  ++    L  S   AH +   I +      + N++    + ++ + T+++   S         LLVP++   F VL    V+I  +W
Sbjct:  297 TNWGGLLCDKDLNYCGSHHPCVNGGTCIN--AEPDQYLCACPDGYLGKNCERAEHACASNPCANGGSCHEVPSGFECHCPSGWNGPTCALDIDECASNPCAAGGTC-VDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCK---NLIGGYYCDCLPGWKGINCQININDCH-GQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACR-VIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSGWEGELCDINPNDCLPDPCHSRGRCY----DLVNDFYCACDDGWKGKTCH-SREFQCDAYTCSNGGTC--YDSGDTFRCACPPGWKGSTCT---IAKNSSCVPNPCVNGGTCVGSG-DSFSCICRDGWEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGYRCSCPPGRSGPRCQEVVIFTRP----CWSRGMSFPHGSSWMEDCNSCRCLDGHRDCSKVWCGWKPCLLSGQPSDPSAQCPPGQQCQEKAVG--QCLQPPCENWGECTAEEPLPPSTP----------CQPRSSHLDNNCARLTLRFNRDQVPQGTTVGAICSGIRALPATR---AAAHDRLLLLLCDRASSGASAVEVAVSFSPARDLPDSSLIQST--AHAIVAAITQ------RGNSSLLLAVTEVKVETVVMGGSSTG-------LLVPVLCSVFSVLWLACVVICVWW 1107          

HSP 2 Score: 157.532 bits (397), Expect = 3.218e-171
Identity = 93/277 (33.57%), Postives = 135/277 (48.74%), Query Frame = 3
Query:   63 FSLKITKYIKYSFQRLDGKCC-GDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-----------------NKESTHSYKFTIKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            F L+++     + + L G CC GD  +     C    C     +CL+ Y A V+P      TG C+YG   T + G +S                      +         + +WP S TLI+EA+D  ++T P  + +I+RV +   + P      W  +  S   +  +  + + C  +YY   C+++C+      GHY CD  G K C  GWMG +C   +C+ GC+ +HG C  PGECRC  GWQG FCDEC+ YPGC HG+CV+ PW C CE
Sbjct:   30 FELQLSALRNVNGELLSGACCDGDGRTTRAGGCGRDECDTYVRVCLKEYQAKVTP------TGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSRTGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPE---DRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKECKEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSCVE-PWHCDCE 296          

HSP 3 Score: 118.627 bits (296), Expect = 2.034e-25
Identity = 128/459 (27.89%), Postives = 176/459 (38.34%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC---------HLP------------------------------KHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCIN-------------VG---------------YNDFTCH---------CKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFD-SGETW-----SYNCQNCACDRGKV---TCESVP-CGVWTCLQANGTDDPYACKPGEMCYSFPF------------------NPKRCFVPPCVPKARCIKEYSIY----PNNQISWPGE----SHKDCQPNSIKNHNYCAKIILTF 2956
            EC C  G+ GK C+E    C+  P   +G C+         + C+C+ NWGG LC         H P                                  C SNPC NGGSC  + +  GF+CHC  GW G  C    +D   C   N C   G C++             VG                N F+C          C PG++G +C IN N+C+   C +GG C D +N Y+C+C +GF G +C+L YD+CAS PC  G IC D +D F C CP G  G  C+   +   P P  C+   R ++  G+ +      +  +NC+  R       C  +  CG     +A G      C P   C S P                   N   C   PC     CI E   +    P+    W GE    +  DC P+   +   C  ++  F
Sbjct:  261 ECRCSYGWQGKFCDE----CVPYPGCVHGSCVE-------PWHCDCETNWGGLLCDKDLNYCGSHHPCVNGGTCINAEPDQYLCACPDGYLGKNCERAEHACASNPCANGGSCHEVPS--GFECHCPSGWNGPTCA---LDIDEC-ASNPCAAGGTCVDQVDGFECICPEQWVGATCQLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGINCQININDCH-GQCQHGGTCKDLVNGYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLCEPSP--CLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGVAPSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRCFCPSG---WEGELCDINPNDCLPDPCHSRGRCYDLVNDF 696          
BLAST of Delta-like protein vs. UniProt/SwissProt
Match: sp|Q90Y57|JAG1A_DANRE (Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1)

HSP 1 Score: 471.47 bits (1212), Expect = 1.260e-170
Identity = 314/925 (33.95%), Postives = 467/925 (50.49%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKE--KFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERNISNST 3562
            NWGGQ CD+ LN C    PC NGG C N   +   Y C CP G+ G++CE   + C   PC   G C++S   F CQC   WTG  C+ +   C  N C + G C    +G  +CIC   + G  C + A  CE S C +A  C+     +G Y C C PG+TG+ CD  +N+C    C N G+C D +N Y+C C+  F G  CE ++  C ++PC NGG CQ+   G+ C C  G++G  C++    C   PC NGA C+++  D+YC C +++ GK C   + +C    C+   D+C++  + NS+      I  + CG +G C SH      F C C  GF G  C  +I+DC+++PC +GG CID IN ++CIC +G+ G  CE   D C  +PC + GVC     +L NDF CEC+N W G+ CH  + S CD + C NGG+CS     + F+C C+ GW G  C   +I        N C+N   C+  G + FTC CK G+EG  C  N+N+CNP PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ CVD I+ + C CP GR G  C  V          CV   RI   G  W+ +C  C C +G VTC  + CG   C +  +G  D   C  G++C   P   ++CFV PC  +  C   +                 CQP+S     +CA +  TFNK  +P G+T++ +C  ++ L   +++       S+ +SC+++   S  ++VAI+     I+        P       +I   L+     N++    + ++ +      + + D   ++  L+  + A  VL L   + +  +     R++ +++T IN  +  S P     +           +HL +  N  E+N SN +
Sbjct:  288 NWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPD--KYHCACPDGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDG-FKCICPVQWTGKTCLIDANECEESPCVNAHSCR---NLIGGYFCECLPGWTGQNCDINVNDC-HGQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRCQDTLNGFQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQ-VIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCR----DLVNDFYCECENGWKGKTCH-SRESQCDEDTCNNGGTCSDEG--DSFKCLCSPGWEGATC---NIAKNSSCLPNPCENGATCVVTG-DGFTCVCKEGWEGPTCSQNSNDCNPQPCYNSGTCVDGDNWYRCECASGFAGPDCRININECQSSPCAFGSTCVDEINGYRCLCPPGRTGPRCQEVTGR------PCVIGGRIAVDGAKWAEDCNTCYCHKGIVTCTKLFCGPKACRMLGSGRGD---CPTGQLC--VPVRDEQCFVKPCSSQGECWSAHRPAVRTH----------CQPDS-----HCANVTFTFNKDTMPQGVTVEQVCRELRHLYVTKNVTSE---FSISVSCELSSAASNEIHVAIHVTENGIH-----GRVPVKEITDNII--DLVSKHSANSSVIGSIAEVRVQRKQPQNPNVDY--MVPLLVSVVTAIWVLALASVFLWCIRHH---RKQSSSATAINPTSPFSTPEENTANN--------AREHLNQIKNHIEKNASNGS 1144          

HSP 2 Score: 153.68 bits (387), Expect = 1.260e-170
Identity = 88/270 (32.59%), Postives = 134/270 (49.63%), Query Frame = 3
Query:   48 ESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVP-CIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDS--SMKFNKESTHSYKFTIKSS--WPGSITLIIEAYD---TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            E+   F +++      + +   G CC       + +C    C   F +CL+ Y + VS   P      C+YG   T + G +  S+K   ++    +  +  S  WP S TLI+EA D    S T      VI++ V    + P+     W  +  +   + +Q+ + + C   Y+G  C+++C+      GHY CD NG K C  GW G +CN  IC+ GC   HG C+ PG CRC  GWQG +CD+C+ +PGC HGTC++ PW C C+
Sbjct:   27 EASGHFEMQVLSMQNVNGELQSGACCDGARDPAERSCAADQCDTFFRVCLKEYQSRVSSGGP------CSYGSGSTPVIGGNTFSVKPLDQTNDKTRIVLPFSFAWPRSYTLIVEALDFNNDSSTGSINGQVIEKAVQSGMINPNR---QWQVLKHNGPVAQFQYQIRVTCDEHYFGFGCNKFCRPRDDFFGHYTCDHNGNKTCLEGWAGPECNTAICKQGCSIEHGSCKVPGNCRCLYGWQGEYCDQCIPHPGCVHGTCIE-PWQCLCD 286          

HSP 3 Score: 276.944 bits (707), Expect = 5.308e-75
Identity = 206/641 (32.14%), Postives = 305/641 (47.58%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNP-CKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQ-NSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCM---------------------------NYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYD-ECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ 2656
            W G  C+ ++        CK G   E+   +V P  C C  G++G  C  D C P+P C  GTC++    + C C   W G+LCD+D + C     C NGG C         C C  GY G  C  A   C +  C +   C    ++LG ++C C  G+TG  C+   ++C PNPC ++GVC D ++ +KC C   + GK C ++   C+  PC N   C+ +  GY C+C  G+TG NC+I    C    CLNG  C  +   + C C   F G RCE     C +  C            LN    +    G            F C C PGF G +C++D+D C++ PC+NG  C    +++ C C   + GK C +  D+C+ +PC                             +G C  HS      F C+C++ + G  CH    + C+S+PCL+GG+C  +  +N +QC C  GW G  C+    +   C R N C++ GVC ++  NDF C C+ G++GK C    ++C+ + C NGG C D+ +S++C+C+ G+ G+ C +  +  C   PC  GA CV   D F C C EG +G  C    N+ +PQP    Y +     G+ W Y C+
Sbjct:  225 WAGPECNTAI--------CKQGCSIEHGSCKV-PGNCRCLYGWQGEYC--DQCIPHPGCVHGTCIEP---WQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPDGYSGQNCERADNACLSEPCLNGGLC--VESSLG-FECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSCRNLIGGYFCECLPGWTGQNCDINVNDCH-GQCLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPC------------LNGGRCQDTLNG------------FQCLCPPGFSGATCQLDLDYCESGPCQNGAQCFSLASDYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHS-HAGGHFSCDCQDGFTGTYCH-ENINDCESSPCLSGGTC--IDKINAYQCICADGWEGPNCE---TNIDDC-RTNPCRDRGVCRDL-VNDFYCECENGWKGKTCHSRESQCDEDTCNNGGTCSDEGDSFKCLCSPGWEGATCNIAKNSSCLPNPCENGATCVVTGDGFTCVCKEGWEGPTCSQNSNDCNPQP---CYNSGTCVDGDNW-YRCE 810          

HSP 4 Score: 258.455 bits (659), Expect = 4.713e-69
Identity = 178/532 (33.46%), Postives = 252/532 (47.37%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGY--NDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C+E W G  C+  T+IC Q      G C    N    C C  G++G  C    P  +  C H        T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y C C   + G+NCE  + AC ++PC NGG+C E   G+ C+C  G+TG +C I +  CSPNPC +   C  +   F C C  ++ GK C      C    C +A+                N  G Y            C C+PG+ G +C+I+++DC    C NGG+C D +N + C+C  GF G  CE   D C   PC+N G C     +  N F C C   + G  C L     C+S PC NG  C  L++   + C C + + G  C  L  H    PC+                       ++C   G C +  +    F+C C+ GF G +C  N N+C  +PC +GG CIDK+N+Y+CICA G+ G NC+ N D+C + PC    +C D ++DF C C  G  GK C
Sbjct:  221 CLEGWAGPECN--TAICKQGCSIEHGSCKVPGN----CRCLYGWQGEYCDQCIP--HPGCVHG-------TCIEPWQCLCDTNWGGQLCDKDLNTCGTLQPCLNGGTCSNTGPDKYHCACPDGYSGQNCERADNACLSEPCLNGGLCVESSLGFECQCAAGWTGPSCNINEDDCSPNPCNHSGVCVDLVDGFKCICPVQWTGKTCLIDANECEESPCVNAHSC-------------RNLIGGY-----------FCECLPGWTGQNCDINVNDCHGQ-CLNGGLCKDLVNGYRCVCAAGFAGDRCERDVDECASRPCLNGGRC----QDTLNGFQCLCPPGFSGATCQL-DLDYCESGPCQNGAQCFSLAS--DYYCKCPEDYEGKNCSQLKDHCLITPCQVIDSCTVAVVSNSTPGGLRLISSSVCGPHGRCRSHSHAGGHFSCDCQDGFTGTYCHENINDCESSPCLSGGTCIDKINAYQCICADGWEGPNCETNIDDCRTNPCRDRGVCRDLVNDFYCECENGWKGKTC 705          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A074ZZC9 (Delta-like protein OS=Opisthorchis viverrini OX=6198 GN=T265_01276 PE=4 SV=1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 350/945 (37.04%), Postives = 511/945 (54.07%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCM-KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ--IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDAC-----------------------SMPQMLNSSGIKHNYCGKYGTCLSHEKEK--FICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICD-SNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPK-RCFVPPCVPKARCIKEYSIYPNNQIS-----WPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTL-KCIQDLNGTPRGRSLGISCDI----NENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTF-----------------------------------FTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTK 3427
            NWGG FCDQ L+YC+ + PCKNGGIC+N  +  + + C CP  F G  CE  + PC  NPCK+G C+ K    + C+C   W G  C+++   C +NSC NGG C   +    RC+C  G+KG+ C L +PC NS+C HA DC   I      +Y CLCQPG+TG++CD+ I++CV + C+N G C D ++D+ C C   F G++CE+N  C ++PC+N G+C E+  GY C+C  GYTG NCEI   GCSPNPC N AYCYT+   FYC C+ + +G+ CEH RPYCG   C    D C                       ++ +  ++       CG +GTC+  E E   ++C C  GF+G  C+  ++ C+ NPC +GG CI++++  EC+C  GF G  CE   D C  +PC N G C  H      DF C C   W GR C L     C+ S  C N G+C S      GFQC C + W+G+VC     D + C  + LCKN   C++VG + F C C+PGF+G++C  N NEC+  PC+N G C+D +NS+ C C KGF GS+C +N +ECA+ PCA+G+ C+DR+ D++C CPE R G+ C+ V     P+PP+C ++ RI+D  ETW+Y+CQ+C CD G+V C+   CG W+C +A G  DP+ACK  E+C+      +  CFVPPC  +  C+      P          +PG +   C+PN+   +N CA+IIL F++  +P G+T+ D+C  ++ L   ++        ++ G+SCD+     +     + + I +  + + +        FAH L+  I+K +      N T                                      G+V+I + T++L    F    LI  +   I+A  V+  I    Y ++K  ++  KYA+S  
Sbjct:  288 NWGGPFCDQDLDYCSRHQPCKNGGICKNEPTASKQFSCSCPKDFTGELCETKLAPCTWNPCKRGRCVPKGADNYRCECEPGWRGDHCEKNIDYCLKNSCLNGGICQDLDGIGFRCLCPPGFKGANCQLRSPCGNSRCVHARDCTQLIPPVNGVEYSCLCQPGWTGQFCDQNIDDCV-DKCQNGGTCHDLVDDFYCTCPKGFYGRHCEINRECTSEPCQNNGICHEITGGYRCECPNGYTGHNCEIATNGCSPNPCQNTAYCYTVPNGFYCKCSSKHYGQFCEHERPYCGPAGCAIVTDPCLTSMQSRSSVYPSLTQTVPQNDTALSEETHAVSSPWGVCGPHGTCVKTEDEGMGYMCVCSSGFQGKYCQEPVNHCEDNPCMHGGTCINTLDGVECMCQEGFVGPLCETPQDLCHPNPCQNGGNC--HHTIHPGDFFCSCDVGWSGRWCQLRTEDPCNASRICFNNGACHSNPHIPGGFQCECGENWMGSVCHLRRPDSRACANRTLCKNGATCVDVG-DSFNCICRPGFDGQYCQNNINECSSMPCYNNGTCVDLINSFECQCPKGFTGSDCSININECATNPCAFGSTCIDRVGDYQCICPESRHGRHCEEVLIYSPPKPPACNFHERIYDHNETWTYDCQHCQCDMGQVVCKDEFCGYWSCFRAVGQSDPFACKADEVCHILSSGGEGECFVPPCYLRTVCLNTTQSIPAQLRRMMPDMYPGPAMPGCRPNAAHLNNRCARIILQFSRARLPYGVTVGDVCMSVRQLPTTLRHREKQEEAKNFGMSCDLRATYTKEQGNAIEITISADGDQLQVGPDGQEHSFAHLLAYNISKDIAQKAATNITMRKDELGPLWTDETMPLPPFSQLLVTNQLDKYWHRVLLGVVEIHVDTMVLREKDFGSPILIPLVCSLILAAAVICTIFICAYAQRKHHQLLLKYASSVA 1228          

HSP 2 Score: 231.876 bits (590), Expect = 0.000e+0
Identity = 117/283 (41.34%), Postives = 158/283 (55.83%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDH--GSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYN--------SSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            L +I   +   H      + FS+KI ++  +  +R+DG CCG    G      C   C   F ICLE +   VS  D TPY G C YG+  T  WG++ M++      ++K  I  SWP S  +I+EAYD    N  ++ +IDR V+++ L+P  N           W+ V  +   S Y FS+ L C+PD+Y   C + C  N   Y CD NG+KVC+ GW GS+C+  IC+ GCH  HG C  PGEC C  GWQG +CDEC+KYPGCKHGTC D+P+TC C
Sbjct:    5 LHLICVSVFFLHCCANHLATFSIKILEFQNHERRRMDGTCCGKGKTGERNSSVCVAECSLEFRICLEPFSIPVSLTDRTPYAGPCIYGEGTTGHWGNTDMQYTFSEAPTHKINITLSWPLSFAVIVEAYDMITLN--KRYLIDRAVHRSLLRPVSNFPSQSVAGVKEWHHVTTTTQVSGYTFSIRLACQPDHYNNTCTKICLKNSTQYVCDSNGDKVCEPGWSGSECDTPICKVGCHPNHGNCLQPGECECAIGWQGPYCDECVKYPGCKHGTCDDAPFTCRC 285          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A419PFZ4 (Delta-like protein OS=Clonorchis sinensis OX=79923 GN=Jag2 PE=4 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 353/945 (37.35%), Postives = 510/945 (53.97%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCM-KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ--IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDAC-----------------SMPQMLNSSGIKH------NYCGKYGTCLSHEKEK--FICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICD-SNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPK-RCFVPPCVPKARCIKEYSIYPNNQIS-----WPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTL-KCIQDLNGTPRGRSLGISCDI----NENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTF-----------------------------------FTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTK 3427
            NWGG FCDQ L+YC+ + PCKNGGIC+N  +  + + C CP  F G  CE  + PC  NPCK+G C+ K    + C+C   W G  C+++   C +NSC NGG C   +    RC+C  G+KG+ C L +PC NS+C HA DC   I      +Y CLCQPG+TG++CD+ I++CV + C+N G C D ++D+ C C   F G++CE+N  C + PC+N G+C E+  GY C+C  GYTG NCEI   GCSPNPC N AYCYT+   FYC C+ + +G+ CEH RPYCG   C    D C                 ++      SG  H        CG +GTC+  + E   +IC C  GF+G  C+  ++ C+ NPC +GG CI+S++  EC+C+ GF G  CE   D C  +PC N G C  H      DF C C   W GR C L     C+ S  C N G+C S      GFQC C + W+G+VC     D + C  + LCKN   C++VG + F C C+PGF+G++C+ N NEC+  PC+N G C+D +NS+ C C KGF GS+C +N +ECA+ PCA+G+ C+DR+ D++C CPE R G+ C+ V     P+PP+C ++ RI+D  ETW+Y+CQ+C CD G+V C+   CG W+C  A G  DP+ACK  E+C+      +  CFVPPC  +  C+      P          +PG +   C+PN+   +N CA+IIL  ++  +P G+T+ D+C  ++ L   ++        ++ G+SCD+     +     + + I +  + + +        FAH L+  I+K +      N T                                      G+V+I + T++L    F    LI  +   I+A  V+  I    Y ++K  ++  KYA+S  
Sbjct:  292 NWGGPFCDQDLDYCSRHQPCKNGGICKNEPNAGKQFSCSCPKEFTGELCETKLAPCTWNPCKRGRCVPKGVDNYRCECEPGWRGDHCEKNIDYCLKNSCLNGGICQDLDGVGFRCLCPPGFKGANCQLRSPCGNSRCVHARDCTQLIPPVNGVEYSCLCQPGWTGQFCDQNIDDCV-DKCQNGGTCHDLVDDFYCTCPKGFYGRHCEINRECTSAPCQNNGICHEITGGYRCECPNGYTGHNCEIATNGCSPNPCQNTAYCYTVPNGFYCKCSSKHYGQFCEHERPYCGPAGCAIVTDPCLTSIQSRSSVYPSLTQTTLQNKTALSGETHAVSSPWGVCGPHGTCVKTDDEGMGYICVCSSGFQGKYCQEPVNHCEGNPCMHGGTCINSLDGVECMCEEGFVGPLCETPQDLCHPNPCQNGGNC--HHTIHPGDFFCSCDVGWSGRWCQLRTEDPCNVSRICFNNGACHSNPHIPGGFQCECGENWMGSVCHLRRPDSRACANRTLCKNGATCVDVG-DSFNCICRPGFDGQYCENNINECSSMPCYNNGTCVDLINSFECQCPKGFTGSDCSININECATNPCAFGSTCIDRVGDYQCICPESRHGRHCEEVLIYSPPKPPACNFHERIYDHNETWTYDCQHCQCDMGQVVCKDEFCGYWSCFHAVGQSDPFACKVDEVCHILSSGGEGECFVPPCYLRTVCLNTSQSIPAQLRRMMPDMYPGPAMPGCRPNAAHLNNRCARIILQLSRTRLPYGVTVGDVCMSVRQLPTTLRHREKQEEAKNFGMSCDLRATYTKEQGNAIEITISADDDQLQVGPDGQEHSFAHLLAYNISKDIAQKAATNITMRKDELGPLWTDETMPLPPFSQLLVTNQLDKYWHRVLLGVVEIHVDTMVLREKDFGSPILIPLVCSLILAAAVICTIFICAYAQRKHHQLLLKYASSVA 1232          

HSP 2 Score: 228.024 bits (580), Expect = 0.000e+0
Identity = 115/281 (40.93%), Postives = 158/281 (56.23%), Query Frame = 3
Query:   12 IFCFLEIF-HGFVESKSQFSLKITKYIKYSFQRLDGKCCGD--HGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYN--------SSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            +FC   +F H      + FS+KI ++     +R+DG CCG   +G      C   C   F ICLE +   VS  D +PY G C YG+  T  WG++ M++      +++  I  SWP S  +I+EAYD    N  ++ +IDR V+++ L+P  N           W+ V  +   S Y FSM L C+P +Y   C + C  N   Y CD NG+KVC+ GW G++C+  IC+ GCH  HG C  PGEC C  GWQG +CDEC+KYPGCKHGTC D+P+TC C
Sbjct:   11 LFCVSVLFLHCCANHLATFSIKILEFQNNERRRMDGTCCGKGKNGERNSSVCVAECSLEFRICLEPFSIPVSLTDRSPYAGPCVYGEGTTGHWGNTDMQYMFSEAPTHRINITLSWPLSFAVIVEAYDMITLN--KRYLIDRAVHRSLLRPVSNFPGHSVVGMKEWHHVTTTTQVSGYTFSMRLACQPGHYNNTCTKICLKNSTQYVCDSNGDKVCEPGWSGTECDTPICKVGCHPNHGSCLQPGECECAIGWQGPYCDECVKYPGCKHGTCDDAPFTCRC 289          

HSP 3 Score: 106.686 bits (265), Expect = 2.820e-19
Identity = 85/261 (32.57%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1811 CMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQ--FLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLN-SYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID-----DFECRCPEGRDGKLCDH 2566
            C PG+ G  C+  I  CK     N G C+      EC C  G+ G  C+E    C+K P   +G C    D+    F C C  NWGG  C           PC NGG C +  +    F C C + + G +C+       + PC+R       G C+  G +++ C C+PG+ G HC+ N + C  N C NGG C D     +RC+C  GF G+NCQL    C +  C +   C   I      ++ C C  G  G+ CD 
Sbjct:  224 CEPGWSGTECDTPI--CKVGCHPNHGSCLQP---GECECAIGWQGPYCDE----CVKYPGCKHGTC----DDA--PFTCRCLPNWGGPFCDQDLDYCSRHQPCKNGGICKNEPNAGKQFSCSCPKEFTGELCETKLAPCTWNPCKR-------GRCVPKGVDNYRCECEPGWRGDHCEKNIDYCLKNSCLNGGICQDLDGVGFRCLCPPGFKGANCQLR-SPCGNSRCVHARDCTQLIPPVNGVEYSCLCQPGWTGQFCDQ 461          
BLAST of Delta-like protein vs. TrEMBL
Match: G7YV35 (Delta-like protein OS=Clonorchis sinensis OX=79923 GN=CLF_111574 PE=4 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 353/945 (37.35%), Postives = 510/945 (53.97%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCM-KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ--IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDAC-----------------SMPQMLNSSGIKH------NYCGKYGTCLSHEKEK--FICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICD-SNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPK-RCFVPPCVPKARCIKEYSIYPNNQIS-----WPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTL-KCIQDLNGTPRGRSLGISCDI----NENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTF-----------------------------------FTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTK 3427
            NWGG FCDQ L+YC+ + PCKNGGIC+N  +  + + C CP  F G  CE  + PC  NPCK+G C+ K    + C+C   W G  C+++   C +NSC NGG C   +    RC+C  G+KG+ C L +PC NS+C HA DC   I      +Y CLCQPG+TG++CD+ I++CV + C+N G C D ++D+ C C   F G++CE+N  C + PC+N G+C E+  GY C+C  GYTG NCEI   GCSPNPC N AYCYT+   FYC C+ + +G+ CEH RPYCG   C    D C                 ++      SG  H        CG +GTC+  + E   +IC C  GF+G  C+  ++ C+ NPC +GG CI+S++  EC+C+ GF G  CE   D C  +PC N G C  H      DF C C   W GR C L     C+ S  C N G+C S      GFQC C + W+G+VC     D + C  + LCKN   C++VG + F C C+PGF+G++C+ N NEC+  PC+N G C+D +NS+ C C KGF GS+C +N +ECA+ PCA+G+ C+DR+ D++C CPE R G+ C+ V     P+PP+C ++ RI+D  ETW+Y+CQ+C CD G+V C+   CG W+C  A G  DP+ACK  E+C+      +  CFVPPC  +  C+      P          +PG +   C+PN+   +N CA+IIL  ++  +P G+T+ D+C  ++ L   ++        ++ G+SCD+     +     + + I +  + + +        FAH L+  I+K +      N T                                      G+V+I + T++L    F    LI  +   I+A  V+  I    Y ++K  ++  KYA+S  
Sbjct:  292 NWGGPFCDQDLDYCSRHQPCKNGGICKNEPNAGKQFSCSCPKEFTGELCETKLAPCTWNPCKRGRCVPKGVDNYRCECEPGWRGDHCEKNIDYCLKNSCLNGGICQDLDGVGFRCLCPPGFKGANCQLRSPCGNSRCVHARDCTQLIPPVNGVEYSCLCQPGWTGQFCDQNIDDCV-DKCQNGGTCHDLVDDFYCTCPKGFYGRHCEINRECTSAPCQNNGICHEITGGYRCECPNGYTGHNCEIATNGCSPNPCQNTAYCYTVPNGFYCKCSSKHYGQFCEHERPYCGPAGCAIVTDPCLTSIQSRSSVYPSLTQTTLQNKTALSGETHAVSSPWGVCGPHGTCVKTDDEGMGYICVCSSGFQGKYCQEPVNHCEGNPCMHGGTCINSLDGVECMCEEGFVGPLCETPQDLCHPNPCQNGGNC--HHTIHPGDFFCSCDVGWSGRWCQLRTEDPCNVSRICFNNGACHSNPHIPGGFQCECGENWMGSVCHLRRPDSRACANRTLCKNGATCVDVG-DSFNCICRPGFDGQYCENNINECSSMPCYNNGTCVDLINSFECQCPKGFTGSDCSININECATNPCAFGSTCIDRVGDYQCICPESRHGRHCEEVLIYSPPKPPACNFHERIYDHNETWTYDCQHCQCDMGQVVCKDEFCGYWSCFHAVGQSDPFACKVDEVCHILSSGGEGECFVPPCYLRTVCLNTSQSIPAQLRRMMPDMYPGPAMPGCRPNAAHLNNRCARIILQLSRTRLPYGVTVGDVCMSVRQLPTTLRHREKQEEAKNFGMSCDLRATYTKEQGNAIEITISADDDQLQVGPDGQEHSFAHLLAYNISKDIAQKAATNITMRKDELGPLWTDETMPLPPFSQLLVTNQLDKYWHRVLLGVVEIHVDTMVLREKDFGSPILIPLVCSLILAAAVICTIFICAYAQRKHHQLLLKYASSVA 1232          

HSP 2 Score: 228.024 bits (580), Expect = 0.000e+0
Identity = 115/281 (40.93%), Postives = 158/281 (56.23%), Query Frame = 3
Query:   12 IFCFLEIF-HGFVESKSQFSLKITKYIKYSFQRLDGKCCGD--HGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYN--------SSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            +FC   +F H      + FS+KI ++     +R+DG CCG   +G      C   C   F ICLE +   VS  D +PY G C YG+  T  WG++ M++      +++  I  SWP S  +I+EAYD    N  ++ +IDR V+++ L+P  N           W+ V  +   S Y FSM L C+P +Y   C + C  N   Y CD NG+KVC+ GW G++C+  IC+ GCH  HG C  PGEC C  GWQG +CDEC+KYPGCKHGTC D+P+TC C
Sbjct:   11 LFCVSVLFLHCCASHLATFSIKILEFQNNERRRMDGTCCGKGKNGERNSSVCVAECSLEFRICLEPFSIPVSLTDRSPYAGPCVYGEGTTGHWGNTDMQYMFSEAPTHRINITLSWPLSFAVIVEAYDMITLN--KRYLIDRAVHRSLLRPVSNFPGHSVVGMKEWHHVTTTTQVSGYTFSMRLACQPGHYNNTCTKICLKNSTQYVCDSNGDKVCEPGWSGTECDTPICKVGCHPNHGSCLQPGECECAIGWQGPYCDECVKYPGCKHGTCDDAPFTCRC 289          

HSP 3 Score: 106.686 bits (265), Expect = 2.968e-19
Identity = 85/261 (32.57%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 1811 CMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQ--FLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLN-SYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID-----DFECRCPEGRDGKLCDH 2566
            C PG+ G  C+  I  CK     N G C+      EC C  G+ G  C+E    C+K P   +G C    D+    F C C  NWGG  C           PC NGG C +  +    F C C + + G +C+       + PC+R       G C+  G +++ C C+PG+ G HC+ N + C  N C NGG C D     +RC+C  GF G+NCQL    C +  C +   C   I      ++ C C  G  G+ CD 
Sbjct:  224 CEPGWSGTECDTPI--CKVGCHPNHGSCLQP---GECECAIGWQGPYCDE----CVKYPGCKHGTC----DDA--PFTCRCLPNWGGPFCDQDLDYCSRHQPCKNGGICKNEPNAGKQFSCSCPKEFTGELCETKLAPCTWNPCKR-------GRCVPKGVDNYRCECEPGWRGDHCEKNIDYCLKNSCLNGGICQDLDGVGFRCLCPPGFKGANCQLR-SPCGNSRCVHARDCTQLIPPVNGVEYSCLCQPGWTGQFCDQ 461          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A4E0RM29 (Delta-like protein OS=Fasciola hepatica OX=6192 GN=D915_002371 PE=4 SV=1)

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 358/942 (38.00%), Postives = 512/942 (54.35%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSKGEFY-CQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ--IQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDAC----SMPQM-------------LNSSGIKHNYCGKYGTCLS---HEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICD-SNPCLNGGSC-SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPK-RCFVPPCVPKARCIK-----EYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQ-DLNGTPRGRSLGISCDI-----NENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTF--------------------------------------FTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANST 3424
            WGG  CDQ L+YC  + PCKNGGIC N  S  +P+ C C     G  CE  + PC  NPC +G C+    + Y C+C   W G  C+++   C QNSC NGG C   +    RCIC  G+KG+ C L +PC NS+C HA DC+  ++     DY+C+CQPG+TG+ CD+ I++CV + C+N GVC D +ND+ C C   F G++CE+N  C  +PCKN G+C E+  GY C+C +G+TG NCE+  +GC+PNPC N AYCYT++Q FYC C+   +G+ CEH RPYCG + C +  D C    S+P +              N   + +  CG YGTC++   ++   ++C C  GF G  C+  ++ C  +PC + G CI++   FECIC+ GF G  C+   D C  +PC N G C     E   DF C C   W GR C L     C  S  CLN G C S      GF+C C+  W+G+VC     + + C  K LC+N   C++VG N F C C PGF+G+ C+ + NECN  PCFN G C D +N++ C C KGF G++C++N +ECA+ PCAYGA C+DR+ D+EC CPEGR G+ C+ +     P+PP+C +  RI+D  ETW+YNCQ C C++G + CE   CG W+CL A G  D +ACK GE+C+      +  CFV PC  +  C+         I      S+PG S   C+PN+   +N CA+I L F+K+ +P  +T+ DIC  I+ L  IQ + N     R++G+SCDI     +E  STI  + + +    + +D  +    F H L+  I+  + +    N T                                         G+++I ++T+ +         LI      I+A   + +I    Y ++K  E+  +YA +T
Sbjct:  308 WGGPLCDQDLDYCGRHRPCKNGGICRNTNSTEKPFLCSCTREHTGELCEKKLAPCTWNPCHRGRCVPRGSDSYKCKCDPGWRGDHCEENIDYCLQNSCLNGGICQDLDGVGFRCICPPGFKGANCQLRSPCSNSRCVHARDCKQLLEPVNGLDYECICQPGWTGQLCDENIDDCV-DKCQNGGVCHDLLNDFYCTCPVGFAGRHCEINQECATKPCKNNGICHEIPGGYRCECPSGFTGHNCEVVLSGCNPNPCQNAAYCYTVSQGFYCKCSPNHYGQFCEHERPYCGPDGCTAYLDPCFSGMSVPVLEDTMNGLNRTDLVANEMSLPYGVCGPYGTCVNGGPNDPTGYMCVCSSGFHGKRCQELVNHCDGDPCMHSGTCINTAEGFECICEEGFAGAQCQIALDLCQPNPCQNGGYC--QHTEHPGDFQCRCAPGWSGRWCQLRTDDPCAVSKICLNNGLCHSDPLQAGGFRCDCDPTWMGSVCHLRQPNSRACANKTLCQNGATCVDVG-NSFNCICPPGFDGRFCENDINECNSMPCFNNGTCRDLVNAFECDCPKGFIGTDCRINVNECATNPCAYGATCIDRVGDYECICPEGRRGRNCEDLIVYTPPKPPACNFQERIYDHNETWTYNCQICQCNKGHIICEDDFCGYWSCLHAVGQSDRFACKEGEVCHVLSSGMEGECFVAPCYLRTVCLNASRPIAMQIRELLPDSFPGPSIPGCRPNAAHLNNQCARIRLQFSKERMPYSVTVGDICTAIRQLPSIQRERNRIKSDRAIGLSCDITAGYTDEAKSTI-EITLSATDGQLRVDSNERELSFVHELAINISHEIAEKTSTNMTLEKPIDLNVGKHASDRTMPLPPITVLLGTPYLNKYWHRVLLGVIEIKVYTMAVKEKDLGSPILIPLACSLILATAFMCIIFICLYAQRKQRELLMRYAPTT 1244          

HSP 2 Score: 228.409 bits (581), Expect = 0.000e+0
Identity = 109/268 (40.67%), Postives = 154/268 (57.46%), Query Frame = 3
Query:   57 SQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSM-----------WNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            + FS+K+ ++     +R++GKCCG         C  PC   F ICLE +  +VS  DP PY+G C YGK  T  WG+S + +  +    +   I   WP S ++I+E YD        K +IDR V++  L+P+ N              W+ V  +   S Y F + L+C+PD+Y   C + C  NG HY CD NG+KVC+ GW G++C+  +C+ GCH +HG C  PG+C C  GWQG +CDEC+KYPGCKHGTC D+P+TC C +
Sbjct:   42 ATFSVKLLEFQNRGRRRMNGKCCGKSQEESSQ-CQSPCSLEFLICLEPFGIAVSLTDPKPYSGPCIYGKTGTGHWGNSDVVYGVDEAPIHYINISLPWPRSFSVILETYDLISAK--EKYLIDRAVHRGVLRPTPNGPAQRASKRPLDRDWHHVTTTTQFSSYVFRIRLVCQPDHYNNTCTKICTKNGTHYTCDANGDKVCEPGWSGTECDKAVCKVGCHPVHGSCMRPGDCTCATGWQGAYCDECIKYPGCKHGTCHDAPFTCRCLL 306          

HSP 3 Score: 177.178 bits (448), Expect = 6.064e-41
Identity = 149/521 (28.60%), Postives = 218/521 (41.84%), Query Frame = 2
Query: 1283 LCQPGYTGKYCDKEI-----------------------------NECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNC--ELNIACQNQPCKNGGVCQEVDTG---YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESA-----YDACSMPQMLNSSGIKHNYCGKYGTCLS----HEKE-----------KFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ-------------------------FLHIDFQPCRRKNLCKNE-----------GVCINVGYND---FTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAIC--VDRIDDFECRCPEGRDGKLC 2560
            +C+PG++G  CDK +                             +EC+  P   +G C D+   + C C   + G  C  +L+   +++PCKNGG+C+  ++    + C C   +TG  CE     C+ NPC  G      +  + C C+  + G  CE +  YC   SC +       D     + +   G K   C     C +    H ++            + C C PG+ G  C+ +IDDC  + C+NGG+C D +N+F C C  GF G+ CE   + C   PC N G+C     E+   + CEC + + G  C +   S C+ NPC N   C  +S   GF C C+    G  C+                          L        R +L  NE           G C+N G ND   + C C  GF GK C    N C+ +PC + G CI+    + CIC +GF G+ CQ+  D C   PC  G  C   +   DF+CRC  G  G+ C
Sbjct:  238 VCEPGWSGTECDKAVCKVGCHPVHGSCMRPGDCTCATGWQGAYCDECIKYPGCKHGTCHDA--PFTCRCLLKWGGPLCDQDLDYCGRHRPCKNGGICRNTNSTEKPFLCSCTREHTGELCEKKLAPCTWNPCHRGRCVPRGSDSYKCKCDPGWRGDHCEENIDYCLQNSCLNGGICQDLDGVGF-RCICPPGFKGANCQLRSPCSNSRCVHARDCKQLLEPVNGLDYECICQPGWTGQLCDENIDDC-VDKCQNGGVCHDLLNDFYCTCPVGFAGRHCEINQE-CATKPCKNNGIC----HEIPGGYRCECPSGFTGHNCEV-VLSGCNPNPCQNAAYCYTVS--QGFYCKCSPNHYGQFCEHERPYCGPDGCTAYLDPCFSGMSVPVLEDTMNGLNRTDLVANEMSLPYGVCGPYGTCVNGGPNDPTGYMCVCSSGFHGKRCQELVNHCDGDPCMHSGTCINTAEGFECICEEGFAGAQCQIALDLCQPNPCQNGGYCQHTEHPGDFQCRCAPGWSGRWC 746          

HSP 4 Score: 108.227 bits (269), Expect = 1.010e-19
Identity = 86/259 (33.20%), Postives = 125/259 (48.26%), Query Frame = 2
Query: 1805 CRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIK-SPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLN-----SYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            C C  G++G  C    D+C   P    G C D+   F C C   + G  C++  DYC +  PC N G+C R+++     F+C C     G LC   K + C  NPC  G    R S  + ++C C+ GW G  C+  +ID+     +N C N G+C ++    F C C PGF+G +C + +  C+ + C +   C   L       Y CIC  G+ G  C  N D+C    C  G +C D ++DF C CP G  G+ C+
Sbjct:  270 CTCATGWQGAYC----DECIKYPGCKHGTCHDA--PFTCRCLLKWGGPLCDQDLDYCGRHRPCKNGGIC-RNTNSTEKPFLCSCTREHTGELCE-KKLAPCTWNPCHRGRCVPRGS--DSYKCKCDPGWRGDHCE-ENIDYC---LQNSCLNGGICQDLDGVGFRCICPPGFKGANCQLRS-PCSNSRCVHARDCKQLLEPVNGLDYECICQPGWTGQLCDENIDDCVD-KCQNGGVCHDLLNDFYCTCPVGFAGRHCE 512          
BLAST of Delta-like protein vs. TrEMBL
Match: A0A068WBH6 (Delta-like protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000744300 PE=4 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 370/933 (39.66%), Postives = 498/933 (53.38%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCM-KSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDC-QIQSTALGDYK--CLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQ-DFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACS----------MPQM---LNSSGIKHNYCGKYGTCLSHE-KEKFICRCMPGFEGDSCEIDIDDCKT--NPCKNGGICID-SINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPK-HSICD-SNPCLNGGSC--SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCY--SFPFNPKRCFVPPCVPKARCIKEYSIYPNNQIS----WPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCI-QDLNGTPRGRSLGISCDIN------ENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNN------------------------NTFFTGLVDITIHTLLLNSDSFDRATLIKYLL-VPIIAFGVL-VLIGAYWYHRKKMVEIREKYANST 3424
            NWGG FCDQ L+YC  + PC NGGIC+N     QP+ CICP G+ G  CE  + PC  NPCK+G C   S G F C C   W G+LCDQ+   C+QN C NGG+C   +    RC C +G++GS C L +PC +SQC HA  C Q+ + + G  K  CLC PG+TG+ CD+ I++CV + C N G C D I DY C C   F G+NCE+N  C + PCKN GVC EV+ G+ C C  G TGT CE  + GC PNPC N A CY ++  D+YC CN+ F+G+RCEH RPYCG E C S  D C+          +P +     SS I    CG++G CL      ++ C C  G+ G  C+   D+C    + C+NG  C++   + F C+C  GF G  CE     C   PC N   C +        F C C   W GR CHLP   S C  S PC NGG C    LS+ +GF C C  GW G  CQ   +++Q C   N C+N G CINVG   + C C PGF G  C+ + +EC  NPC NGG+C D +N + CICA+GF G +C+ N DEC   PCAYGA CVDRI  +EC CPEGR G+ C+ V    +P+PPSC + +RI+D GE W+  C  C C  G + C+   CG WTCL A+  +DP+ACK GE C+  S   +P  C  PPC  +ARC+   S+   + +S        +   C+P S++  N CA++ +  ++  +P G+T++D C+ ++ L  + Q    T  G  LG+SC +        ++   + V + S  E I   E      F    +  IA  + +    N                        +T   G+ +I + T+L+  D      L+  L    ++A G L   I     HRK   E+ EKYA ST
Sbjct:  282 NWGGAFCDQDLDYCGRHKPCLNGGICKNTNITSQPFHCICPRGYRGDTCEKKLKPCELNPCKRGHCRGNSDGGFDCVCEPGWRGELCDQNIDFCEQNLCMNGGRCQDLDGLGFRCDCPRGFQGSVCQLRSPCIDSQCVHAHKCTQLATASHGGIKHDCLCLPGWTGELCDQNIDDCV-DKCLNGGTCHDLIGDYYCTCPEGFSGRNCEVNRKCASNPCKNEGVCVEVEGGFQCVCPEGVTGTLCEFARRGCDPNPCENQAPCYNLSPYDYYCKCNEGFYGRRCEHRRPYCGPEGCSSLLDPCADTKSSLQVPLLPAVTFNAQSSAIPTESCGEHGICLHDPVTSQYSCVCENGYTGRFCQQLKDNCAEMGHLCRNGATCVNGEADAFYCLCTEGFTGTFCERELQPCDSEPCRNGAYCQQMEVTGDVSFQCRCTPGWSGRWCHLPMPRSPCQVSQPCHNGGVCLDDALSS-HGFFCQCPAGWTGLFCQTRSLEYQACENGNFCRNGGTCINVGEGIY-CLCPPGFAGGRCEEDIDECRNNPCQNGGECRDLVNGFECICAEGFMGVDCRHNIDECVDHPCAYGARCVDRIGTYECICPEGRSGRHCEEVIAPIAPKPPSCRFNHRIYDHGEKWASYCATCECVEGNIVCKREFCGYWTCLTASRENDPFACKEGEECHLLSTAPSPPLCLTPPCYARARCVNA-SLAEISAVSPTPPGLPPALPGCRPASVRLTNQCARLAVVVSRSRLPYGVTVEDFCNAVRALPAVEQTRAATNEGGLLGMSCGLAGRQLDYPSDLAYIEVTLSSTDERIRKAEDGREFVFVQRFAHSIATAIRENASTNITTQFHHLPSFALMVGAESQDHYWHTILHGVAEINVETVLVKDDEIPHNPLLVPLACCLVVAVGALCTCIICVCAHRKHQ-ELIEKYAAST 1209          

HSP 2 Score: 150.984 bits (380), Expect = 0.000e+0
Identity = 68/180 (37.78%), Postives = 101/180 (56.11%), Query Frame = 3
Query:  285 DSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKA-VIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSC 821
            D   K  KES       I   WP   T+I+E +D           ++DR +++N L P+     W  +V+ +  S Y+ SM L C P ++G  C   C+   G + CD +G ++C+ GW G +C+  +C+ GCH  HG C++P EC C  GW+G  CDEC+ YPGC+HGTC ++P+TC C
Sbjct:  101 DMVKKSGKESYLWKSLNILDRWPTLYTMILEVFDAKPDGVSTSTYLVDRTLHRNILLPT-TPPQWQSIVVESTSSTYRLSMRLACTPHHFGLKCAVECQPKAGRFTCDRHGNRICEKGWSGENCDRPMCRKGCHPTHGICKSPNECVCVNGWKGELCDECITYPGCQHGTCDNAPFTCHC 279          

HSP 3 Score: 149.828 bits (377), Expect = 1.484e-32
Identity = 147/554 (26.53%), Postives = 233/554 (42.06%), Query Frame = 2
Query: 1229 KHALDCQIQSTALGDYKC------LCQPGYTGKYCDKEI-----------------------------NECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNC--ELNIACQNQPCKNGGVCQEVDTG---YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD---------ACSMPQM------------LNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQF-----------------------LHIDFQPCRRKNL---------CKNEGVCI-NVGYNDFTCHCKPGFEGKHCDINTNECNP--NPCFNGGKCID-KLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAIC----VDRIDDFECRCPEGRDGKLCDHVKNNESP 2587
            K A++CQ ++   G + C      +C+ G++G+ CD+ +                             +EC+  P   +G C ++   + C+C  ++ G  C  +L+   +++PC NGG+C+  +     + C C  GY G  CE     C  NPC  G      +  F C C   + G+ C+ +  +C    C +             C  P+             ++S  +  + C +  T  SH   K  C C+PG+ G+ C+ +IDDC  + C NGG C D I ++ C C  GF G+ CE     C  +PC N GVC+    E+   F C C     G LC   +   CD NPC N   C  LS  + + C CN+G+ G  C+                        L +   P    N          C   G+C+ +   + ++C C+ G+ G+ C    + C    + C NG  C++ + +++ C+C +GF G+ C+     C S PC  GA C    V     F+CRC  G  G+ C H+    SP
Sbjct:  192 KCAVECQPKA---GRFTCDRHGNRICEKGWSGENCDRPMCRKGCHPTHGICKSPNECVCVNGWKGELCDECITYPGCQHGTCDNA--PFTCHCLPNWGGAFCDQDLDYCGRHKPCLNGGICKNTNITSQPFHCICPRGYRGDTCEKKLKPCELNPCKRGHCRGNSDGGFDCVCEPGWRGELCDQNIDFCEQNLCMNGGRCQDLDGLGFRCDCPRGFQGSVCQLRSPCIDSQCVHAHKCTQLAT-ASHGGIKHDCLCLPGWTGELCDQNIDDC-VDKCLNGGTCHDLIGDYYCTCPEGFSGRNCEVNRK-CASNPCKNEGVCV----EVEGGFQCVCPEGVTGTLCEFARRG-CDPNPCENQAPCYNLSPYD-YYCKCNEGFYGRRCEHRRPYCGPEGCSSLLDPCADTKSSLQVPLLPAVTFNAQSSAIPTESCGEHGICLHDPVTSQYSCVCENGYTGRFCQQLKDNCAEMGHLCRNGATCVNGEADAFYCLCTEGFTGTFCERELQPCDSEPCRNGAYCQQMEVTGDVSFQCRCTPGWSGRWC-HLPMPRSP 730          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: jag2b (protein jagged-2 [Source:NCBI gene;Acc:103029720])

HSP 1 Score: 461.455 bits (1186), Expect = 1.756e-172
Identity = 315/920 (34.24%), Postives = 446/920 (48.48%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI--YKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSS--GIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYER 3544
            NWGG  CD+ LNYC  ++PC NGG C N  SE   Y C CP G+ G++CEI    C  NPC  G TC +    F C C   W G  C +D   C  + C  GG C   ENG   C+C   + G  C +    C    C +A  C+     +G Y C C  G+ G+ CD  +N C    C+N   C +     Y C C+  F G +CE+    C + PC+N G C  +   + C+C  GY GT CEI  +   C PNPC N A C+++  DFYC C +++ GK C   + +C    C+   D+C++    NS+  G++H   N CG +G C+S     F C C PGF G  C  +++DC ++PC+NGG CID IN+F+C C +G+ G  C    + C ++PC N G C+    +  NDF CEC N W G+ CH  + S CD++ C NGG+C      + F+C C  GW G+ C             + C N G C+  G + FTC CK G+EG  C  N N+CNP+PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ F C CP GR G  C            SC Y    F  G  W  +C  C C  GKV C  V CG   C L      +  AC  G  C    F    C  PPC     C     + P N           C+PN+    N CA I L FN++ +PI   ++++C  ++ L   ++L    +   L + C+++ +N   V VAI     +   DE  +        S +++       ++N+T    ++++ + T L+         L+  L V   A  +  +I   W+ RK+  E   +     +             V +Q+  +RP  + +H       YER
Sbjct:  290 NWGGLLCDKDLNYCGTHHPCVNGGTCIN--SEPNEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPSGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENG-FECLCPPQWAGKTCKIDVNECVGKPCVNAYSCK---NLIGGYHCDCFQGWAGQNCDINMNGC-HGQCQNGATCKEGARGGYHCQCAPGFTGTHCEIQRNKCASSPCQNAGQCHVLLDSFVCECLPGYIGTLCEIPSHSNPCEPNPCKNEASCHSLLGDFYCACPEDYEGKTCADRKDHCRTAPCQ-VIDSCTIAVASNSTDGGVRHISSNVCGPHGRCVSQPTGNFTCTCDPGFTGTYCHENVNDCVSSPCRNGGTCIDGINSFQCFCPDGWEGDLCGLNVNECSRNPCKNGGRCV----DQVNDFYCECANGWKGKTCH-SRESQCDASTCSNGGTC--YDHGDTFRCACPSGWGGSTCNTAK---NSTCASSPCVNGGTCVG-GGDTFTCICKDGWEGPTCAQNINDCNPHPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCICPLGRSGPRCQEFIGIGK----SCHYTGLQFPHGSRWEEDCNACQCVNGKVECTKVVCGRRPCLLPGTPGRERAACPGGRECLEHNF--LTCLSPPCHQWGFCSSPEPVPPVN---------SKCEPNTGYLDNSCAHITLVFNREKLPIATAVENVCSELRYLPATRNL---AKEDPLLVLCELSYSNQDAVEVAI-----SFQQDEQPDHSRIQEAASTIVS---TLSKRHNSTIMQAVIEVRVETRLVPQPV---DYLVPVLCVIFCALWIFCVIVCVWWTRKRRKERERRERAPVE-----------ESVNNQWEPLRPVARQQHKDNRDAEYER 1150          

HSP 2 Score: 166.777 bits (421), Expect = 1.756e-172
Identity = 96/281 (34.16%), Postives = 139/281 (49.47%), Query Frame = 3
Query:   21 FLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFT--------IKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
             L I+     S   F L++      + +  DG+CC    S     CT   C   F +CL+ Y + V+       TG C +G   T + G +   F    +   K +         + +WP S TLI+EA+D  + T    + +IDR  +   + P      W  +      + +++ + + C  +YYG  C++ C+      GHY+CD +G  VC  GWMG DC   IC+ GC+ IHG C  PGEC C  GWQG FCDEC+ YPGC HGTC ++PW C+CE
Sbjct:   18 LLTIWTEVGHSSGYFELQLMSVENVNGELWDGECCDGARSSQDQRCTRDECDTYFKVCLKEYQSEVT------TTGQCNFGTGSTGVLGGNIFSFKNSKSSPVKISEAGKITIPFQFAWPRSYTLILEAWDWDNTTQNSEELLIDRHAHTGMVNPG---DHWQVIAHPGATARFEYRIRVKCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLEGWMGHDCRTAICKQGCNLIHGGCSVPGECTCNYGWQGQFCDECLPYPGCVHGTC-ENPWQCTCE 288          

HSP 3 Score: 246.514 bits (628), Expect = 3.476e-66
Identity = 190/585 (32.48%), Postives = 263/585 (44.96%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDS-INDYKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSI-NNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS-ICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQN----CACDRGK-VTCESVPC 2704
            C+E W G  C   T+IC Q      G C         C C  G++G  C    P             +  T    ++C C+  + G  CDK++N C   +PC N G C +S  N+Y C C   + GKNCE+   AC + PC NGG C EV +G+ C C  G+ G  C      C+ +PC  G  C  +   F C C  ++ GK C+     C  + C +AY                N  G Y            C C  G+ G +C+I+++ C    C+NG  C +     + C C  GF G  CE + + C  SPC N G C      L + F+CEC   + G LC +P HS  C+ NPC N  SC  L  L  F C C + + G  C  +  H    PC+                       N+C   G C++    +FTC C PGF G +C  N N+C  +PC NGG CID +NS++C C  G+ G  C LN +EC+  PC  G  CVD+++DF C C  G  GK C H + ++     +C      +D G+T+   C +      C+  K  TC S PC
Sbjct:  223 CLEGWMGHDCR--TAICKQGCNLIHGGCSVP----GECTCNYGWQGQFCDECLPYPGC---------VHGTCENPWQCTCEKNWGGLLCDKDLNYCGTHHPCVNGGTCINSEPNEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPSGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENGFECLCPPQWAGKTCKIDVNECVGKPCVNAYSC-------------KNLIGGYH-----------CDCFQGWAGQNCDINMNGCHGQ-CQNGATCKEGARGGYHCQCAPGFTGTHCEIQRNKCASSPCQNAGQC----HVLLDSFVCECLPGYIGTLCEIPSHSNPCEPNPCKNEASCHSL--LGDFYCACPEDYEGKTCADRKDHCRTAPCQVIDSCTIAVASNSTDGGVRHISSNVCGPHGRCVSQPTGNFTCTCDPGFTGTYCHENVNDCVSSPCRNGGTCIDGINSFQCFCPDGWEGDLCGLNVNECSRNPCKNGGRCVDQVNDFYCECANGWKGKTC-HSRESQC-DASTCSNGGTCYDHGDTFRCACPSGWGGSTCNTAKNSTCASSPC 759          

HSP 4 Score: 87.0409 bits (214), Expect = 1.013e-16
Identity = 69/219 (31.51%), Postives = 95/219 (43.38%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCD-QDTSICDQNSCQNGGQC--GKDENGNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA 1444
            + W G  C  ++N C+  NPCKNGG C   + +V  + C C +G++G+ C      C  + C   GTC      F C C   W G  C+    S C  + C NGG C  G D      CIC+ G++G  C          PC N          I    +  ++C C PG+ G  C   I+EC  +PC     C D IN ++C C     G  C+  I 
Sbjct:  663 DGWEGDLCGLNVNECSR-NPCKNGGRC---VDQVNDFYCECANGWKGKTCHSRESQCDASTCSNGGTCYDHGDTFRCACPSGWGGSTCNTAKNSTCASSPCVNGGTCVGGGD---TFTCICKDGWEGPTCAQNINDCNPHPCYNG--------GICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCICPLGRSGPRCQEFIG 866          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: JAG1 (protein jagged-1a [Source:NCBI gene;Acc:103036342])

HSP 1 Score: 463.381 bits (1191), Expect = 2.093e-166
Identity = 315/917 (34.35%), Postives = 458/917 (49.95%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERN 3547
            NWGGQ CD+ LN C    PC N G C N   +   Y C CP G+ G++CE   + C   PC   G+C++S   F C+C   WTG  C  +   C  N C + G C    NG  RC+C   + G  C + A  C+ + C +A  C+     +G Y C C PG+TG+ CD  +N+C    C N G C D +N YKC C+  F G++CE +I  C + PC N G CQ+   G+ C C  G++G  C++    C  NPC NGA C+ +  D+YC C  ++ GK C H + +C    C+   D+C++  + NSS      I  N CG +G C SH    F C C  GF G  C  +I+DC+++PC NGG CID +N ++CIC +G+ G  CE   D C  +PC + GVC     +L NDF CECKN W G+ CH  + S CD   C NGG+CS     N F+C C  GW GT C   +I        + C+N G C+ V  + FTC CK G+EG  C  N+N+CNP+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ C+D I+ + C CP GR G  C  V          C+   R+   G  W  +C +C C  G+ +C  + CG  +C    G      C  G+ C   P   +RCFV PC  +  C         NQ          C P S      CA +  TF K ++P G+T++ +C  +++L  +++L+       + I+C+ +  +S  ++V I S       D+   S      ++  I   L+     N T  T + ++ +     NS   D    +   +V +I    LV +   W  R++    R++ A++T   + +  +       +     R     +HL +  N  E+N
Sbjct:  291 NWGGQLCDKDLNTCGTRQPCLNEGTCSNTGPD--KYHCACPEGYSGQNCERADNACLSEPCFNGGSCVESSQGFECRCSPGWTGPSCTINEDDCSPNPCNHAGTCVDLING-FRCLCPSQWSGKTCLIDANECDENPCVNAHSCR---NLIGGYFCECLPGWTGQNCDINVNDC-QGQCLNGGSCKDLVNGYKCVCAPGFAGEHCERDIDECASHPCLNRGRCQDDVNGFQCLCLPGFSGNLCQLDIDYCVGNPCQNGAQCFNLANDYYCKCPDDYEGKNCSHLKDHCRTTPCQ-VIDSCTVAVVSNSSAGSVRFISSNVCGPHGRCRSHAGGHFSCECDEGFTGTYCHENINDCESSPCGNGGTCIDKVNVYQCICADGWEGPNCETNIDDCSTNPCRDRGVCR----DLVNDFYCECKNGWKGKTCH-SRESQCDEATCNNGGTCSDEG--NSFKCMCTPGWEGTTC---NIAKNSSCLPSPCENGGTCV-VSGDGFTCVCKEGWEGLTCSQNSNDCNPHPCYNSGTCVDGDNWYRCECAAGFAGPDCRININECQSSPCAFGSTCIDEINGYRCLCPPGRTGARCQEVTGR------PCMVGGRMVADGSRWEEDCNSCYCQNGRTSCTKLWCGPRSCQVVGGGRGD--CPAGQSC--VPLREERCFVKPCPVQGECRSGQRSPVRNQ----------CHPES-----NCANVTFTFIKDSMPQGVTVEQVCRELRSLSVVKNLSSE---FFISITCEPSTTSSNEIHVTIVS-------DDGVGSDAVVKEITDWIVD-LVSKRSANGTILTAIAEVRVQR-RQNSSQNDYLVPVLVSVVTVIWVMALVSV-LLWCVRRR----RKQNASATATGHASQSTPASAEENNAVNNAR-----EHLNQIKNHIEKN 1141          

HSP 2 Score: 144.436 bits (363), Expect = 2.093e-166
Identity = 89/271 (32.84%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMK---FNKESTHSYKFTIKSSWPGSITLIIEAYD---TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFS--MNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +  QF L++        +   G CC          CT   C     +CL+ Y + VS   P      C++G   T + G +++       ES          +WP S TLI+EA D    S T      +I++ V    + P+ +   W   +L ++  V QF+  + + C   YYG  C+++C+      GHY CD NG K C  GW   +CN  +C+ GC   HG C+ PG+C+C  GWQG FCD+C+ +PGC HGTCV+ PW C C+ 
Sbjct:   32 ASGQFELQLLSVQNPRGELQSGVCCDGSRDPATEECTRDECDTYVRVCLKEYQSRVSVGGP------CSFGSGSTPVLGGNTVAREVLVGESRARVVLPFSFAWPRSYTLILEAMDFNNDSSTGSTSGQLIEKAVQSGMINPNRH---WQ--ILRHNGPVAQFTYQIRVSCDEHYYGVGCNKFCRPRDDFFGHYTCDHNGNKTCMEGWASPECNTAMCRQGCSAEHGSCKVPGDCKCLYGWQGEFCDQCIPHPGCVHGTCVE-PWQCLCDT 290          

HSP 3 Score: 256.529 bits (654), Expect = 2.041e-69
Identity = 178/517 (34.43%), Postives = 252/517 (48.74%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAA-----PCENSQCKHALDCQ-------------------IQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD----------ACSMPQMLNSSGIKHNYCGKYGTCLSHEKEK-----FICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            D NGN+ C+  +G+   EC+ A        E+  CK   DC+                   +  T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y C C   + G+NCE  + AC ++PC NGG C E   G+ C+C  G+TG +C I +  CSPNPC +   C  +   F C C  ++ GK C      C    C +A+            C       +  I  N C   G CL+    K     + C C PGF G+ CE DID+C ++PC N G C D +N F+C+C  GF G  C+   DYC+ +PC N   C      L ND+ C+C +++ G+ C HL  H  C + PC    SC+     N           G+V +F+          N+C   G C +     F+C C  GF G +C  N N+C  +PC NGG CIDK+N Y+CICA G+ G NC+ N D+C++ PC    +C D ++DF C C  G  GK C
Sbjct:  217 DHNGNKTCM--EGWASPECNTAMCRQGCSAEHGSCKVPGDCKCLYGWQGEFCDQCIPHPGCVHGTCVEPWQCLCDTNWGGQLCDKDLNTCGTRQPCLNEGTCSNTGPDKYHCACPEGYSGQNCERADNACLSEPCFNGGSCVESSQGFECRCSPGWTGPSCTINEDDCSPNPCNHAGTCVDLINGFRCLCPSQWSGKTCLIDANECDENPCVNAHSCRNLIGGYFCECLPGWTGQNCDINVNDC--QGQCLNGGSCKDLVNGYKCVCAPGFAGEHCERDIDECASHPCLNRGRCQDDVNGFQCLCLPGFSGNLCQLDIDYCVGNPCQNGAQCF----NLANDYYCKCPDDYEGKNCSHLKDH--CRTTPCQVIDSCTVAVVSNSS--------AGSV-RFI--------SSNVCGPHGRCRSHAGGHFSCECDEGFTGTYCHENINDCESSPCGNGGTCIDKVNVYQCICADGWEGPNCETNIDDCSTNPCRDRGVCRDLVNDFYCECKNGWKGKTC 706          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:103034980])

HSP 1 Score: 458.373 bits (1178), Expect = 7.796e-166
Identity = 297/869 (34.18%), Postives = 439/869 (50.52%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVI---KNNNTFFTGLVDITIHTLLLNSDSFDRATLIK--YLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGGQ CD+ LNYC    PC NGG C N   +   Y+C C  G+ G +CE     C  +PC  G +C +S   + C C   WTG  C  +   C  N C +GG C    NG  +C C   + G  C + A  C +  C +A  C+     +G Y C C PG+ G+ CD  IN+C    C N G C D +N Y+C CS  F G++CE +I  C + PC NGG C++   G+ C C  G++G  C++    C P+PC N A C+ +  D+YC C  ++ GK C H + +C   SC+   D+C++    NS+      I  N CG +G+C S    +F C C  GF G  C  +I+DC+ NPC+NGG CID +N ++CIC +G+ G  CE  TD C   PC+N G C     +L NDF CEC+N W G+ CH  + S CD   C NGG+C      + F+C C  GW G  C   +I        N C+N G C+ V  + FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA G+ C+D I+ + C C  GR G  C      E+   P      ++   GE W  +C  C C  G + C  + CG   C    G      C+ G+ C   P   + CFV PC     C       PN++          C  +     N CA I  TF+K+ +P G++I+ +C+ ++ +  +++L+      ++ I+C+ + + S  ++V+I +    +    +K            I   +ID++     N++  T +  + +  +   S +     L+   ++L+ I+A    +L    W  R++
Sbjct:  289 NWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPD--KYQCSCADGYSGSNCERAERACLSSPCANGGSCSESSEGYECLCAAGWTGTSCSINVDDCFSNPCSHGGTCQDLVNG-FKCSCPPQWIGKTCLIDANECNDKPCVYAKSCR---NLIGGYFCECLPGWEGQNCDININDC-HGQCLNGGSCRDLVNGYRCVCSAGFVGEHCEKDIDECASSPCLNGGRCEDEVNGFQCLCPAGFSGQFCQLDIDYCRPSPCQNAAPCFNLASDYYCQCPDDYEGKNCSHLKDHCRTTSCQ-VIDSCTVAVASNSTPEGVRLISSNVCGPHGSCRSQAGGQFTCECQEGFRGTYCHENINDCERNPCRNGGTCIDKVNEYQCICADGWEGSHCETNTDDCSLKPCLNKGTC----QDLVNDFYCECRNGWKGKTCH-SRESQCDEATCNNGGTCHDEG--DTFKCRCAPGWEGATC---NIAKNSSCLPNPCENGGTCV-VSADSFTCVCKEGWEGATCSQNTNDCSPHPCYNSGTCVDGDNWYRCECAAGFAGPDCRININECQSSPCAVGSTCIDEINGYRCICAPGRTGPQC-----QETTGRPCISEGGQVSTDGEKWEEDCNTCQCRHGNIHCTRMWCGPKACRVGKGRG---GCQLGQSC--IPIKEEYCFVKPCPGLGECWPSTPPPPNSK----------CHHSFPYQQNSCANITFTFSKETLPPGLSIEHVCNELRRVYVVKNLSSE---YAVSITCNPSSSASNEIHVSISTEEPTLDRSPIKE-----------ITDRIIDLVSKRSGNSSIITAVTGVRLQQIQNPSKTDYLVPLLSSIFILLWIVALATSLL----WCIRRR 1100          

HSP 2 Score: 147.902 bits (372), Expect = 7.796e-166
Identity = 88/272 (32.35%), Postives = 138/272 (50.74%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGD-HGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTI----KSSWPGSITLIIEAYD----TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +   F L+I            G CCG   G   + +C    C   F +CL+ Y + V+   P      C++G   T + G ++    + S+ S K  I      +WP S TLI+EA D    T+  +     +I++  +   + P+++   W  +  +   + +++ + + C+  YYG  C+++C+      GHY CD NG K C  GW G +CN  IC+ GC   HG C+ PG+C C  GWQG +CD+C+ +PGC HGTCV+ PW C C+I
Sbjct:   28 ASGHFELEILSMHNARGALQSGSCCGGARGGRTERSCAPDQCDTYFRVCLKEYQSRVAAAGP------CSFGTGSTPVLGGNTFS-TRGSSASDKARIVLRFSFAWPRSYTLILEALDLHNETAGDSLSSGRLIEKAYHSGMINPNHS---WQKLSHNGPVAQFEYQIRVTCEEHYYGFSCNKFCRPRDEFFGHYTCDQNGNKTCLEGWTGPECNTAICRQGCSVEHGSCKLPGDCNCLYGWQGLYCDKCIPHPGCVHGTCVE-PWQCLCDI 288          

HSP 3 Score: 259.225 bits (661), Expect = 2.797e-70
Identity = 185/530 (34.91%), Postives = 250/530 (47.17%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C+E WTG  C+  T+IC Q      G C    +    C C  G++G  C    P  +  C H        T +  ++CLC   + G+ CDK++N C    PC N G C+++  D Y+C+C+  + G NCE    AC + PC NGG C E   GY C C  G+TGT+C I    C  NPC +G  C  +   F C C  ++ GK C      C ++ C  A                 N  G Y            C C+PG+EG +C+I+I+DC    C NGG C D +N + C+C  GF G+ CE+  D C  SPC+N G C    DE+ N F C C   + G+ C L     C  +PC N   C  L++   + C C   + G  C  L  H     C+                       N+C   G C +     FTC C+ GF G +C  N N+C  NPC NGG CIDK+N Y+CICA G+ GS+C+ N D+C+  PC     C D ++DF C C  G  GK C
Sbjct:  222 CLEGWTGPECN--TAICRQGCSVEHGSCKLPGD----CNCLYGWQGLYCDKCIP--HPGCVHG-------TCVEPWQCLCDINWGGQLCDKDLNYCGTYQPCLNGGTCSNTGPDKYQCSCADGYSGSNCERAERACLSSPCANGGSCSESSEGYECLCAAGWTGTSCSINVDDCFSNPCSHGGTCQDLVNGFKCSCPPQWIGKTCLIDANECNDKPCVYAKSC-------------RNLIGGY-----------FCECLPGWEGQNCDININDCHGQ-CLNGGSCRDLVNGYRCVCSAGFVGEHCEKDIDECASSPCLNGGRC---EDEV-NGFQCLCPAGFSGQFCQL-DIDYCRPSPCQNAAPCFNLAS--DYYCQCPDDYEGKNCSHLKDHCRTTSCQVIDSCTVAVASNSTPEGVRLISSNVCGPHGSCRSQAGGQFTCECQEGFRGTYCHENINDCERNPCRNGGTCIDKVNEYQCICADGWEGSHCETNTDDCSLKPCLNKGTCQDLVNDFYCECRNGWKGKTC 704          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: jag2b (protein jagged-2 [Source:NCBI gene;Acc:103029720])

HSP 1 Score: 424.861 bits (1091), Expect = 1.681e-161
Identity = 298/918 (32.46%), Postives = 423/918 (46.08%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL---NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSS--GIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTC-LQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYER 3544
            NWGG  CD+ LNYC  ++PC NGG C N  SE   Y C CP G+ G++CEI    C  NPC   GTC +    F C C   W G  C +D   C  + C  GG C   ENG   C+C   + G  C +     + QC++   C  +  A G Y C C PG+TG +C+ + N+C  +PC+N G C   ++ + C C   + G  CE+   +  C+  PCKN   C  +   + C C   Y G  C   K  C   PC                                          D+C++    NS+  G++H   N CG +G C+S     F C C PGF G  C  +++DC ++PC+NGG CID IN+F+C C +G+ G  C    + C ++PC N G C+    +  NDF CEC N W G+ CH  + S CD++ C NGG+C      + F+C C  GW G+ C             + C N G C+  G + FTC CK G+EG  C  N N+CNP+PC+NGG C+D +N +RC CA GF G +C++N DEC S PCAYGA CVD I+ F C CP GR G  C            SC Y    F  G  W  +C  C C  GKV C  V CG   C L      +  AC  G  C    F    C  PPC     C     + P N           C+PN+    N CA I L FN++ +PI   ++++C  ++ L   ++L    +   L + C+++ +N   V VAI     +   DE  +        S +++       ++N+T    ++++ + T L+         L+  L V   A  +  +I   W+ RK+  E   +     +             V +Q+  +RP  + +H       YER
Sbjct:  290 NWGGLLCDKDLNYCGTHHPCVNGGTCIN--SEPNEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPSGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENG-FECLCPPQWAGKTCKIDMNGCHGQCQNGATC--KEGARGGYHCQCAPGFTGTHCEIQRNKCASSPCQNAGQCHVLLDSFVCECLPGYIGTLCEIPSHSNPCEPNPCKNEASCHSLLGDFYCACPEDYEGKTCADRKDHCRTAPC---------------------------------------QVIDSCTIAVASNSTDGGVRHISSNVCGPHGRCVSQPTGNFTCTCDPGFTGTYCHENVNDCVSSPCRNGGTCIDGINSFQCFCPDGWEGDLCGLNVNECSRNPCKNGGRCV----DQVNDFYCECANGWKGKTCH-SRESQCDASTCSNGGTC--YDHGDTFRCACPSGWGGSTCNTAK---NSTCASSPCVNGGTCVG-GGDTFTCICKDGWEGPTCAQNINDCNPHPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCICPLGRSGPRCQEFIGIGK----SCHYTGLQFPHGSRWEEDCNACQCVNGKVECTKVVCGRRPCLLPGTPGRERAACPGGRECLEHNF--LTCLSPPCHQWGFCSSPEPVPPVN---------SKCEPNTGYLDNSCAHITLVFNREKLPIATAVENVCSELRYLPATRNL---AKEDPLLVLCELSYSNQDAVEVAI-----SFQQDEQPDHSRIQEAASTIVS---TLSKRHNSTIMQAVIEVRVETRLVPQPV---DYLVPVLCVIFCALWIFCVIVCVWWTRKRRKERERRERAPVE-----------ESVNNQWEPLRPVARQQHKDNRDAEYER 1112          

HSP 2 Score: 167.162 bits (422), Expect = 1.681e-161
Identity = 96/281 (34.16%), Postives = 139/281 (49.47%), Query Frame = 3
Query:   21 FLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFT--------IKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
             L I+     S   F L++      + +  DG+CC    S     CT   C   F +CL+ Y + V+       TG C +G   T + G +   F    +   K +         + +WP S TLI+EA+D  + T    + +IDR  +   + P      W  +      + +++ + + C  +YYG  C++ C+      GHY+CD +G  VC  GWMG DC   IC+ GC+ IHG C  PGEC C  GWQG FCDEC+ YPGC HGTC ++PW C+CE
Sbjct:   18 LLTIWTEVGHSSGYFELQLMSVENVNGELWDGECCDGARSSQDQRCTRDECDTYFKVCLKEYQSEVT------TTGQCNFGTGSTGVLGGNIFSFKNSKSSPVKISEAGKITIPFQFAWPRSYTLILEAWDWDNTTQNSEELLIDRHAHTGMVNPG---DHWQVIAHPGATARFEYRIRVKCDENYYGSKCNKQCRPRDDYFGHYRCDPSGNIVCLEGWMGHDCRTAICKQGCNLIHGGCSVPGECTCNYGWQGQFCDECLPYPGCVHGTC-ENPWQCTCE 288          

HSP 3 Score: 234.187 bits (596), Expect = 2.841e-62
Identity = 182/555 (32.79%), Postives = 252/555 (45.41%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNC--ELNIACQNQPCKNGGVCQEVDTG-YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSIN-NFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS-ICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQN----CACDRGK-VTCESVPC 2704
            D +GN   +C +G+ G +C  A       CK   +  I        +C C  G+ G++CD    EC+P P   +G C    N ++C C  ++ G  C  +LN    + PC NGG C   +   Y C C  GY+G NCEI +  C  NPC NG  C+ +   F CHC   + G  C      C +  C                          GTC+  E   F C C P + G +C+ID++ C    C+NG  C +     + C C  GF G  CE + + C  SPC N G C      L + F+CEC   + G LC +P HS  C+ NPC N  SC  L  L  F C C + + G  C  +  H    PC+                       N+C   G C++    +FTC C PGF G +C  N N+C  +PC NGG CID +NS++C C  G+ G  C LN +EC+  PC  G  CVD+++DF C C  G  GK C H + ++     +C      +D G+T+   C +      C+  K  TC S PC
Sbjct:  216 DPSGN--IVCLEGWMGHDCRTAI------CKQGCN-LIHGGCSVPGECTCNYGWQGQFCD----ECLPYPGCVHGTCE---NPWQCTCEKNWGGLLCDKDLNYCGTHHPCVNGGTCINSEPNEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPSGFECHCPPGWEGPTCAKDMDECASSPCAQG-----------------------GTCIDLEN-GFECLCPPQWAGKTCKIDMNGCHGQ-CQNGATCKEGARGGYHCQCAPGFTGTHCEIQRNKCASSPCQNAGQC----HVLLDSFVCECLPGYIGTLCEIPSHSNPCEPNPCKNEASCHSL--LGDFYCACPEDYEGKTCADRKDHCRTAPCQVIDSCTIAVASNSTDGGVRHISSNVCGPHGRCVSQPTGNFTCTCDPGFTGTYCHENVNDCVSSPCRNGGTCIDGINSFQCFCPDGWEGDLCGLNVNECSRNPCKNGGRCVDQVNDFYCECANGWKGKTC-HSRESQC-DASTCSNGGTCYDHGDTFRCACPSGWGGSTCNTAKNSTCASSPC 721          

HSP 4 Score: 94.3597 bits (233), Expect = 5.668e-19
Identity = 68/217 (31.34%), Postives = 89/217 (41.01%), Query Frame = 2
Query: 2012 RHSDELYNDFICE------CKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQ----------------------------FLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            R  D+ +  + C+      C   W G  C   + +IC     L  G CS        +C CN GW G  C                                 D   C   + C N G CIN   N++ C C  G+ GK+C+I  + C  NPC NGG C +  + + C C  G+ G  C  + DECAS PCA G  C+D  + FEC CP    GK C
Sbjct:  204 RPRDDYFGHYRCDPSGNIVCLEGWMGHDC---RTAICKQGCNLIHGGCSVPG-----ECTCNYGWQGQFCDECLPYPGCVHGTCENPWQCTCEKNWGGLLCDKDLNYCGTHHPCVNGGTCINSEPNEYNCACPEGYSGKNCEIAEHACVSNPCANGGTCHEVPSGFECHCPPGWEGPTCAKDMDECASSPCAQGGTCIDLENGFECLCPPQWAGKTC 412          

HSP 5 Score: 87.0409 bits (214), Expect = 9.581e-17
Identity = 69/219 (31.51%), Postives = 95/219 (43.38%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCD-QDTSICDQNSCQNGGQC--GKDENGNRRCICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA 1444
            + W G  C  ++N C+  NPCKNGG C   + +V  + C C +G++G+ C      C  + C   GTC      F C C   W G  C+    S C  + C NGG C  G D      CIC+ G++G  C          PC N          I    +  ++C C PG+ G  C   I+EC  +PC     C D IN ++C C     G  C+  I 
Sbjct:  625 DGWEGDLCGLNVNECSR-NPCKNGGRC---VDQVNDFYCECANGWKGKTCHSRESQCDASTCSNGGTCYDHGDTFRCACPSGWGGSTCNTAKNSTCASSPCVNGGTCVGGGD---TFTCICKDGWEGPTCAQNINDCNPHPCYNG--------GICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGATCVDEINGFRCICPLGRSGPRCQEFIG 828          
BLAST of Delta-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000008576.2 (pep primary_assembly:Astyanax_mexicanus-2.0:25:39197091:39270816:1 gene:ENSAMXG00000008300.2 transcript:ENSAMXT00000008576.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 438.728 bits (1127), Expect = 1.681e-151
Identity = 292/882 (33.11%), Postives = 425/882 (48.19%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSS--GIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH---IDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYA----CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENI-YIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAY-----WYHRKKMVEIR 3403
            NWGG  CDQ LNYC  + PC NGG C N  +E   Y+C+CP G+ G++CEI    C  NPC  G TC +    F C C   W+G  C +D   C    C +GG C   EN    C+C   + G  C +    C    C ++  C+     +G Y C C PG+TG+ C+  I  C    C+N G C D  + Y C C   F G++CE+  + C + PC+NGG C+    GY C+C  GYTGT C+++   C+PNPC N A C+ +  DFYC C  E+ GK C   R +C   +C    D+C++    NS+  G+ H   + CG +G C+S     F C C PGF G  C  +I+DC ++PC+NGG C+D I +F+C+C +G+ G  CE+     + S  ++        D LY                  P+ S CD   C NGG+C        + C C  GW G+ C        D QPC       N G C+  G   FTC CK G+ G  C +N ++CNP+PC+NGG C+D  N +RC CA GF G +C++N DEC S PC+YGA CVD I+ + C CP GR G  C            +C +       G  W   C  C C  G + C  V CG   C+    + +       C  G+ C   P     C  PPC+    C   +S   +           DC+PN+      CA++ L F+ K++P G T++ IC  ++ L   + L    +  +L I C+ + ++S+ V VA+ S +EN   I E+  S      +  V++K      ++N+T    + ++ +   ++        T I YL+  +     L+ I        W+ +++    R
Sbjct:  278 NWGGLMCDQDLNYCGSHRPCVNGGTCLN--TEPNKYQCVCPEGYSGKNCEIVEHACMSNPCANGGTCHEIASRFECLCPPGWSGPTCAKDKDECMSAPCAHGGTCIDLENA-FDCVCPAQWTGKTCQIDVNECVKKPCVNSYSCK---NLIGGYHCACYPGWTGQSCNINIQTCY-GQCQNGGTCKDGRHGYVCQCLPGFVGRHCEVQQSGCASAPCQNGGQCRATRAGYECQCLPGYTGTTCQVHVDPCTPNPCQNKAQCHALQGDFYCACADEYEGKTCVQLRDHCKISACR-VIDSCTIAVASNSTKEGVWHISSSVCGPHGRCISLSGANFTCACQPGFTGSYCHENINDCASSPCRNGGTCLDGIGSFKCLCPDGWEGALCEQGQSEALSSSVLH--------DLLY------------------PRESQCDPTTCANGGTCYDHGA--SYLCVCPSGWQGSTCNLATNSTCDSQPC------ANGGTCVG-GVKSFTCMCKDGWAGSDCTLNVDDCNPHPCYNGGMCVDGENWFRCQCAPGFAGPDCRINVDECQSSPCSYGASCVDEINGYRCECPPGRAGPRCQEFIGVGK----ACQHSGLPVPHGGRWEEECNTCQCVNGNIKCTRVHCGHRLCILHTSSGETQQQQQRCPAGQECTEDP--SLSCLHPPCLQWGMCSSPHSPPVDT----------DCRPNNSYLDQNCARVTLIFDTKSLPQGATVEGICSELRYLPGTRVL---AKDYTLFILCEQSPSSSSAVEVAMSSAVENTGQIQEVVGS------IINVLSK------RHNSTLLLAIREVKVEAQVM-------PTSIGYLVPLLCVLFTLLWISCMVVCICWFRKRRKARER 1078          

HSP 2 Score: 119.783 bits (299), Expect = 1.681e-151
Identity = 72/223 (32.29%), Postives = 107/223 (47.98%), Query Frame = 3
Query:  180 FSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF-NKESTHSYKFTI----KSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            F  C + Y   VS   P      C YG   + + G +S +  N    H    T+    + +WP + TLI+EA+    +      +I+R VY+  + P      W  +  +   + +Q+S+ + C+  YYG  C++ C+      GHY+C   G      G   +     +C+ GC  +HG C  PGEC C  GWQG  CDEC+ +PGC HGTCV+  W C CE
Sbjct:   70 FRACAKEYQVEVSLGGP------CIYGSASSSVLGANSFQLENSRDKHGETGTVLIPFEFAWPRAFTLIVEAWHWDNSTIKNDLLIERDVYRGEMNPG---DEWQVIQHTGSTASFQYSVRIRCERHYYGNKCNKKCRPRDDYFGHYECGHFG------GGPKTPKRGALCKQGCSELHGTCAVPGECACHYGWQGPLCDECLTHPGCVHGTCVNK-WECICE 276          

HSP 3 Score: 65.4698 bits (158), Expect = 3.447e-10
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH 1198
            + W G  C+ + N   ++ PC NGG C   +  V+ + C+C  G+ G DC   +D C P+PC   G C+  +  F CQC   + G  C  +   C  + C  G  C  + NG  RC C  G  G  C 
Sbjct:  703 SGWQGSTCNLATNSTCDSQPCANGGTC---VGGVKSFTCMCKDGWAGSDCTLNVDDCNPHPCYNGGMCVDGENWFRCQCAPGFAGPDCRINVDECQSSPCSYGASCVDEING-YRCECPPGRAGPRCQ 826          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: JAG1 (jagged canonical Notch ligand 1 [Source:HGNC Symbol;Acc:HGNC:6188])

HSP 1 Score: 414.461 bits (1064), Expect = 5.017e-144
Identity = 291/851 (34.20%), Postives = 409/851 (48.06%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID----PCFPNPCKKGTCMKSKGEFY-CQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTI-NQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDAC--SMPQMLNSSGIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCI-KSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH-IDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCL--QANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLV 3328
            NWGG  CD+ LNYC  + PC+NGG C N  ++   YKC C  G+ G +CEID        N C  G         Y C C   WTG  C +D   C  + C NGG C    NG  RC C   + G  C +    C+++ C HA  C+      G Y C C PG+TG+ CD ++N+C    C N G C D +NDY C C   + G+ CE  +  C + PC NGG C++    Y C C  G+ G +CE+    C PNPC NGA C  + N D++CHC++ F G  C   + +C    C+   D+C  ++P   + SG+ H     CG  G CLS     F C C  GF G  C  +++DC    C NGG C+D IN+F+C+C +G+ G+ CE   D C   +PC+N G C     +L NDF CECKN W G+ CH  K S CD   C NGG C      + F+C C  GW G  C     I   P    N C+N   C+  G + + C C+ G+EG +C  + N+C+ +PC+NGG C+D  N YRC CA GF G     + +EC S PCA  A C+D I+ + C CP GR G+ C    ++E P  P CV   R    G +W   C  C C  G + C  V CG   CL   A  + +   C  G  C++     + C    C  +  C+         Q S P      CQ         CA + LTF++  +    T++ IC  ++ L+ I +L+ +     + I C++ +     + VAI S          + S P    L   +A  + D IK   +  +  +    +    +S + +  +    L+V
Sbjct:  150 NWGGLLCDKDLNYCGNHQPCRNGGSCSN--AQPDSYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNG-FRCTCPPQWTGHTCLVDTDECDDNPCVHARSCK---NLFGGYYCGCLPGWTGQNCDIDVNDC-EGKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYYCVCMDGFAGDSCELDVDLCVPNPCQNGARCVNLPNGDYFCHCSENFEGTNCTLLKDHCLTSPCQ-VIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTC----HDLVNDFSCECKNGWKGKTCH-SKISHCDEATCNNGGEC--FDVGDTFRCSCPTGWEGPTCNIAQSIACMP----NPCQNGATCVISG-DSYKCICQSGWEGANCTQDINDCSSHPCYNGGTCVDGTNWYRCECAAGFAGE----DINECQSMPCAKDATCIDEINGYRCMCPLGRAGRHC----HDEVPTQP-CVASGRNHSHGSSWKEECNMCHCSNGNINCTKVWCGNKLCLLSPAAASAERDGCPAGLSCHAMRH--ESCLAGSCFRQGECLP--------QTSPPASL---CQQQEDGASGGCAHLRLTFDRSLLAPSTTVEHICRELRYLEAIHNLSSS---FPIYILCEMIDKEPDKIRVAISSD---------RQSGPQGAQLVQEVAARIADAIKQRRSGSSRHLAAVTNADFTHSTAVNNESDNMVLIV 946          

HSP 2 Score: 116.701 bits (291), Expect = 5.017e-144
Identity = 61/143 (42.66%), Postives = 77/143 (53.85%), Query Frame = 3
Query:  417 VIDRVVYKNFLKPSYNSSMWNDVVLSNDRSV-YQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRA--GWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            +I RV Y   + P      W++      R+V   + + ++C   Y+   C + CK      GHY CD NG KVC  GW G DC   IC+ GC   HG C+NPGEC CR   GWQG FCD+C+ YPGC HG C   PW C C+ 
Sbjct:   11 LITRVTYSGMINPG---DQWHNHSAVGARAVTVDYRLRVMCDEHYFSTNCTKLCKPRDDYFGHYACDSNGNKVCLDGWTGGDCKKAICRQGCSTEHGQCDNPGECNCRCQYGWQGHFCDQCIPYPGCVHGGC-SKPWECRCDT 149          

HSP 3 Score: 209.534 bits (532), Expect = 1.723e-55
Identity = 171/565 (30.27%), Postives = 250/565 (44.25%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKY-------------------------------CDKEINECVPN-PCKNNGVCTDSIND-YKCNCSTSFKGKNCELNIACQ---NQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASF-PCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC 2653
            D NGN+  +C  G+ G +C  A   +    +H      Q    G+  C CQ G+ G +                               CDK++N C  + PC+N G C+++  D YKC+C   + G NCE++       N  C NGG      +GY C C  G+TG NC      C+ +PC NG  C  +   F C C  ++ G  C      C +  C            +++   K+ + G Y            C C+PG+ G +C+ID++DC+   C NGG C D +N++ C C  G+ G+ CE   + C   PC+N G C    D  Y    C C + + G  C L    +C  NPC NG  C  L   + F CHC++ + GT C  L  H    PC+                        +C   G C++    +FTC C  GF G  C  N N+C    C NGG C+D +NS++C+C  G+ G  C+ + D+C++  PC  G  C D ++DF C C  G  GK C H K +   +  +C      FD G+T+  +C
Sbjct:   74 DSNGNK--VCLDGWTGGDCKKAICRQGCSTEHG-----QCDNPGECNCRCQYGWQGHFCDQCIPYPGCVHGGCSKPWECRCDTNWGGLLCDKDLNYCGNHQPCRNGGSCSNAQPDSYKCDCQKGYHGVNCEIDYVQHITLNNTCANGGSSVGSPSGYKCLCAPGWTGANCTEDIDECASSPCGNGGTCLNLVNGFRCTCPPQWTGHTCLVDTDECDDNPC------------VHARSCKNLFGGYY------------CGCLPGWTGQNCDIDVNDCE-GKCLNGGTCKDLVNDYSCECKPGYTGRRCETEVNECASHPCLNGGQCRDAIDSYY----CVCMDGFAGDSCELDV-DLCVPNPCQNGARCVNLPNGDYF-CHCSENFEGTNCTLLKDHCLTSPCQVIDSCTVAVPSNTSESGVAHVTSTVCGPNGRCLSQAGGNFTCMCNSGFRGSFCHENVNDCAEGACHNGGTCLDGINSFQCMCPDGWDGEFCENDVDDCSNHNPCLNGGTCHDLVNDFSCECKNGWKGKTC-HSKISHCDE-ATCNNGGECFDVGDTFRCSC 598          

HSP 4 Score: 100.908 bits (250), Expect = 1.042e-21
Identity = 73/222 (32.88%), Postives = 109/222 (49.10%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSI-CDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGG 1474
            + W G+FC+  ++ C+ +NPC NGG C +L+++   + C C +G++G+ C  +I  C    C   G C      F C C   W G  C+   SI C  N CQNG  C    + + +CICQ G++G+ C      C +  C +   C +  T    Y+C C  G+ G    ++INEC   PC  +  C D IN Y+C C     G++C   +    QPC   G
Sbjct:  523 DGWDGEFCENDVDDCSNHNPCLNGGTCHDLVND---FSCECKNGWKGKTCHSKISHCDEATCNNGGECFDVGDTFRCSCPTGWEGPTCNIAQSIACMPNPCQNGATCVISGD-SYKCICQSGWEGANCTQDINDCSSHPCYNGGTC-VDGTNW--YRCECAAGFAG----EDINECQSMPCAKDATCIDEINGYRCMCPLGRAGRHCHDEVP--TQPCVASG 731          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000962.1 (pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 gene:ENSPMAG00000000874.1 transcript:ENSPMAT00000000962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 405.986 bits (1042), Expect = 3.993e-125
Identity = 275/837 (32.86%), Postives = 398/837 (47.55%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENL----LSEVQPYKCI----CPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQ---IQSTALGDYKCLCQPG--YTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAY-DACSMPQMLNS--SGIKH---NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGT---DDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNY--CAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDI 3259
             NWGG  CD+ LNYC  + PC+NGG C N      +   P   +     PS      C  DPC       G+C ++   F C C   WTG  C  D   C  + C NGG C +D   +  C C   + G  C L    +  + +    C+   I           C+P   +        IN+C    C+N G CTD +N Y C C   + G+ C+  +  C + PC N G CQ+    + C C  G++G  C++    C PNPC NGA C+ +N D++C C++++ GK C   R +C   +   A  D+C++    NS  SG+++     CG +G C+S    KF C C  GF G  C  +I+DC  NPCKNGG CID + +++CIC  G+ G  CE  T+ C  + C N G C     +L NDF CEC+N W G+ CH  +   CD   C NG +C      + F C C  GW G  C  +          + C N   C+  G + FTC CK G+EG  C  NTN+CNP+PC+NGG C+D  N YRC CA GF G +C++N +EC S PCA+GA CVD I+ F C CP GR G  C  V     P      +  +++ SG  W   C  C C  G+  C  + CG   CL +       D + C  G+ C + P +   C   PC     C+             P  +   C+PN   + +   CA++ LT +  ++  G  ++ +C  I+ L  ++DL    R R L I CD ++++   V VA+ +  +   + E         ++  V+A+ L  +   N T    + ++
Sbjct:   35 TNWGGLLCDKDLNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCA----NDGSCHETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTC-RDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCH-GQCQNGGTCTDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCFNLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYCHENINDCTVNPCKNGGTCIDGVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCR----DLVNDFYCECRNGWKGKTCH-SRERQCDEATCNNGATC--YDRGDSFACLCPMGWEGATCSIVRNSSC---ASSPCMNTATCVGSG-DSFTCVCKEGWEGPTCSENTNDCNPHPCYNGGTCVDGENWYRCDCAPGFAGPDCRINVNECQSNPCAFGATCVDEINGFRCLCPHGRSGFRCQDVYAKPCP------WNGKLYASGAKWEDECNLCQCLNGRTNCTKLWCGGTLCLTSGKVVPGPDAHRCPTGQKCMATPAS--ACLAAPCDYWGECLPR-----------PEPTRVKCRPNHPGHADTEPCARLALTLDPFHLQPGALVEHVCSEIRHLPFLRDL---ARERPLYILCDASDDSDGKVAVAVSTEEQAGGLREDA-------FVRDVVARLLNALRHGNGTVLAAITEV 825          

HSP 2 Score: 209.92 bits (533), Expect = 2.206e-56
Identity = 171/551 (31.03%), Postives = 242/551 (43.92%), Query Frame = 2
Query: 1166 CQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKG----KNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNES-----CES----------AYDAC--SMPQMLNSSGIK----HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLC-HLPKHSICDSNPCLNGGSCSRLSTLNG--------------------------FQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ 2656
            CQ G++G+ C         QC     C ++ T    ++C C+  + G  CDK++N C    PC+N G C ++  D Y      S  G     +     AC + PC N G C E  +G+ C C  G+TG  C      C+ +PC NG  C     DF C C  ++ G+ C+        E      CES          AY  C  S P  L+         H  C   GTC +     + C C PG+ G  C+ ++D+C ++PC N G C D +N+F C+C  GF G  C+   DYC  +PC N   C      L  D+ C C  ++ G+ C  L  H    + P     SC+     N                           F C C++G+ GT C   H +   C   N CKN G CI+ G   + C C  G+EG  C+I+TN+C+PN C N G+C D +N + C C  G+ G  C     +C    C  GA C DR D F C CP G +G  C  V+N+     P C+       SG++++  C+
Sbjct:    2 CQYGWQGAYC--------DQCTPYPGC-VRGTCHEPWQCSCETNWGGLLCDKDLNYCGTHTPCRNGGTCANTEPDEYTRRSPLSPVGLREIPSHTAEHACLSDPCANDGSCHETPSGFECVCALGWTGLTCAYDIDDCASDPCGNGGTCRDRLNDFECRCPPQWMGRTCQLGTHAKVREERVPAPCESRRICKVPRAQAYLPCRPSRPWQLHQLPPHINDCHGQCQNGGTC-TDLVNGYHCTCPPGYTGRGCQQEVDECVSSPCLNNGQCQDQLNSFRCLCPAGFSGHLCQLDVDYCEPNPCQNGAPCF----NLNMDYFCSCSEDYEGKNCSRLRDHCRTSTWPRAVIDSCTVAVASNSTQSGMRYISSGVCGPHGRCVSQGGGKFTCSCDEGFTGTYC---HENINDC-TVNPCKNGGTCID-GVKSYQCICHEGWEGDVCEIDTNDCSPNLCQNRGRCRDLVNDFYCECRNGWKGKTCHSRERQCDEATCNNGATCYDRGDSFACLCPMGWEGATCSIVRNSSCASSP-CMNTATCVGSGDSFTCVCK 532          

HSP 3 Score: 51.2174 bits (121), Expect = 1.661e-6
Identity = 22/36 (61.11%), Postives = 26/36 (72.22%), Query Frame = 3
Query:  720 RCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            RC+ GWQG +CD+C  YPGC  GTC + PW CSCE 
Sbjct:    1 RCQYGWQGAYCDQCTPYPGCVRGTCHE-PWQCSCET 35          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002643.1 (pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 gene:ENSPMAG00000002413.1 transcript:ENSPMAT00000002643.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 4.593e-49
Identity = 118/352 (33.52%), Postives = 166/352 (47.16%), Query Frame = 2
Query: 1445 CQNQPCKNGGVC-QEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICEC-KNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYND-------------------FTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYG 2437
            C + PC +GG C    D G++C+C  GY+G NCE    GC+  PCLN A C      + C+C   F G+ CE     C +E C                          GTC ++ ++++ C C  GF G+ C++D ++C + PC NG  C+D    FEC+C  G+ G  CE   D C   PC N GVC+    +L + + C+C +  + G+ C L     C SNPC +  +C  +  +  F C C  G+ G  C+    D   C  +  C N G CI +   D                   FTC C PG  G++C +N +EC   PC NGG CID + S+ C CA GF G
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHG-----------------------GTC-TNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCI----DLVDSYTCDCLETGYEGKDCELEILE-CASNPCRHNSTC--IEGILNFTCICWPGFAGDACE---EDVNECGDEP-CMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 2 Score: 167.933 bits (424), Expect = 3.033e-46
Identity = 119/370 (32.16%), Postives = 173/370 (46.76%), Query Frame = 2
Query:  875 NNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRR--CICQQGYKGSECHL------AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNC-STSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFG 1945
            + PC +GG C  L +    + C C  G+ G +CE  +  C   PC     C+   G + C C+  + G+ C+ D + C    C +GG C    NG  R  C C  G+ G  C L      + PC N      LD        G ++C+C  GYTG  C+ E++EC   PC+N GVC D ++ Y C+C  T ++GK+CEL I  C + PC++   C E    +TC C  G+ G  CE     C   PC+NG  C  +++        +F+GK  E    +                   N+SG                   F CRC+PG  G++C +++D+C++ PC NGG CID+I +F C C  GF G
Sbjct:    3 SGPCLHGGTC--LPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTC---TNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLD--------GKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSK-------PDFYGKLSELPGTF----------------HYANASG-------------------FTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 3 Score: 157.918 bits (398), Expect = 9.084e-43
Identity = 115/355 (32.39%), Postives = 156/355 (43.94%), Query Frame = 2
Query: 1559 CSPNPCLNGAYCY-TINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHC-NQGWIGTVCQF--LHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCID--------------------KLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDG 2551
            C+  PCL+G  C    +  F C C   + G  CE S   C +  C            LN +            C+  E   + C C+PGF+G  CEIDI++C + PC +GG C +  + + C C +GF G+ C+  T+ C   PC N   C+    +L   F C C   + G +C       C+S PC NGG C  L  ++ + C C   G+ G  C+   L     PCR  + C         G  +FTC C PGF G  C+ + NEC   PC NGG+CI+                      + + C C  G  G NC +N DEC S PC  G  C+D I  F C C  G  G
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPC------------LNDA-----------VCVD-EPGGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCV----DLDGKFECVCPRGYTGAMCETEVDE-CESGPCQNGGVCIDL--VDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIE-------GILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 4 Score: 155.221 bits (391), Expect = 8.495e-42
Identity = 109/348 (31.32%), Postives = 151/348 (43.39%), Query Frame = 2
Query: 1097 CDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHC-NKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICID--------------------SINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGG 2071
            C    C +GG C    +G   C C  GY G  C  +   C +  C +   C  +    G YKC C PG+ G++C+ +INEC   PC + G CT+  + Y C C   F G+ C+L+   C +QPC NG  C ++D  + C C  GYTG  CE     C   PC NG  C  +   + C C    + GK CE     C +  C   +++  +  +LN                      F C C PGF GD+CE D+++C   PC NGG CI+                    + + F C C  G  G+ C    D C   PC+N G C+ +       F CEC   + G
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEP---GGYKCYCVPGFQGRHCEIDINECASEPCLHGGTCTNGRDRYSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCR--HNSTCIEGILN----------------------FTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDN----IGSFSCECAPGFTG 317          

HSP 5 Score: 122.865 bits (307), Expect = 1.201e-30
Identity = 85/258 (32.95%), Postives = 129/258 (50.00%), Query Frame = 2
Query:  836 GQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDP--CFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCIC-QQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTD--------------------SINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTG 1531
            G+ C+  +N CA + PC +GG C N       Y C CP GF G  C++D   C   PC  G TC+   G+F C C   +TG +C+ +   C+   CQNGG C  D   +  C C + GY+G +C L    C ++ C+H   C      + ++ C+C PG+ G  C++++NEC   PC N G C +                    + + + C C     G+NC +N+  C++QPC NGG C +    ++C+C  G+TG
Sbjct:   68 GRHCEIDINECA-SEPCLHGGTCTNGRDR---YSCACPDGFAGERCQLDTNECASQPCHNGATCVDLDGKFECVCPRGYTGAMCETEVDECESGPCQNGGVC-IDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCI---EGILNFTCICWPGFAGDACEEDVNECGDEPCMNGGQCIELSKPDFYGKLSELPGTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSFSCECAPGFTG 317          

HSP 6 Score: 121.324 bits (303), Expect = 3.536e-30
Identity = 100/335 (29.85%), Postives = 151/335 (45.07%), Query Frame = 2
Query: 1859 CKTNPCKNGGICIDSINN-FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAK-GFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C + PC +GG C+ + +  F C C  G+ G  CE     C   PC+N  VC+         + C C   + GR C +  +  C S PCL+GG+C+  +  + + C C  G+ G  CQ   +D   C  +  C N   C+++    F C C  G+ G  C+   +EC   PC NGG CID ++SY C C + G+ G +C+L   ECAS PC + + C++ I +F C C  G  G  C+   N    +P  C+   +  +  +   Y         GK++   +P    T   AN +     C PG    +   N   C   PC+    CI     +
Sbjct:    1 CASGPCLHGGTCLPAADGGFSCRCAPGYSGDNCEASVGGCASGPCLNDAVCVDEP----GGYKCYCVPGFQGRHCEIDINE-CASEPCLHGGTCT--NGRDRYSCACPDGFAGERCQ---LDTNECASQP-CHNGATCVDLD-GKFECVCPRGYTGAMCETEVDECESGPCQNGGVCIDLVDSYTCDCLETGYEGKDCELEILECASNPCRHNSTCIEGILNFTCICWPGFAGDACEEDVNECGDEP--CMNGGQCIELSKPDFY---------GKLS--ELP---GTFHYANASGFTCRCLPGTTGENCSVNLDECESQPCLNGGSCIDNIGSF 307          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008695.1 (pep scaffold:Pmarinus_7.0:GL501129:36413:70075:1 gene:ENSPMAG00000007872.1 transcript:ENSPMAT00000008695.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.451 bits (389), Expect = 4.205e-40
Identity = 128/484 (26.45%), Postives = 188/484 (38.84%), Query Frame = 2
Query: 1274 YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSI-----NDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCG----------KYGTCLSHEKEKF-----------------ICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNL-----CKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID------DFECRCPEGRDGKLCDHVKNNESPQP 2593
            ++C C+  Y G +C+     C PNPC N  +C         + Y+C C+  F G NC   + AC  Q C++G       + + C+C  GY G  C      C+  PC NG  C  +   F C C K   G+RCE     C ++ C        +   +NS G    +C           K   C   +  KF                 IC  +   +G  C+ D D+C ++PC NG  C +  N F C C  GF G  CE+  + C  SPC + G C+    +L + +IC C       +       +C   P  N   C + +      C    G  G    +   +    RR +L      +   V I VG             G HC+++ +EC  +PC +G  C+D +  Y C C   F    C      C S PC   A+C   +D         C CP G  G  C+   ++ +  P
Sbjct:    3 FRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCG------PLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCI----DLVDGYICLCPPGL-TEVSRGNAQPMCQRTPARNQSYCIQRTQKQ--SCIFQDGAQGLTVLY---NTDASRRTSLQTYGSLREGAVAIAVGGCVSL-----SLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDDCASAP 465          

HSP 2 Score: 137.502 bits (345), Expect = 2.038e-34
Identity = 123/465 (26.45%), Postives = 185/465 (39.78%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGIC--ENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMK-SKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC----VPNPC--KNNGVCTDS-INDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGN---------------ESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMP-GFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDF--ICECKNNWGGRLCHLPKHSICDSNPCLNG 2128
            + G  C+ +   C+ N PC NG IC           Y+C C  GF G +C   +  C    C+ G+C+  +   F C+C   + G  C      C    C NGG C  +  G+  CIC +G  G  C L    C +  C     C     ++G Y+C C PG+   +   ++ +C     P  C  KN   C +  I+ Y C      KG  C+ +   C + PC NG  C  +  G++C+C  G+ G  CE     CS +PC +   C  +   + C C          +++P C                 +SC     A  +  + N+   +      YG+         +  C+     G  CE+DID+C ++PC +G  C+D I  + C C   F    C  +   C+  PC N  VC +  D         C C   + G  C       C S PC +G
Sbjct:   11 YAGPHCEAAAGACSPN-PCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTC-IEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCI---NSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSPCHHDGSCIDLVDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQCLAPFKAIVCPRQIKICMSVPCENAAVCRQEVDLAVYPMGSSCSCPAGFAGLYCETNTDD-CASAPCNHG 469          

HSP 3 Score: 125.946 bits (315), Expect = 1.268e-30
Identity = 114/436 (26.15%), Postives = 171/436 (39.22%), Query Frame = 2
Query: 1382 NDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQE-----VDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYC--IKSPCMNYGVCLRHSDELYND----FICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKG----------------------------------------FYGSNCQLNYDECASFPCAYGAICVDRIDDFECRC 2533
            N ++C C   + G +CE    AC   PC NG +C         +GY CKC  G+ G NC      C+   C +G+        F C C+  + G  C      C            S+P            C   GTC+      F+C C  G  G  CE+DI++C ++PC    +CI+S+  + C C  GF       +   C  +K P   +   ++++++ +N     +IC    +  G  C       C S+PC NG SCS L   NGF C C  G+ G +C+    +   C   + C ++G CI++  + + C C PG            C   P  N   CI +     CI   G                                          G +C+++ DEC S PC +GA C+D I  + C+C
Sbjct:    1 NAFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEAVGACNEQRCEHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCA-----------SLP------------CTNGGTCI-EVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCF---IKNANQCHNRRISIYICPAVFHHKGARCDSDADE-CLSSPCWNGASCSNLR--NGFSCECLPGFQGGLCE---QEVNEC-SSSPCHHDGSCIDL-VDGYICLCPPGLTEVSRGNAQPMCQRTPARNQSYCIQRTQKQSCIFQDGAQGLTVLYNTDASRRTSLQTYGSLREGAVAIAVGGCVSLSLTGPHCEMDIDECGSSPCLHGATCLDLIGGYYCQC 401          

HSP 4 Score: 94.3597 bits (233), Expect = 3.441e-20
Identity = 56/173 (32.37%), Postives = 83/173 (47.98%), Query Frame = 2
Query: 2033 NDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSC---SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEG 2542
            N F C C+  + G  C     + C  NPC NG  C   +     +G++C C +G++G  C         C  +      G C++V  + F C C  G+ G  C    + C   PC NGG CI+   S+ CIC KG  G  C+L+ +ECAS PC   ++C++ +  + C C  G
Sbjct:    1 NAFRCRCREPYAGPHCEAAAGA-CSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCSEA---VGACNEQRC--EHGSCVDVTPSTFVCECHAGYMGPTCSAPIDRCASLPCTNGGTCIEVPGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPG 167          

HSP 5 Score: 87.0409 bits (214), Expect = 6.816e-18
Identity = 80/276 (28.99%), Postives = 108/276 (39.13%), Query Frame = 2
Query: 1907 NNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCL-RHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNL-CKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFY---------------------------------------------GSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            N F C C   + G  CE     C  +PC N  +C+ R      + + C+C   + G  C       C+   C + GSC  + T + F C C+ G++G  C    ID    R  +L C N G CI V    F C C  G  G+ C+++ NEC  +PC     CI+ +  YRC CA GF                                              G+ C  + DEC S PC  GA C +  + F C C  G  G LC+   N  S  P
Sbjct:    1 NAFRCRCREPYAGPHCEAAAGACSPNPCGNGAICVPRTEGGAGSGYRCKCAEGFVGWNCS-EAVGACNEQRCEH-GSCVDV-TPSTFVCECHAGYMGPTCS-APID----RCASLPCTNGGTCIEV-PGSFVCICPKGLMGRRCELDINECASDPCGPLSLCINSVGGYRCFCAPGFIAVFATSKVADCQLLKFPKFCFIKNANQCHNRRISIYICPAVFHHKGARCDSDADECLSSPCWNGASCSNLRNGFSCECLPGFQGGLCEQEVNECSSSP 267          
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002014.1 (pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 gene:ENSPMAG00000001825.1 transcript:ENSPMAT00000002014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 1.885e-37
Identity = 82/211 (38.86%), Postives = 107/211 (50.71%), Query Frame = 2
Query: 1844 IDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASF 2476
             D+D+C  NPC+NGG CID   ++ C C  GF GK CE   D C   PC N G C+  +      F C C   + G LC       C S+PC NGG C  ++    F C C  G+ GT+C     D   C   + C N G C + G   FTC C PGF G  C+ + NEC  +PC NGG+C D + ++ C CA GF G+ C+   + C   
Sbjct:   10 ADVDECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGA----GSFTCSCLAGYTGTLCDSDIDE-CTSDPCQNGGQC--VNGAGSFTCSCLAGYTGTLCD---SDVNECA-SSPCLNGGRCRD-GVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLNPCTKM 208          

HSP 2 Score: 132.494 bits (332), Expect = 3.094e-35
Identity = 78/222 (35.14%), Postives = 102/222 (45.95%), Query Frame = 2
Query: 1319 KEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIK 1981
             +++EC PNPC+N G C D    Y C+C+  F GK CE +I  C + PC+NGG C      +TC C  GYTGT C+     C+ +PC NG  C      F C C   + G  C+     C +  C            LN    +                 F C C PGF G  CE D+++C ++PC NGG C D +  F C C  GF G  CE   + C K
Sbjct:   10 ADVDECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPC------------LNGGRCRDGV------------AAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLNPCTK 207          

HSP 3 Score: 131.339 bits (329), Expect = 8.934e-35
Identity = 74/200 (37.00%), Postives = 105/200 (52.50%), Query Frame = 2
Query:  974 EIDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCS 1564
            ++D C PNPC+  G C+     + C C + +TGK C+ D   C  + CQNGGQC  +  G+  C C  GY G+ C      C +  C++   C       G + C C  GYTG  CD ++NEC  +PC N G C D +  + C C+  F G  CE ++  C + PC NGG C++    +TC+C  G+TGT CE     C+
Sbjct:   11 DVDECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQC-VNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCV---NGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLNPCT 206          

HSP 4 Score: 125.946 bits (315), Expect = 6.261e-33
Identity = 76/203 (37.44%), Postives = 104/203 (51.23%), Query Frame = 2
Query: 1967 DYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN 2575
            D C  +PC N G C+  +      + C+C   + G+ C       C S+PC NGG C  ++    F C C  G+ GT+C     D   C   + C+N G C+N G   FTC C  G+ G  CD + NEC  +PC NGG+C D + ++ C CA GF G+ C+ + +ECAS PC  G  C D +  F C C  G  G  C+ V N
Sbjct:   13 DECSPNPCQNGGRCIDGAAS----YTCDCAQGFTGKRCETDIDE-CTSDPCQNGGQC--VNGAGSFTCSCLAGYTGTLCD---SDIDECT-SDPCQNGGQCVN-GAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVLN 203          

HSP 5 Score: 123.635 bits (309), Expect = 3.412e-32
Identity = 74/192 (38.54%), Postives = 99/192 (51.56%), Query Frame = 2
Query:  878 NPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI 1441
            NPC+NGG C   +     Y C C  GF G+ CE  ID C  +PC+ G  C+   G F C C+  +TG LCD D   C  + CQNGGQC  +  G+  C C  GY G+ C      C +S C +   C+    A   + C C PG+TG  C+ ++NEC  +PC N G C D +  + C C+  F G  CE  +
Sbjct:   18 NPCQNGGRC---IDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQC-VNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETVL 202          

HSP 6 Score: 123.25 bits (308), Expect = 4.780e-32
Identity = 71/193 (36.79%), Postives = 97/193 (50.26%), Query Frame = 2
Query: 1085 DTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCE 1657
            D   C  N CQNGG+C  D   +  C C QG+ G  C      C +  C++   C       G + C C  GYTG  CD +I+EC  +PC+N G C +    + C+C   + G  C+ ++  C + PC NGG C++    +TC+C  G+TGT CE     C+ +PCLNG  C      F C C   F G RCE
Sbjct:   11 DVDECSPNPCQNGGRC-IDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCV---NGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCE 199          

HSP 7 Score: 114.005 bits (284), Expect = 7.261e-29
Identity = 74/202 (36.63%), Postives = 96/202 (47.52%), Query Frame = 2
Query: 1751 NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECN 2356
            N C   G C+      + C C  GF G  CE DID+C ++PC+NGG C++   +F C C  G+ G  C+   D C   PC N G C+  +      F C C   + G LC    +  C S+PCLNGG C     +  F C C  G+ GT C+    D   C   + C N G C + G   FTC C PGF G  C+   N C 
Sbjct:   18 NPCQNGGRCIDGAA-SYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGA----GSFTCSCLAGYTGTLCDSDVNE-CASSPCLNGGRC--RDGVAAFTCECAPGFTGTRCE---TDVNEC-ASSPCLNGGRCRD-GVAAFTCECAPGFTGTRCETVLNPCT 206          

HSP 8 Score: 109.383 bits (272), Expect = 3.212e-27
Identity = 68/214 (31.78%), Postives = 94/214 (43.93%), Query Frame = 2
Query: 1445 CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHL 2086
            C   PC+NGG C +    YTC C  G+TG  CE     C+ +PC NG  C      F C C   + G  C+     C ++ C++        Q +N +G                   F C C+ G+ G  C+ D+++C ++PC NGG C D +  F C C  GF G  CE   + C  SPC+N G C     +    F CEC   + G  C  
Sbjct:   15 CSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGG------QCVNGAG------------------SFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCR----DGVAAFTCECAPGFTGTRCET 200          

HSP 9 Score: 108.612 bits (270), Expect = 6.357e-27
Identity = 66/198 (33.33%), Postives = 88/198 (44.44%), Query Frame = 2
Query: 1274 YKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCK 1864
            Y C C  G+TGK C+ +I+EC  +PC+N G C +    + C+C   + G  C+ +I  C + PC+NGG C      +TC C  GYTGT C+     C+ +PCLNG  C      F C C   F G RCE     C +  C            LN    +                 F C C PGF G  CE  ++ C 
Sbjct:   33 YTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPC------------LNGGRCRDGV------------AAFTCECAPGFTGTRCETVLNPCT 206          

HSP 10 Score: 92.0485 bits (227), Expect = 3.700e-21
Identity = 52/137 (37.96%), Postives = 71/137 (51.82%), Query Frame = 2
Query: 2243 NLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC 2653
            N C+N G CI+ G   +TC C  GF GK C+ + +EC  +PC NGG+C++   S+ C C  G+ G+ C  + DEC S PC  G  CV+    F C C  G  G LCD   N  +  P  C+   R  D    ++  C
Sbjct:   18 NPCQNGGRCID-GAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSP--CLNGGRCRDGVAAFTCEC 151          

HSP 11 Score: 87.0409 bits (214), Expect = 1.804e-19
Identity = 58/174 (33.33%), Postives = 88/174 (50.57%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGR--DCEIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECV 1339
            + G+ C+  ++ C  ++PC+NGG C N       + C C +G+ G   D +ID C  +PC+ G  C+   G F C C+  +TG LCD D + C  + C NGG+C +D      C C  G+ G+ C      C +S C +   C+    A   + C C PG+TG  C+  +N C 
Sbjct:   41 FTGKRCETDIDECT-SDPCQNGGQCVNGAGS---FTCSCLAGYTGTLCDSDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSPCLNGGRC-RDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAA---FTCECAPGFTGTRCETVLNPCT 206          

HSP 12 Score: 80.1073 bits (196), Expect = 4.825e-17
Identity = 58/183 (31.69%), Postives = 78/183 (42.62%), Query Frame = 2
Query: 2336 INTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPCGVWTCLQANGTDDPYA-----CKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
             + +EC+PNPC NGG+CID   SY C CA+GF G  C+ + DEC S PC  G  CV+    F C C  G  G LCD   +  +  P  C    +  +   +++ +C        CD     C S P     CL      D  A     C PG        +   C   PC+   RC    + +
Sbjct:   10 ADVDECSPNPCQNGGRCIDGAASYTCDCAQGFTGKRCETDIDECTSDPCQNGGQCVNGAGSFTCSCLAGYTGTLCDSDIDECTSDP--CQNGGQCVNGAGSFTCSCLAGYTGTLCDSDVNECASSP-----CLNGGRCRDGVAAFTCECAPGFTGTRCETDVNECASSPCLNGGRCRDGVAAF 185          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO46243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW9])

HSP 1 Score: 349.362 bits (895), Expect = 1.292e-105
Identity = 227/599 (37.90%), Postives = 292/599 (48.75%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD--------ACSMPQMLNSS--GIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC--QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G+ C   ++ CA +NPCKNG  C +    +  + C C  GF G+DC  EID C  NPCK G TC      F C C   +TGK C  +   C  N C+NG  C    NG   C C+ G+ G +C      C ++ CK+   C  +   +  + C C+PG+TGK C  EI+EC  NPCKN   CTD IN + C C   F GK+C   I  C + PCKNG  C +   G+ C CK G+TG +C      C+ NPC NGA C      F C C   F GK C      C +  C++           AC+          G + + C     K G   +     F C C PGF G  C  +ID+C +NPCKNG  C D IN F C C  GF GK C    D C  +PC N   C     +  N F C CK  + G+ C   +   C SNPC NG +C+    +NGF C C  G+ G  C  +       PC+    C +    IN   N + C C PGF G HC+ N +EC  +PC NGG C D +N++ C C  G+ G  C ++ DECAS PC  G  C D I+ F C CP G  G  CD
Sbjct:  110 FTGKDCGTEIDECA-SNPCKNGATCTD---RINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRING-FACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR---INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT----DRINGFACTCKPGFTGKDCGT-EIDECASNPCKNGATCTDR--INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR---INDLINGYYCFCTPGFSGIHCEANIDECASSPCQNGGLCTDMINAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCD 690          

HSP 2 Score: 346.28 bits (887), Expect = 1.897e-104
Identity = 229/591 (38.75%), Postives = 286/591 (48.39%), Query Frame = 2
Query:  845 CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD--------ACSMPQMLNSS--GIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C   ++ CA +NPCKNG  C +    +  + C C  GF G+DC  EID C   PCK G TC      F C C   +TGK C  +   C  N C+NG  C    NG   C C+ G+ G +C      C ++ CK+   C  +   +  + C C+PG+TGK C  EI+EC  NPCKN   CTD IN + C C   F GK+C   I  C + PCKNG  C +   G+ C CK G+TG +C      C+ NPC NGA C      F C C   F GK C      C +  C++           AC+          G + + C     K G   +     F C C PGF G  C  +ID+C +NPCKNG  C D IN F C C  GF GK C    D C  +PC N   C     +  N F C CK  + G+ C   +   C SNPC NG +C+    +NGF C C  G+ G  C     +   C   N CKN   C +   N F C CKPGF GK C    +EC  NPC NG  C D++N + C C  GF G +C    DECAS PC  GA C DRI+ F C C  G  GK C
Sbjct:    1 CGTEIDECA-SNPCKNGATCTD---RINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRING-FTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDR---INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT----DRINGFACTCKPGFTGKDCGT-EIDECASNPCKNGATCTDR--INGFACTCKPGFTGKDC---GTEIDEC-ASNPCKNGATCTDR-INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDC 571          

HSP 3 Score: 311.612 bits (797), Expect = 5.439e-92
Identity = 211/562 (37.54%), Postives = 280/562 (49.82%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD--------ACSMPQMLNSS--GIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCS-RLSTL-NGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQL 2452
            + G+ C   ++ CA +NPCKNG  C +    +  + C C  GF G+DC  EID C  NPCK G TC      F C C   +TGK C  +   C  N C+NG  C    NG   C C+ G+ G +C      C ++ CK+   C  +   +  + C C+PG+TGK C  EI+EC  NPCKN   CTD IN + C C   F GK+C   I  C + PCKNG  C +   G+ C CK G+TG +C      C+ NPC NGA C      F C C   F GK C      C +  C++           AC+          G + + C     K G   +     F C C PGF G  C  +ID+C +NPCKNG  C D IN F C C  GF GK C    D C  +PC N   C     +  N F C CK  + G+ C   +   C SNPC NG +C+ R++ L NG+ C C  G+ G  C+  +ID       + C+N G+C ++  N FTC C PG+ G  CDI+ +EC  +PC NGG C D +N++ C C  G+ G  C +
Sbjct:  148 FTGKDCGTEIDECA-SNPCKNGATCTD---RINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRING-FACTCKPGFTGKDCGTEIDECASNPCKNGATCTDR---INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT----DRINGFACTCKPGFTGKDCGT-EIDECASNPCKNGATCTDRINDLINGYYCFCTPGFSGIHCE-ANIDEC---ASSPCQNGGLCTDM-INAFTCTCPPGYTGITCDIDIDECASSPCQNGGFCTDMINAFTCSCPPGYTGITCDI 691          

HSP 4 Score: 271.166 bits (692), Expect = 1.051e-77
Identity = 204/576 (35.42%), Postives = 252/576 (43.75%), Query Frame = 2
Query: 1313 CDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD--------ACSMPQMLNSS--GIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC----DHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPC--GVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKD-------CQPNSIKNHNYCAKIILTF 2956
            C  EI+EC  NPCKN   CTD IN + C C   F GK+C   I  C ++PCKNG  C +   G+TC CK G+TG +C      C+ NPC NGA C      F C C   F GK C      C +  C++           AC+          G + + C     K G   +     F C C PGF G  C  +ID+C +NPCKNG  C D IN F C C  GF GK C    D C  +PC N   C     +  N F C CK  + G+ C   +   C SNPC NG +C+    +NGF C C  G+ G  C     +   C   N CKN   C +   N F C CKPGF GK C    +EC  NPC NG  C D++N + C C  GF G +C    DECAS PC  GA C DRI+ F C C  G  GK C    D   +N      +C      F       +  ++C  +  +  C S PC  G     + NG      CKPG            C   PC   A C    + +       PG + KD       C  N  KN   C   I  F
Sbjct:    1 CGTEIDECASNPCKNGATCTDRINGFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCT----DRINGFACTCKPGFTGKDCGT-EIDECASNPCKNGATCTDR--INGFACTCKPGFTGKDC---GTEIDEC-ASNPCKNGATCTDR-INGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDE--CASNPCKNGATCTDRINGF--ACTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFA--CTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGF 558          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO29720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U3])

HSP 1 Score: 337.806 bits (865), Expect = 1.823e-102
Identity = 217/582 (37.29%), Postives = 286/582 (49.14%), Query Frame = 2
Query:  875 NNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD----------ACSMPQMLNSSGIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            +NPC+NGG C + L+    Y C CPSG+ G  CEI  D C   PC   GTC   +  ++C C   +TGK C+ +   C+ + C+NGG C  D      C C+ G+ G +C      C +  CK+   C  +   +  + C C+PG+TGK C  EI+EC   PCKN   CTD IN + C C   F GK+C   I  C ++PCKNG  C +   G+ C CK G+TG +C      C+ NPC NGA C      F C C   F G  C      C +  C++              C +       G + + C     K G   +     F C C PGF G  C  +ID+C ++PCKNG  C D IN F C C  GF G  C    D C   PC N   C     +  N F C CK  + G+ C       C S PC NG +C+    +NGF C C +G+ G  C     D   C   N C NEG C +   N + C CK G+ G +C++  NEC  +PC NGG C D + SYRC C  G+ G +C+ + DECAS PCA G  C D +D  +C+C  G  GK C+
Sbjct:    7 SNPCQNGGTCTDQLNS---YSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSC-TDRINRFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDR---INGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCT----DRINGFACTCKPGFTGKDCGTEIDE-CASEPCKNGANCT--DKINGFMCTCKEGYTGKDC---GTDIDECSS-NPCLNEGTCTDQ-VNGYLCVCKKGYTGPNCEVEVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQCSTGYTGKNCE 569          

HSP 2 Score: 330.487 bits (846), Expect = 9.968e-100
Identity = 210/573 (36.65%), Postives = 289/573 (50.44%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDC--EIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRC 2533
            + G+ C+ +++ C  ++PCKNGG C + ++    + C C  GF G+DC  EID C   PCK G TC      F C C   +TGK C  +   C    C+NG  C    NG   C C+ G+ G +C      C +  CK+   C  +   +  ++C C+PG+TGK C  EI+EC  NPCKN   CTD IN + C C   F G +C   I  C + PCKNG  C +   G+ C CK G+TG +C      C+ NPC NGA C      F C C   F G  C      C +  C                        K G   +     F C C PGF G  C  +ID+C + PCKNG  C D IN F C C  GF GK C    D C   PC N   C     +  N F+C CK  + G+ C       C SNPCLN G+C+    +NG+ C C +G+ G  C+   ++   C+  + C+N G C ++    + C CK G+ G+HC+ + +EC  +PC NGG C D +++++C C+ G+ G NC++N DECA+ PC  GA CVD+I  ++C C
Sbjct:   69 FTGKNCETNIDEC-NSSPCKNGGSCTDRINR---FTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRING-FTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDR---INGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPC------------------------KNGATCTDRINGFACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFACTCKPGFTGKDCGTEIDECASEPCKNGANCT----DKINGFMCTCKEGYTGKDCGTDIDE-CSSNPCLNEGTCTDQ--VNGYLCVCKKGYTGPNCE---VEVNECQS-DPCQNGGTCEDL-IASYRCFCKAGYTGRHCETDIDECASSPCANGGTCTDLVDAHKCQCSTGYTGKNCEVNIDECATKPCLNGATCVDQIAVYKCLC 597          

HSP 3 Score: 297.36 bits (760), Expect = 7.457e-88
Identity = 220/640 (34.38%), Postives = 285/640 (44.53%), Query Frame = 2
Query:  974 EIDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPP-----SC----VYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            EID C  NPC+ G TC      + C C   +TG  C+     C    C NGG C  D  G   C C+ G+ G  C      C +S CK+   C  +   +  + C C+ G+TGK C  EI+EC   PCKN   CTD IN + C C   F GK+C   I  C ++PCKNG  C +   G+TC CK G+TG +C      C+  PC NGA C      F C C   F GK C       G E  E A + C                 K G   +     F C C PGF G  C  +ID+C ++PCKNG  C D IN F C C  GF GK C    D C  +PC N   C     +  N F C CK  + G  C       C S+PC NG +C+    +NGF C C  G+ G+ C     +   C  K  CKN   C +   N F C CKPGF GK C    +EC   PC NG  C DK+N + C C +G+ G +C  + DEC+S PC     C D+++ + C C +G  G  C+ V+ NE    P     +C      Y     +G T  +      C+     C S PC                C  G    +   N   C   PC+  A C+ + ++Y
Sbjct:    1 EIDECSSNPCQNGGTCTDQLNSYSCTCPSGYTGTKCEIVPDQCASAPCINGGTCKSDRYG-YHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDR---INRFTCTCKHGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFTCTCKPGFTGKDCGTEIDECASKPCKNGATCTDRINGFRCTCKPGFTGKDC-------GTEIDECASNPC-----------------KNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCT----DRINGFTCTCKPGFTGSDCGTEIDE-CASSPCKNGATCTDR--INGFACTCKPGFTGSDC---GTEIDECASK-PCKNGATCTDR-INGFACTCKPGFTGKDCGTEIDECASEPCKNGANCTDKINGFMCTCKEGYTGKDCGTDIDECSSNPCLNEGTCTDQVNGYLCVCKKGYTGPNCE-VEVNECQSDPCQNGGTCEDLIASYRCFCKAGYTGRH------CETDIDECASSPCANGGTCTDLVDAHKCQCSTGYTGKNCEVNIDECATKPCLNGATCVDQIAVY 593          

HSP 4 Score: 198.364 bits (503), Expect = 1.126e-53
Identity = 156/454 (34.36%), Postives = 195/454 (42.95%), Query Frame = 2
Query: 1559 CSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC----DHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPC--GVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDC 2902
            CS NPC NG  C      + C C   + G +CE               D C+    +N            GTC S ++  + C C  GF G +CE +ID+C ++PCKNGG C D IN F C C +GF GK C    D C   PC N   C     +  N F C CK  + G+ C       C S PC NG +C+    +NGF C C  G+ G  C     +   C  K  CKN   C +   N F C CKPGF GK C    +EC  NPC NG  C D++N + C C  GF GS+C    DECAS PC  GA C DRI+ F C C  G  GK C    D   +N      +C      F       +   +C  +  +  C S PC  G     + NG      CKPG            C   PC   A C    + +       PG + KDC
Sbjct:    5 CSSNPCQNGGTCTDQLNSYSCTCPSGYTGTKCEI------------VPDQCASAPCING-----------GTCKS-DRYGYHCHCKVGFTGKNCETNIDECNSSPCKNGGSCTDRINRFTCTCKHGFTGKDCGTEIDECASKPCKNGATCT----DRINGFTCTCKPGFTGKDCGTEIDE-CASKPCKNGATCTDR--INGFTCTCKPGFTGKDC---GTEIDECASK-PCKNGATCTDR-INGFRCTCKPGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDECASSPCKNGATCTDRINGFACTCKLGFTGKDCGTEIDECASNPCKNGATCTDRINGFTCTCKPGFTGSDCGTEIDE--CASSPCKNGATCTDRINGF--ACTCKPGFTGSDCGTEIDECASKPCKNGATCTDRINGFA--CTCKPGFTGKDC 416          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO41506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S429])

HSP 1 Score: 316.62 bits (810), Expect = 1.418e-95
Identity = 206/567 (36.33%), Postives = 284/567 (50.09%), Query Frame = 2
Query:  878 NPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKGT--CMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            +PC+N G C ++ +    Y+C C  GF G++C+I+   C P+PC+ G   C     ++ CQC + WTGK C +D   C    C+NG  C    N N  C C  GY G  C      C    C++  +C      +  YKC C PGYTG  C+ +INEC  N C+N G CTD +N + C C+  + G  CE +I  C + PC+NGG C +   GY C+C  G+ G+ C+I    C PNPC NG  C      + C C   + G +CE     C +  C++                        G+C + +   + C C  G+ G +CEI+ DDC++ PC NGG C D ++ +EC C  G+ G  CE   + C  +PC+N G C     +  N + C C   + G  C       C S PC+NG +C  L  +N + C C  GW G  C    I+   C   N C N G C N     +TC C  G+ G HC+ + +EC  NPC NG  C DK+NSY C CA G+ G +C+ + D+CAS PC  G  C D + DFEC C  G  GK C
Sbjct:    7 SPCRNNGTCTDMHNA---YRCQCTQGFVGKNCQININDCIPDPCQNGGWCCCDLVNDWICQCPKGWTGKNCTEDVDECAPQPCKNGATCNNLFN-NYTCTCAAGYTGINCTENIDDCNGVVCQNGGNC---VDGVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNPCGNGGTCTDQLNAYLCTCPPGYTGSKCEIDINECASFPCQNG-----------------------GSC-TDQVNGYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDAYECTCPLGYTGLRCETDINDCQPNPCLNGGSCT----DRVNGYTCACAPGYTGNNCEKDIDD-CASTPCMNGATC--LDGVNSYTCICVTGWTGDQCT---INVDECS-SNPCVNGGTC-NDEAGGYTCTCAAGYTGLHCETDIDECRTNPCLNGATCTDKVNSYTCTCAPGYAGVHCEKDEDDCASKPCLNGGTCTDLLADFECACVLGFIGKTC 530          

HSP 2 Score: 291.197 bits (744), Expect = 1.877e-86
Identity = 191/542 (35.24%), Postives = 267/542 (49.26%), Query Frame = 2
Query:  977 IDPCFPNPCK-KGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            ID C P+PC+  GTC      + CQC + + GK C  + + C  + CQNGG C  D   +  C C +G+ G  C      C    CK+   C   +    +Y C C  GYTG  C + I++C    C+N G C D +N YKC+C+  + G NCE +I  C    C+NGG C ++  G++C C  GYTG  CE     C+  PC NG  C      + C C   F G  C+                       +N +    N CG  GTC + +   ++C C PG+ G  CEIDI++C + PC+NGG C D +N + C C  G+ G  CE   D C   PC+N G C    D     + C C   + G  C    +  C  NPCLNGGSC+    +NG+ C C  G+ G  C+    D   C     C N   C++ G N +TC C  G+ G  C IN +EC+ NPC NGG C D+   Y C CA G+ G +C+ + DEC + PC  GA C D+++ + C C  G  G  C+  +++ + +P
Sbjct:    1 IDDCAPSPCRNNGTCTDMHNAYRCQCTQGFVGKNCQININDCIPDPCQNGGWCCCDLVNDWICQCPKGWTGKNCTEDVDECAPQPCKNGATC---NNLFNNYTCTCAAGYTGINCTENIDDCNGVVCQNGGNCVDGVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQ-----------------------ININDCDPNPCGNGGTC-TDQLNAYLCTCPPGYTGSKCEIDINECASFPCQNGGSCTDQVNGYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDA----YECTCPLGYTGLRCETDIND-CQPNPCLNGGSCTDR--VNGYTCACAPGYTGNNCEK---DIDDCAST-PCMNGATCLD-GVNSYTCICVTGWTGDQCTINVDECSSNPCVNGGTCNDEAGGYTCTCAAGYTGLHCETDIDECRTNPCLNGATCTDKVNSYTCTCAPGYAGVHCEKDEDDCASKP 503          

HSP 3 Score: 219.55 bits (558), Expect = 1.787e-61
Identity = 160/482 (33.20%), Postives = 217/482 (45.02%), Query Frame = 2
Query: 1445 CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCY-TINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP----PSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPC-GVWTCLQANGTDDPYACK-----PGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C   PC+N G C ++   Y C+C  G+ G NC+I    C P+PC NG +C   +  D+ C C K + GK C      C  + C                        K G   ++    + C C  G+ G +C  +IDDC    C+NGG C+D +N ++C C  G+ G  CE   + C  + C N G C     +L N F C C   + G  C       C S PC NGG+C+    +NG++C C  G++G+ CQ    D  P    N C N G C +   N + C C PG+ G  C+I+ NEC   PC NGG C D++N Y C CA G+ G NC++N D+C S PC  G  C D++D +EC CP G  G  C+   N+  P P     SC      +       Y   N  C++    C S PC    TCL      + Y C       G+ C     N   C   PCV    C  E   Y
Sbjct:    4 CAPSPCRNNGTCTDMHNAYRCQCTQGFVGKNCQININDCIPDPCQNGGWCCCDLVNDWICQCPKGWTGKNCTEDVDECAPQPC------------------------KNGATCNNLFNNYTCTCAAGYTGINCTENIDDCNGVVCQNGGNCVDGVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCT----DLVNGFSCTCAPGYTGHRCETDIDD-CASAPCRNGGTCT--DQVNGYRCQCALGFVGSYCQININDCDP----NPCGNGGTCTDQ-LNAYLCTCPPGYTGSKCEIDINECASFPCQNGGSCTDQVNGYTCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDAYECTCPLGYTGLRCETDINDCQPNPCLNGGSCTDRVNGYTCACAPGYTGNN--CEKDIDDCASTPCMNGATCLDGV---NSYTCICVTGWTGDQC---TINVDECSSNPCVNGGTCNDEAGGY 441          

HSP 4 Score: 159.458 bits (402), Expect = 4.493e-41
Identity = 124/386 (32.12%), Postives = 167/386 (43.26%), Query Frame = 2
Query: 1850 IDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPC--GVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY----PNNQISWPGESH-KDCQPNSIKNHNYCAKIILTFNKKNVP 2974
            IDDC  +PC+N G C D  N + C C  GF GK C+   + CI  PC N G C     +L ND+IC+C   W G+ C       C   PC NG +C+ L   N + C C  G+ G  C     D        +C+N G C++ G N + C C PG+ G +C+ + NEC  N C NGG C D +N + C CA G+ G  C+ + D+CAS PC  G  C D+++ + C+C  G  G  C    N+  P P  C       D    +   C        C+     C S PC  G     Q NG     +C  G    +   N   C   PC+    C  +   Y    P        E+   DCQPN   N   C   +  +     P
Sbjct:    1 IDDCAPSPCRNNGTCTDMHNAYRCQCTQGFVGKNCQININDCIPDPCQNGGWCCC---DLVNDWICQCPKGWTGKNCTEDVDE-CAPQPCKNGATCNNL--FNNYTCTCAAGYTGINCTENIDDC----NGVVCQNGGNCVD-GVNGYKCSCAPGYTGSNCETDINECAVNSCQNGGNCTDLVNGFSCTCAPGYTGHRCETDIDDCASAPCRNGGTCTDQVNGYRCQCALGFVGSYCQININDCDPNP--CGNGGTCTDQLNAYLCTCPPGYTGSKCEIDINECASFPCQNGGSCTDQVNGY--TCSCAAGYSGVNCEINADDCQSMPCLNGGSCKDKVDAYECTCPLGYTGLRCETDINDCQPNPCLNGGSCTDRVNGYTCACAP 371          

HSP 5 Score: 63.5438 bits (153), Expect = 4.014e-10
Identity = 45/125 (36.00%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC 1195
            W G  C  +++ C+ N PC NGG C +   E   Y C C +G+ G  CE  ID C  NPC  G TC      + C C   + G  C++D   C    C NGG C  D   +  C C  G+ G  C
Sbjct:  411 WTGDQCTINVDECSSN-PCVNGGTCND---EAGGYTCTCAAGYTGLHCETDIDECRTNPCLNGATCTDKVNSYTCTCAPGYAGVHCEKDEDDCASKPCLNGGTC-TDLLADFECACVLGFIGKTC 530          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO34086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQB0])

HSP 1 Score: 312.768 bits (800), Expect = 5.222e-94
Identity = 209/578 (36.16%), Postives = 285/578 (49.31%), Query Frame = 2
Query:  845 CDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSEC-HLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            C +++N C + NPC NG  C   L ++  Y C+CPSG+ G +C ++   C  NPC+ G TC+   G + C C   +TG  C  +   C    C+NG  C    N +  C C  G+ G  C H    C +  CKH   C+     +  + C+C  GYTG  C   IN C  +PC+N   C D ++ Y+C+CS  F G NC  NI  C + PCKNG  C +    YTC C TG+TG NC +    CS NPC NGA C      + C C   F             +++C +  D C+            N C    TC+     K+ C C  GF   +C  +IDDC TNPC+NG  C+D IN + C C  GF  +TC    D C  +PC N   C+    +  N + C C   +  + C       C +NPC NG +C  +  +N + C C  G+ G  CQ  +ID    R    C N G CI+   N + C C PG+ G++C ++ +EC   PC NGG CID++  Y C CA G+   NC +  DECAS PC  GA C DR+  + C C  G  GK C+
Sbjct:    7 CSENINEC-DPNPCLNGATC---LDKIADYACVCPSGYSGINCSVNVNDCRTNPCENGGTCIDLIGGYACTCAPGFTGVNCSVNIDDCASRPCKNGATCNDGVN-SYTCSCAAGFSGKNCSHNIDDCFSMPCKHGATCK---DGVAGWTCVCSAGYTGATCGTNINNCAFSPCENGATCIDLVDGYRCSCSVGFTGTNCSTNIDDCYSDPCKNGASCVDGINRYTCVCPTGFTGFNCSLNIDDCSTNPCRNGATCVDGINKYSCTCPAGFT------------DQTCSTNIDDCAT-----------NPCRNGATCI-DGINKYSCTCPAGFTDQTCSTNIDDCATNPCRNGATCVDGINKYSCTCPIGFTDQTCSTNIDDCATNPCRNGATCV----DGINKYSCTCPIGFTDQTCSTNIDD-CATNPCGNGATC--VDEINKYSCLCPAGFSGGNCQ-TNIDECASRP---CANGGSCIDR-INSYECTCVPGYTGRNCQVDIDECESKPCVNGGTCIDRVAGYSCACAVGYTDQNCSVEIDECASNPCLNGATCTDRLGGYACSCIPGFTGKNCE 540          

HSP 2 Score: 283.878 bits (725), Expect = 1.004e-83
Identity = 191/551 (34.66%), Postives = 263/551 (47.73%), Query Frame = 2
Query: 1076 CDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC------QNCACDRGKVTCESVPC 2704
            C ++ + CD N C NG  C  D+  +  C+C  GY G  C +    C  + C++   C      +G Y C C PG+TG  C   I++C   PCKN   C D +N Y C+C+  F GKNC  NI  C + PCK+G  C++   G+TC C  GYTG  C      C+ +PC NGA C  +   + C C+  F G  C  +   C ++ C                        K G        ++ C C  GF G +C ++IDDC TNPC+NG  C+D IN + C C  GF  +TC    D C  +PC N   C+    +  N + C C   +  + C       C +NPC NG +C  +  +N + C C  G+    C     D       N C+N   C++ G N ++C C  GF  + C  N ++C  NPC NG  C+D++N Y C+C  GF G NCQ N DECAS PCA G  C+DRI+ +EC C  G  G+ C  V  +E    P CV      D    +S  C      QNC+ +  +  C S PC
Sbjct:    7 CSENINECDPNPCLNGATC-LDKIADYACVCPSGYSGINCSVNVNDCRTNPCENGGTCI---DLIGGYACTCAPGFTGVNCSVNIDDCASRPCKNGATCNDGVNSYTCSCAAGFSGKNCSHNIDDCFSMPCKHGATCKDGVAGWTCVCSAGYTGATCGTNINNCAFSPCENGATCIDLVDGYRCSCSVGFTGTNCSTNIDDCYSDPC------------------------KNGASCVDGINRYTCVCPTGFTGFNCSLNIDDCSTNPCRNGATCVDGINKYSCTCPAGFTDQTCSTNIDDCATNPCRNGATCI----DGINKYSCTCPAGFTDQTCSTNIDD-CATNPCRNGATC--VDGINKYSCTCPIGFTDQTCSTNIDDCA----TNPCRNGATCVD-GINKYSCTCPIGFTDQTCSTNIDDCATNPCGNGATCVDEINKYSCLCPAGFSGGNCQTNIDECASRPCANGGSCIDRINSYECTCVPGYTGRNC-QVDIDECESKP-CVNGGTCIDRVAGYSCACAVGYTDQNCSVEIDE--CASNPC 513          

HSP 3 Score: 145.976 bits (367), Expect = 1.298e-36
Identity = 93/260 (35.77%), Postives = 129/260 (49.62%), Query Frame = 2
Query: 1820 GFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID--FQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            GF   +C  +I++C  NPC NG  C+D I ++ C+C +G+ G  C    + C  +PC N G C+    +L   + C C   + G  C +     C S PC NG +C+    +N + C C  G+ G  C     D    PC+    CK+       G   +TC C  G+ G  C  N N C  +PC NG  CID ++ YRC C+ GF G+NC  N D+C S PC  GA CVD I+ + C CP G  G  C    ++ S  P
Sbjct:    1 GFHSTNCSENINECDPNPCLNGATCLDKIADYACVCPSGYSGINCSVNVNDCRTNPCENGGTCI----DLIGGYACTCAPGFTGVNCSVNIDD-CASRPCKNGATCN--DGVNSYTCSCAAGFSGKNCSHNIDDCFSMPCKHGATCKD-------GVAGWTCVCSAGYTGATCGTNINNCAFSPCENGATCIDLVDGYRCSCSVGFTGTNCSTNIDDCYSDPCKNGASCVDGINRYTCVCPTGFTGFNCSLNIDDCSTNP 246          

HSP 4 Score: 87.8113 bits (216), Expect = 9.579e-18
Identity = 58/165 (35.15%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  839 QFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDK 1321
            Q C  +++ CA N PC NG  C   + E+  Y C+CP+GF G +C+  ID C   PC   G+C+     + C C+  +TG+ C  D   C+   C NGG C  D      C C  GY    C +    C ++ C +   C  +   LG Y C C PG+TGK C+ 
Sbjct:  385 QTCSTNIDDCATN-PCGNGATC---VDEINKYSCLCPAGFSGGNCQTNIDECASRPCANGGSCIDRINSYECTCVPGYTGRNCQVDIDECESKPCVNGGTC-IDRVAGYSCACAVGYTDQNCSVEIDECASNPCLNGATCTDR---LGGYACSCIPGFTGKNCET 541          
BLAST of Delta-like protein vs. Ensembl Nematostella
Match: EDO39165 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB01])

HSP 1 Score: 330.487 bits (846), Expect = 5.563e-94
Identity = 227/683 (33.24%), Postives = 323/683 (47.29%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI---------------------------------------ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPC-------------------------------------LNGAYCYTINQDFY-CHCNKEFWGKRCEHSRPYCGNESC---ESAYDACSMPQMLNSSGIKHNYCG-----------KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQP 2593
            + G  C+  +N C+ ++PC NGG+C + L E   YKCICPSGF G +C+  ID C  +PCK G TC     EF CQC   + G+ C+ + + C   +C NG  C    N   +C C  G+ G  C +    C+++ C+H   C      +  Y+C+CQPGYTG+YC  +I+EC+  PC NNG+C D ++D+ C C T F GK+C +NI                                        C + PC+ GG C  +  GY C C  GYTG NCE     C  NPC                                      NG  C++ N  +Y C C K + G  CE    YC + SC    +  D  +    +   G     C              G         F C C  GF+G +C +DI++C T+PC N   C D ++ + C C +G+ G  CE   D C  SPC+N G+C+ ++    N F C C   +GG  C +     C + PCL+ G+C+    +N F C C  G+ G  C+    D  P    + C++ G C ++  N + CHC  GF+G  C+ + +EC  NPC N G C+D++ SY C+C  GF G+ C+ N D+CA+ PC   AIC D I+DF C CP G  G+ C    ++ +PQP
Sbjct:  158 YSGITCEVDVNECS-SSPCVNGGVCADGLGE---YKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNA-YQCTCLPGFTGRHCDVDIDECQSNPCQHGSACM---DGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCIDLVNDYKCSCLQGYTGKDCHIDINECSSNPCQYGGTCLNLLNGYACLCIDGYTGLNCEKDIDDCLFNPCHNGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYT----NYFECLCHPGYGGDRCEINIDD-CANKPCLHNGNCTDY--VNYFTCACAVGYTGRTCEVNIDDCSP----SPCRHGGSCQDL-VNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGYQGQTCAINVDDCTPQP 820          

HSP 2 Score: 319.701 bits (818), Expect = 2.489e-90
Identity = 204/588 (34.69%), Postives = 289/588 (49.15%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNN 2578
            + G  CD +++ C E++PC NG  CE+L+++   ++C CP+GF+GR C +D   C  +PC  +  C      + C C   +TG  C++D   C  + C NGG C  D      C+C  GY G  C +    C N  C H  +C   +  +  + C C  GYTG+ C+  I++C P+PC++ G C D +N Y C+C   FKG  CE +I  C   PC N G C +    Y C CK G+TGT CE     C+ +PCLN A C  +  DF+C C   + G+ C                        +N        C + GTC+      + C CMPGF G +C I++D+C + PC N G C+D  N   C C  GF G+ CE   D C  +PC NYG C     +L  DF C C   + G  C  P   +C+++PC N  +C R+  L G+ C C  G  G  C     D +PCR      N G C+ +  + + C C   F    C  + ++C    C NG  C+D  N+Y+C C +G+YG +C+L  D C S PC  GA CVD      C+C  G  G  C+   N+
Sbjct:  538 FTGTLCDVNVDEC-EDSPCANGASCEDLIND---FRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLC-VDYTNYFECLCHPGYGGDRCEINIDDCANKPCLHNGNC---TDYVNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICTDLINDFHCACPAGYQGQTC-----------------------AINVDDCTPQPCKQGGTCVD-AVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTC----QDLVADFTCHCYPGFTGETCATPI-DLCEAHPCQNNATC-RMDPLKGYSCSCPTGVTGRHCDVSICDSKPCR------NNGSCV-LTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSDNAYKCSCLEGYYGKHCEL-IDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNH 1079          

HSP 3 Score: 313.538 bits (802), Expect = 3.275e-88
Identity = 217/653 (33.23%), Postives = 307/653 (47.01%), Query Frame = 2
Query:  872 ENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID--FQPCRRKN-------------------------------LCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQN----CACDRGKVTCESVPC 2704
            +++ C NGG C    + +    C C  GF G+ CE  +D C    C  G TC+     F C C   + G LC+ + + C  N CQN   C +D   +  C C QG  G  C+     C++S CKH   CQ     LG + CLC+ GY+G  C+ ++NEC  +PC N GVC D + +YKC C + F G+NC++NI  C + PCKNG  C+++   + C+C+ G+ G NCE     C    C NG+ C  +   + C C   F G+ C+     C +  C+                        +G+        + C C PG+ G  C IDID+C + PC N G+C+D +++F C C  GF GK C    D C  +PC +   C+    +L ND+ C C   + G+ CH+  +  C SNPC  GG+C  L+ LNG+ C C  G+ G  C+    D  F PC                                   LC+N G C +     +TC C  G+ G  C+   N C  + C+    C+D  N+Y CIC +GF G+ C +N DEC   PCA GA C D I+DF C CP G  G+ C  V  NE    P C+   +  D    +   C++      C+R    C S PC
Sbjct:   19 QHDSCLNGGTCSEGSNSL---LCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATC-QDLINDFSCQCPQGITGQTCNTDIDECQSSPCKHQGTCQ---NYLGGFNCLCRHGYSGITCEVDVNECSSSPCVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQSNPCQ------------------------HGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDFHCTCPTGFSGKDCSVNIDDCADAPCQHGSTCI----DLVNDYKCSCLQGYTGKDCHIDINE-CSSNPCQYGGTC--LNLLNGYACLCIDGYTGLNCEKDIDDCLFNPCHNGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCLDGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTC-AVDINECATSP-CLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPC 631          

HSP 4 Score: 307.76 bits (787), Expect = 2.408e-86
Identity = 213/672 (31.70%), Postives = 309/672 (45.98%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAP-CENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD----------ACSMPQMLNSSGIKHNYCG----KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVC-----------------------------------QFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEG---------------------------------------KHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHV 2569
            + G+ C   +N C+ +NPC+ GG C NLL+    Y C+C  G+ G +CE  ID C  NPC  GTC      + C C +    + C  ++S+CD   C+NGG C  + +    C C +GY G +C      C++S C     C        +Y C+C  G+TG  CD  ++EC  +PC N   C D IND++C+C   F+G+ C ++I  C   PC N   C +V +GY C C++GYTGT CE     CS +PC+NG  C      F C C+  + G RCE +   C N+ C    +          AC++     +  +  + C     ++G         ++C C  GF+G  CE DID+C TNPC N G C+D + +++C+C  GF G  CE   D C  SPC+N  +C     +L NDF C C   + G+ C +     C   PC  GG+C  +  ++G+ C C  G+ G  C                                   QF  ++   C     C+N G C ++   DFTCHC PGF G                                       +HCD++   C+  PC N G C+   + Y+C+CA  F    CQ + D+C    C  GA CVD  + ++C C EG  GK C+ +
Sbjct:  386 YTGKDCHIDINECS-SNPCQYGGTCLNLLNG---YACLCIDGYTGLNCEKDIDDCLFNPCHNGTCEDLVNNYKCVCPDNRQERTCAGNSSVCDTYLCRNGGSCFSNNSTYYTCECPKGYTGHDCESKINYCKSSSCYGNATCL---DGANNYTCICPRGFTGTLCDVNVDECEDSPCANGASCEDLINDFRCHCPAGFQGRTCAVDINECATSPCLNEAKCTDVVSGYRCTCRSGYTGTRCERDIDECSSSPCVNGGLCVDYTNYFECLCHPGYGGDRCEINIDDCANKPCLHNGNCTDYVNYFTCACAVGYTGRTCEVNIDDCSPSPCRHGGSCQDLVNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAICT----DLINDFHCACPAGYQGQTCAINVDD-CTPQPCKQGGTC--VDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAP-CQNYGTCQDL-VADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSI--CDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSDNAYKCSCLEGYYGKHCELI 1039          

HSP 5 Score: 196.052 bits (497), Expect = 1.147e-50
Identity = 156/478 (32.64%), Postives = 225/478 (47.07%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCE--IDPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFY-CHCNKEFWGKRCE----HSRPYCGNESC---ESAY-----DACSMPQMLNS-SGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCI-----------KSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCH 2173
            + G+ C+ +++ C+ + PC++GG C++L   V  Y C CP+GF+G  CE  ID C  NPC   GTC+     + C C   +TG  C+ +   C  + C N   C  D   +  C C  GY+G  C +    C    CK    C     A+  Y CLC PG+TG  C  E++EC   PC NNG C D  N   C C+  F G+ CE+NI  C   PC+N G CQ++   +TC C  G+TG  C      C  +PC N A C       Y C C     G+ C+     S+P   N SC   +S Y      + + PQ   S    +H +C    TC+  +   + C C+ G+ G  CE+ ID C + PC+NG  C+D      C C  GF G  CE+  ++CI              C ++G C+         F+C C+  + G LC       C S+PC+ G + + +  ++ F C 
Sbjct:  690 YTGRTCEVNIDDCSPS-PCRHGGSCQDL---VNGYLCHCPAGFKGSKCETDIDECATNPCDNNGTCVDRVASYDCVCKPGFTGTRCEANIDDCATSPCLNNAIC-TDLINDFHCACPAGYQGQTCAINVDDCTPQPCKQGGTC---VDAVSGYTCLCMPGFTGINCSIEMDECGSYPCLNNGTCVDGRNRVTCTCAVGFTGQFCEVNIDDCDPAPCQNYGTCQDLVADFTCHCYPGFTGETCATPIDLCEAHPCQNNATCRMDPLKGYSCSCPTGVTGRHCDVSICDSKPCRNNGSCVLTQSGYQCLCASSFTSPQCQRSIDDCEHAHCLNGATCVDSDN-AYKCSCLEGYYGKHCEL-IDRCHSQPCQNGATCVDDDGVVFCKCAMGFTGTHCEKEFNHCIVRVADTNLTFPSRICGDHGTCVSKP----TGFLCVCQPGFTGLLCQTDIDD-CSSDPCV-GINVTCVDGIDTFTCQ 1151          

HSP 6 Score: 186.422 bits (472), Expect = 1.187e-47
Identity = 118/317 (37.22%), Postives = 168/317 (53.00%), Query Frame = 2
Query: 1715 MPQM-LNSSG--IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ 2656
            +P M + +SG   +H+ C   GTC S      +C C+PGF G SCE D+D+CK   C NG  CID +N+F+CIC  GF G  CE   + C  +PC N   C     +L NDF C+C     G+ C+      C S+PC + G+C     L GF C C  G+ G  C+   +D   C   + C N GVC + G  ++ C C  GF G++C +N +EC  +PC NG  C D ++ +RC C  GF G NC+ N +EC    CA G+ C+D ++ ++C C  G  G+ CD V  +E    P C + +   D   ++   CQ
Sbjct:    6 LPVMNIGASGRFCQHDSCLNGGTC-SEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCIDQVNSFKCICPVGFHGILCETNYNDCHSNPCQNNATC----QDLINDFSCQCPQGITGQTCNTDIDE-CQSSPCKHQGTCQNY--LGGFNCLCRHGYSGITCE---VDVNEC-SSSPCVNGGVCAD-GLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCETNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCD-VDIDECQSNP-CQHGSACMDGVSSYQCICQ 307          

HSP 7 Score: 159.844 bits (403), Expect = 1.829e-39
Identity = 120/356 (33.71%), Postives = 164/356 (46.07%), Query Frame = 2
Query: 1859 CKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWP-GESHKDCQPN 2911
            C+ + C NGG C +  N+  C C  GF G++CE   D C    C N   C+    +  N F C C   + G LC    ++ C SNPC N  +C  L  +N F C C QG  G  C   + D   C+  + CK++G C N     F C C+ G+ G  C+++ NEC+ +PC NGG C D L  Y+CIC  GF G NCQ+N DECAS PC  GA C D +D+F C+C  G  G+ C+   N       +C   +   D    +   C        CD     C+S PC   +      +     C+PG        +   C   PC+    C+   S +     + P G S KDC  N
Sbjct:   18 CQHDSCLNGGTCSEGSNSLLCSCLPGFTGQSCETDVDECKLVQCHNGATCI----DQVNSFKCICPVGFHGILCET-NYNDCHSNPCQNNATCQDL--INDFSCQCPQGITGQTC---NTDIDECQ-SSPCKHQGTCQNY-LGGFNCLCRHGYSGITCEVDVNECSSSPCVNGGVCADGLGEYKCICPSGFSGENCQVNIDECASSPCKNGATCEDLVDEFRCQCQPGFKGQNCE--TNINECIGAACANGSTCIDLVNAYQCTCLPGFTGRHCDVDIDECQSNPCQHGSACMDGVSSYQCICQPGYTGQYCHIDIDECLSRPCLNNGMCLDLVSDF---HCTCPTGFSGKDCSVN 356          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000022382.2 (protein jagged-2 [Source:NCBI gene;Acc:101163046])

HSP 1 Score: 465.307 bits (1196), Expect = 8.865e-172
Identity = 309/873 (35.40%), Postives = 427/873 (48.91%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH---IDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCL----QANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARC-IKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGG  CD+ LNYC  N PCKNGG C N  +E   Y C CP G+ G++C+I    C  NPC   GTC +    F C C   W+G  C +DT  C  N C +GG C   EN N  C+C   + G  C +    C    C +A  C+     +G Y C+C  G+ G+ CD  +N C    C+N G C +S N Y+C C   F G++CE+    C + PCKNGG C  +   + C+C  G+TG  CE+    C PNPC N A C+    DFYC C+ E  GK C  ++ +C   +C  A D+C++    N +      I  N C  +G C+S     F C C  GF G  C  +I+DC +NPCKNGG CID IN+F CIC  G+ G  C+   + C + PC N G C+    +L NDF C C +NW G+ CH  + S CDSN C NGG+C      + F C C  GW G  C        D  P      C+N G C+  G + FTC CK G+EG  C  N ++C P+PC+NGG CID +N +RC CA GF G +C++N DEC S PCA G+ CVD I+ + C CP G+ G  C  +     P    C +    +  G  W   C +C C  G V C  V CG   CL     +       AC  G  C   PF    C  PPC     C   + S  P          H  C+PNS    N CA + L FNK  +P G T++ +C  +K L   + L        L I CD++   S  V VA+ +   + +   + K        ++G ++K       +N++ F  ++++ +    +  +      L+  L V      +  ++   W  +++
Sbjct:  291 NWGGLLCDKDLNYCGTNWPCKNGGTCMN--TEPDEYNCACPDGYSGKNCQIVEHACVSNPCANGGTCHEVPSGFECHCPPGWSGPTCAKDTDECSSNPCAHGGTCIDMEN-NFECLCTPSWTGKTCQIDINECAGKPCLNAYSCK---NFIGGYHCICFRGWVGQNCDINLNSC-HGQCQNGGACKESANGYQCVCQPGFVGRHCEVQRNLCSSGPCKNGGHCHALLDHFLCECPQGFTGATCEVQNDPCRPNPCHNKAQCFRRLNDFYCSCSNEHEGKTCSEAKDHCKTNTC-LAIDSCTVGVFTNDTQQLVRRISSNVCRPHGRCISLTAGNFSCSCDSGFTGLYCHENINDCASNPCKNGGTCIDGINSFRCICPGGWEGLLCDSEVNECSRLPCQNGGQCV----DLLNDFYCNCVDNWKGKTCH-SRESHCDSNTCNNGGTC--YDHGDSFVCSCPAGWGGRTCSTGKNNSCDSSP------CENGGTCVGAG-DSFTCICKEGWEGLTCTQNVDDCKPHPCYNGGICIDGVNWFRCECAPGFAGPDCRINIDECQSSPCADGSTCVDEINRYLCVCPPGKAGPRCHEMIEVVKP----CRHSGLQYPHGSQWEEECNSCQCVNGDVHCTKVRCGRRPCLLEKSSSAAETSAQACPGGHECVQHPF--LTCLSPPCRQWGVCSAPDPSPAP----------HTQCEPNSGYLDNRCAHVTLIFNKDKIPQGTTVESVCWELKYLPVTRML---ATEHVLLILCDLSYLRSDAVEVAMSFENNKQLKESDCKQVEKAVGAITGALSK------HHNSSIFAAVMEVNVE---MRVECPSVGYLVPVLCVVFSLLWIFCIVICVWRIQRR 1113          

HSP 2 Score: 160.614 bits (405), Expect = 8.865e-172
Identity = 93/287 (32.40%), Postives = 138/287 (48.08%), Query Frame = 3
Query:   12 IFCFL-EIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYK---------FTIKSSWPGSITLIIEAYD--TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            + CFL  ++    +    F L++        Q L G CC    S     C    C   F +CL+ Y   V+       TG C YG  +T+++G +  +F  +                  + +WP + T+I+EA+D   S  +   + +I+R ++K  + P         V      +  Q+++ + C   YYG  C++ C+      GHY CD +G + C  GW G DC   IC+PGCH IHG C  PGEC+C+ GW G  CD+C+ YPGC HGTC + PW CSCE
Sbjct:   13 VVCFLLTVWAEVSQCTGYFELQLLSLDNPRGQLLSGDCCDSTRSAAGGFCGEDECDTYFRVCLKEYQTEVT------TTGACTYGSEITKVFGGNIFRFKSDQKSGQNRNHDAGKIVIPFQFAWPRAYTVIVEAWDWDNSTHSSDEELLIERSIHKGMINPGEEKQT---VEHKTSVTSMQYTVRVRCHEHYYGSKCNQVCRPRDDYFGHYVCDQSGNRNCMEGWTGPDCKTAICKPGCHSIHGTCSVPGECKCKYGWDGLLCDQCLPYPGCFHGTC-NEPWECSCE 289          

HSP 3 Score: 249.98 bits (637), Expect = 2.861e-67
Identity = 182/522 (34.87%), Postives = 240/522 (45.98%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPN-PCKNNGVCTDSIND-YKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYD----------ACSMPQMLNSSGIKHNYCG---KYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRR--KNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            C+E WTG  C   T+IC        G C         C C+ G+ G  C         QC     C    T    ++C C+  + G  CDK++N C  N PCKN G C ++  D Y C C   + GKNC++   AC + PC NGG C EV +G+ C C  G++G  C      CS NPC +G  C  +  +F C C   + GK C+     C  + C +AY            C    +  +  I  N C    + G         + C C PGF G  CE+  + C + PCKNGG C   +++F C C  GF G TCE + D C  +PC N   C R      NDF C C N   G+ C   K   C +N CL   SC                   TV  F +   Q  RR   N+C+  G CI++   +F+C C  GF G +C  N N+C  NPC NGG CID +NS+RCIC  G+ G  C    +EC+  PC  G  CVD ++DF C C +   GK C
Sbjct:  224 CMEGWTGPDCK--TAICKPGCHSIHGTCSVP----GECKCKYGWDGLLC--------DQCLPYPGC-FHGTCNEPWECSCEKNWGGLLCDKDLNYCGTNWPCKNGGTCMNTEPDEYNCACPDGYSGKNCQIVEHACVSNPCANGGTCHEVPSGFECHCPPGWSGPTCAKDTDECSSNPCAHGGTCIDMENNFECLCTPSWTGKTCQIDINECAGKPCLNAYSCKNFIGGYHCICFRGWVGQNCDINLNSCHGQCQNGGACKESANGYQCVCQPGFVGRHCEVQRNLCSSGPCKNGGHCHALLDHFLCECPQGFTGATCEVQNDPCRPNPCHNKAQCFRR----LNDFYCSCSNEHEGKTCSEAKDH-CKTNTCLAIDSC-------------------TVGVFTNDTQQLVRRISSNVCRPHGRCISLTAGNFSCSCDSGFTGLYCHENINDCASNPCKNGGTCIDGINSFRCICPGGWEGLLCDSEVNECSRLPCQNGGQCVDLLNDFYCNCVDNWKGKTC 706          

HSP 4 Score: 113.62 bits (283), Expect = 6.866e-25
Identity = 88/253 (34.78%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1811 CMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNF--ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            CM G+ G        DCKT  CK G   I    +   EC C  G+ G  C    D C+  P   +G C          + C C+ NWGG LC    +    + PC NGG+C   +  + + C C  G+ G  CQ +      C   N C N G C  V  + F CHC PG+ G  C  +T+EC+ NPC +GG CID  N++ C+C   + G  CQ++ +ECA  PC     C + I  + C C  G  G+ CD
Sbjct:  224 CMEGWTGP-------DCKTAICKPGCHSIHGTCSVPGECKCKYGWDGLLC----DQCLPYPGCFHGTC-------NEPWECSCEKNWGGLLCDKDLNYCGTNWPCKNGGTCMN-TEPDEYNCACPDGYSGKNCQIVE---HAC-VSNPCANGGTCHEVP-SGFECHCPPGWSGPTCAKDTDECSSNPCAHGGTCIDMENNFECLCTPSWTGKTCQIDINECAGKPCLNAYSCKNFIGGYHCICFRGWVGQNCD 452          

HSP 5 Score: 81.6481 bits (200), Expect = 1.386e-18
Identity = 61/186 (32.80%), Postives = 90/186 (48.39%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGV 1366
            +NW G+ C    ++C ++N C NGG C         + C CP+G+ GR C     + C  +PC+  GTC+ +   F C C E W G  C Q+   C  + C NGG C    N   RC C  G+ G +C +    C++S C     C  +   +  Y C+C PG  G  C + I   V  PC+++G+
Sbjct:  699 DNWKGKTCHSRESHC-DSNTCNNGGTC---YDHGDSFVCSCPAGWGGRTCSTGKNNSCDSSPCENGGTCVGAGDSFTCICKEGWEGLTCTQNVDDCKPHPCYNGGICIDGVNW-FRCECAPGFAGPDCRINIDECQSSPCADGSTCVDE---INRYLCVCPPGKAGPRCHEMIE--VVKPCRHSGL 874          

HSP 6 Score: 32.3426 bits (72), Expect = 1.386e-18
Identity = 25/70 (35.71%), Postives = 31/70 (44.29%), Query Frame = 3
Query:  624 CDYGWMG-------SDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCD----ECMKYPGCKHGTCVD 800
            CD G+ G       +DC +  C+ G   I G   N   C C  GW+G  CD    EC + P    G CVD
Sbjct:  621 CDSGFTGLYCHENINDCASNPCKNGGTCIDGI--NSFRCICPGGWEGLLCDSEVNECSRLPCQNGGQCVD 688          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 457.988 bits (1177), Expect = 3.474e-168
Identity = 316/934 (33.83%), Postives = 458/934 (49.04%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQY-PIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHP 3595
            NWGG  CD+ LNYC    PC NGG C N   +   Y+C C  G+ G +CE     C  NPC  G +C ++   + C+C   W+G  C  +   C  N C +GG C    NG  +C C   + G  C + A  C++  C +A  C+     +G Y C C PG+ G+ CD  IN+C  + C+N G C D +N Y+C C   F G+ CE ++  C + PC NGG CQ+   G+ C C TG++G  C++    CS NPC NGA C+    D+ C C +++ G+ C H + +C   +C +  D+C++    NS+      I  N CG +G C S    +F C C  GF G  C  +I+DC++NPC NGG CID ++ ++CIC +G+ G+ CE   D C  SPC N G C     +L  DF CECKN W G+ CH  + S CD   C NGG+C      + FQC C+ GW GT C   +I        N C+N G C+  G   FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA G+ CVD I+ + C CP  R G  C  +          C     +   G  W  +C +C C  GKV C  + CG   C    G      C  G+ C   P     CFV PC+    C      + +N  + P      C P+S    + CA I  TFNK  +P G+T++ +C+ ++ L  +++ +     +SL I+CD + + S  ++V I +       D   +  P       +I   L+     NNT  + +V++ + +           +   YL+  + +  +++ +          +  R K +N    + N  +    N VR Q   I  P  ++  LT     YE    N  S  A  +  HP
Sbjct:  282 NWGGHLCDKDLNYCGTRQPCLNGGTCINTGPD--KYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCAPGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNG-YKCHCPSQWTGKTCLIDANECDSKPCVNANSCR---NLIGGYFCECLPGWMGQNCDININDC-KDQCQNGGTCKDLVNGYRCLCPPGFTGELCERDVDECASSPCLNGGRCQDEVNGFQCLCLTGFSGNLCQLDIDYCSQNPCQNGAPCFNRANDYVCACPEDYEGRNCSHLKDHCRTTTC-TVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTCR----DLVTDFFCECKNGWKGKTCH-SRESQCDEATCNNGGTCHDEG--DTFQCRCSPGWEGTTC---NIAKNSSCLPNPCENGGTCVVKG-ESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCALGSTCVDEINGYRCLCPPDRTGSHCQKLTKKH------CSVNGHVAADGTKWEEDCNSCQCSNGKVVCTKMWCGPRPCTP--GGKGRGGCPLGQSC--LPIRDGHCFVKPCLDVGEC------WHSNVKAQP---PIKCHPSSSYQDSSCANITFTFNKDIMPSGLTVEGVCNQLRHLNVVKNFS---LEQSLFITCDPSFSASNEIHVCISTE------DHSLDRSPIKEITDMIID--LVSKRNGNNTIISAIVEVRVPS----------PSKTDYLVPLLSSIFIVIWVLVLVSVLLWCMRRRRKQSNHNGTSANGSEDNTTNNVREQLNQIKNPIEKHVGLTVAIKDYE----NKNSIIAKIRTNHP 1152          

HSP 2 Score: 155.992 bits (393), Expect = 3.474e-168
Identity = 94/284 (33.10%), Postives = 140/284 (49.30%), Query Frame = 3
Query:    9 IIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNK-------ESTHSYKFTIKSSWPGSITLIIEAYD-TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
             + CFL       E   +F ++I      + +  +G CC    +     CT   C   F +CL+ Y + VS   P      C++G   T + G ++  F         ES     F+   +WP S TLI+EA+D T+ET+     +I++      + PS    +W     +   + +++ + + C   Y+G  C+++C+      GHY CD NG K C  GW G DCN  IC+ GC   HG C+ PG C C  GWQG +CD+C+ +PGC HGTCV+ PW C CE
Sbjct:   12 FLLCFLLKVS---EGTGKFEIQILSMHNANGELQNGLCCDGTRNAADRKCTRDECDTFFKVCLKEYQSRVSAAGP------CSFGVGSTPVLGGNTFSFKSAVGNDITESLIVLPFSF--AWPRSYTLIVEAWDFTNETSGAEGKLIEKASLSGMINPS---QIWQRRTHNGPIAQFEYQIRVRCDDHYFGFGCNKFCRPRDEFFGHYTCDGNGNKTCLEGWSGPDCNTAICRQGCSTEHGLCKEPGGCDCLYGWQGQYCDKCIPHPGCVHGTCVE-PWQCLCE 280          

HSP 3 Score: 272.707 bits (696), Expect = 1.210e-74
Identity = 209/634 (32.97%), Postives = 293/634 (46.21%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E W+G  C+  T+IC Q      G C K+  G   C C  G++G  C    P  +  C H        T +  ++CLC+  + G  CDK++N C    PC N G C ++  D Y+C C+  + G NCE    AC + PC NGG C E   GY C+C  G++G +C +    CSPNPC +G  C  +   + CHC  ++ GK C      C ++ C +A ++C             N  G Y            C C+PG+ G +C+I+I+DCK + C+NGG C D +N + C+C  GF G+ CE   D C  SPC+N G C    DE+ N F C C   + G LC L     C  NPC NG  C   +  N + C C + + G  C  L  H     C                        N+C   G C +     FTC C+ GF G +C  N N+C  NPC NGG CIDK++ Y+CICA G+ G +C++N D+C++ PC  G  C D + DF C C  G  GK C H + ++  +  +C       D G+T+   C    +   C+  K  +C   PC         G      CK G    +   N   C   PC     C+   + Y
Sbjct:  215 CLEGWSGPDCN--TAICRQGCSTEHGLC-KEPGG---CDCLYGWQGQYCDKCIP--HPGCVHG-------TCVEPWQCLCETNWGGHLCDKDLNYCGTRQPCLNGGTCINTGPDKYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCAPGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNGYKCHCPSQWTGKTCLIDANECDSKPCVNA-NSC------------RNLIGGY-----------FCECLPGWMGQNCDININDCK-DQCQNGGTCKDLVNGYRCLCPPGFTGELCERDVDECASSPCLNGGRC---QDEV-NGFQCLCLTGFSGNLCQL-DIDYCSQNPCQNGAPC--FNRANDYVCACPEDYEGRNCSHLKDHCRTTTCTVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTCRDLVTDFFCECKNGWKGKTC-HSRESQCDE-ATCNNGGTCHDEGDTFQCRCSPGWEGTTCNIAKNSSCLPNPCENGGTCVVKGESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWY 799          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000040656.1 (protein jagged-1a [Source:NCBI gene;Acc:101169088])

HSP 1 Score: 442.58 bits (1137), Expect = 2.737e-164
Identity = 293/866 (33.83%), Postives = 436/866 (50.35%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNS--SGIK---HNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGA--YWYHRKK 3388
            N+GGQ CD+ LN C    PC NGG C N   +   Y C CP GF G +C+I    C   PC   G+C ++   F C C   WTG LC  +   C +N C +GG C +D     RCIC   + G  C + A  C+++ C +A  C+     +G Y C C PG+ G+ C   IN+C    C+N   C D +N YKC C+  F G++CE ++  C + PC NGG C +    + C C  G++G  C++    C  +PCLNG  C+    D+ C C +++ GK C   R +C   SC+   D+C++    NS  SG++    + C  +G C SH   +F CRC  GF G  C  +I+DC+  PC NGG CID ++ + CIC  G+ G TCE   D C  +PC N GVC     +L NDF C+C + W G+ C   + S CD   C NGG+C      + F+C C  GW G+ C   +I        N C+N G C+ V  + F C C+ G EG  C  N N+C P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA+G+ CVD ID + C CP GR G LC    +        CV+       G  W+ +C +C C  G+VTC  + CG   C   +  +    C  G+ C +     + CFV PCV + +C             W G +H+   P+   + + CA +  TFNK  +  G+T++ +C  +++L  I++L+      S+ ++C+ +   +  + V I +  +   +  +K            +   + DV+   +T  T L  IT    +    S D +  +  LLV ++     + +G+   W  +++
Sbjct:  288 NYGGQLCDKDLNTCGTRQPCLNGGTCSNTGPD--KYHCSCPKGFSGVNCQIAEHACLSGPCLNGGSCTENSRGFECLCAPGWTGPLCSINVDECLENPCSHGGTC-QDLVSGFRCICPPQWTGKTCLIDANECDDNPCVNAKSCR---NLIGGYFCQCLPGWRGQSCSININDC-HGQCQNGATCKDLVNGYKCECAPGFGGEHCERDLDDCASGPCLNGGSCHDRVNDFHCLCPPGFSGRRCQLDIDFCLDSPCLNGGQCFNSVDDYICECPEDYEGKNCSRLRDHCLTASCK-VIDSCTVAVASNSTPSGVRLITSSVCRPHGQCQSHANGQFSCRCEEGFSGTYCHENINDCEIAPCLNGGTCIDEVSRYRCICPKGWEGPTCENNIDDCSSAPCQNRGVC----QDLTNDFYCKCGDGWKGKTCS-SRESQCDDVTCNNGGTC--YDEGDAFKCLCPAGWEGSTC---NIAKNSSCLPNPCENGGTCV-VDGDSFRCICREGLEGPTCTQNANDCQPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGSTCVDEIDGYRCVCPAGRTGPLCQEAADRP------CVHGGVKALHGSRWNEDCNSCRCLNGRVTCTKLWCGPKPC-SLHSQNLAADCPAGQSCIA--VRDEHCFVKPCVGQGQC-------------W-GHTHRATPPSGCHSESSCANVTFTFNKDIMAKGVTVEQVCHELRSLYAIKNLSSD---SSVSVACEPSLRANNEIQVTIITDDQRRGLTLIKE-----------VTDRVTDVVSKRSTNSTILQAIT-EVRIQRRPSQDPSGYLMPLLVSMVILVWALAVGSVLLWCLKRR 1096          

HSP 2 Score: 158.303 bits (399), Expect = 2.737e-164
Identity = 91/267 (34.08%), Postives = 134/267 (50.19%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFN--KESTHSYKFTIKSSWPGSITLIIEAYD---TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            +   F L+I      + Q  +G CC    SV+   CT   C   F +CL+ Y   VSP       G C++G   T + G +   F   K S          +WP S TLI+EA D    S +     A+I++ ++   + PS     W  +  +   + + F + L C   Y+G  C+++C+      GH+ CD NG K C  GW G +CN  IC+ GC   HG+C+ PGEC+C  GWQG  CD+C+ +PGC +G+CV+ PW C C+
Sbjct:   30 ASGHFELRILSVQNKNGQLQNGACCDGSSSVLNGRCTGGQCDTYFRVCLKEYQLKVSP------VGPCSFGTASTPVLGGNIFSFVNFKNSKARILLPFSFAWPRSYTLILEALDFNNDSLSGSVGGALIEKAIHSGMITPS---PQWQKLEHNGPVAQFHFQVRLRCDEHYFGFGCNKFCRPRDDFFGHHMCDHNGNKTCLEGWSGPNCNAAICKQGCSTEHGFCKVPGECKCLYGWQGQHCDQCIPHPGCVNGSCVE-PWQCLCD 286          

HSP 3 Score: 233.802 bits (595), Expect = 4.287e-62
Identity = 166/515 (32.23%), Postives = 247/515 (47.96%), Query Frame = 2
Query: 1139 DENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNC--ELNIACQNQPCKNGGVCQEVDTG-YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCE---------SAYDACSMPQ------MLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLC 2560
            D NGN+ C+  +G+ G  C+ A   +    +H   C++        +C C  G+ G++CD    +C+P+P   NG C   +  ++C C T++ G+ C  +LN     QPC NGG C       Y C C  G++G NC+I +  C   PCLNG  C   ++ F C C   + G  C  +   C    C          S +     PQ      +++++    N C    +C  +    + C+C+PG+ G SC I+I+DC    C+NG  C D +N ++C C  GF G+ CE   D C   PC+N G C     +  NDF C C   + GR C L     C  +PCLNGG C   ++++ + C C + + G  C  L  H     C+                       ++C+  G C +     F+C C+ GF G +C  N N+C   PC NGG CID+++ YRCIC KG+ G  C+ N D+C+S PC    +C D  +DF C+C +G  GK C
Sbjct:  214 DHNGNKTCL--EGWSGPNCNAAICKQGCSTEHGF-CKVPG------ECKCLYGWQGQHCD----QCIPHPGCVNGSC---VEPWQCLCDTNYGGQLCDKDLNTCGTRQPCLNGGTCSNTGPDKYHCSCPKGFSGVNCQIAEHACLSGPCLNGGSCTENSRGFECLCAPGWTGPLCSINVDECLENPCSHGGTCQDLVSGFRCICPPQWTGKTCLIDANECDDNPCVNAKSC-RNLIGGYFCQCLPGWRGQSCSININDCHGQ-CQNGATCKDLVNGYKCECAPGFGGEHCERDLDDCASGPCLNGGSC----HDRVNDFHCLCPPGFSGRRCQL-DIDFCLDSPCLNGGQC--FNSVDDYICECPEDYEGKNCSRLRDHCLTASCKVIDSCTVAVASNSTPSGVRLITSSVCRPHGQCQSHANGQFSCRCEEGFSGTYCHENINDCEIAPCLNGGTCIDEVSRYRCICPKGWEGPTCENNIDDCSSAPCQNRGVCQDLTNDFYCKCGDGWKGKTC 703          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: jag1b (jagged canonical Notch ligand 1 [Source:NCBI gene;Acc:101168394])

HSP 1 Score: 445.277 bits (1144), Expect = 3.349e-157
Identity = 307/916 (33.52%), Postives = 433/916 (47.27%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQY-PIMRPTVQNKHLTEPPNFYE 3541
            NWGG  CD+ LNYC    PC NGG C N   +   Y+C C  G+ G +CE     C  NPC  G +C ++   + C+C   W+G  C  +   C  N C +GG C    NG  +C C   + G  C + A  C++  C +A  C+     +G Y C C PG+ G+ CD  IN+C  + C+N G C D +N Y+C C   F G+ CE ++  C + PC NGG CQ+   G+ C C TG++G  C++    CS NPC NGA C+    D+ C C +++ G+ C H + +C   +C +  D+C++    NS+      I  N CG +G C S    +F C C  GF G  C  +I+DC++NPC NGG CID ++ ++CIC +G+ G+ CE   D C  SPC N G C     +L  DF CECKN W G+ CH  + S CD   C NGG+C      + FQC C+ GW GT C   +I        N C+N G C+  G   FTC CK G+EG  C  NTN+C+P+PC+N G C+D  N YRC CA GF G +C++N +EC S PCA G+ CVD I+ + C CP  R G  C  +          C     +   G  W  +C +C C  GKV C  + CG   C    G      C  G+ C   P     CFV PC+    C      + +N  + P      C P+S    + CA I  TFNK  +P               +  ++ N  P G+    S       ST  +  I   +     D   +  P       +I   L+     NNT  + +V++             R     YL+  + +  +++ +          +  R K +N    + N  +    N VR Q   I  P  ++  LT     YE
Sbjct:  256 NWGGHLCDKDLNYCGTRQPCLNGGTCINTGPD--KYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCAPGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNG-YKCHCPSQWTGKTCLIDANECDSKPCVNANSCR---NLIGGYFCECLPGWMGQNCDININDC-KDQCQNGGTCKDLVNGYRCLCPPGFTGELCERDVDECASSPCLNGGRCQDEVNGFQCLCLTGFSGNLCQLDIDYCSQNPCQNGAPCFNRANDYVCACPEDYEGRNCSHLKDHCRTTTC-TVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTCR----DLVTDFFCECKNGWKGKTCH-SRESQCDEATCNNGGTCHDEG--DTFQCRCSPGWEGTTC---NIAKNSSCLPNPCENGGTCVVKG-ESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCALGSTCVDEINGYRCLCPPDRTGSHCQKLTKKH------CSVNGHVAADGTKWEEDCNSCQCSNGKVVCTKMWCGPRPCTP--GGKGRGGCPLGQSC--LPIRDGHCFVKPCLDVGEC------WHSNVKAQP---PIKCHPSSSYQDSSCANITFTFNKDIMPSVSF----------AEAQREKNKQPMGQFSSFS-------STFTHYQIEQKIST--EDHSLDRSPIKEITDMIID--LVSKRNGNNTIISAIVEV-------------RVPSPNYLVPLLSSIFIVIWVLVLVSVLLWCMRRRRKQSNHNGTSANGSEDNTTNNVREQLNQIKNPIEKHVGLTVAIKDYE 1099          

HSP 2 Score: 132.109 bits (331), Expect = 3.349e-157
Identity = 82/267 (30.71%), Postives = 123/267 (46.07%), Query Frame = 3
Query:   69 LKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNK-------ESTHSYKFTIKSSWPGSITLIIEAYDT---SETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCEI 827
            ++I      + +  +G CC    +     CT   C   F +CL+ Y + VS        G C++G   T + G ++  F         ES     F+   +WP S  +I          E       +I++      + PS    +W     +   + +++ + + C   Y+G  C+++C+      GHY CD NG K C  GW G DCN  IC+ GC   HG C+ PG C C  GWQG +CD+C+ +PGC HGTCV+ PW C CE 
Sbjct:    1 IQILSMHNANGELQNGLCCDGTRNAADRKCTRDECDTFFKVCLKEYQSRVS------AAGPCSFGVGSTPVLGGNTFSFKSAVGNDITESLIVLPFSF--AWPVSGDIISPPQKNFFFKENKSAEGKLIEKASLSGMINPS---QIWQRRTHNGPIAQFEYQIRVRCDDHYFGFGCNKFCRPRDEFFGHYTCDGNGNKTCLEGWSGPDCNTAICRQGCSTEHGLCKEPGGCDCLYGWQGQYCDKCIPHPGCVHGTCVE-PWQCLCET 255          

HSP 3 Score: 272.707 bits (696), Expect = 8.969e-75
Identity = 209/634 (32.97%), Postives = 293/634 (46.21%), Query Frame = 2
Query: 1049 CIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINEC-VPNPCKNNGVCTDSIND-YKCNCSTSFKGKNCE-LNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFL--HIDFQPCR---------------------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNC----QNCACDRGK-VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIY 2857
            C+E W+G  C+  T+IC Q      G C K+  G   C C  G++G  C    P  +  C H        T +  ++CLC+  + G  CDK++N C    PC N G C ++  D Y+C C+  + G NCE    AC + PC NGG C E   GY C+C  G++G +C +    CSPNPC +G  C  +   + CHC  ++ GK C      C ++ C +A ++C             N  G Y            C C+PG+ G +C+I+I+DCK + C+NGG C D +N + C+C  GF G+ CE   D C  SPC+N G C    DE+ N F C C   + G LC L     C  NPC NG  C   +  N + C C + + G  C  L  H     C                        N+C   G C +     FTC C+ GF G +C  N N+C  NPC NGG CIDK++ Y+CICA G+ G +C++N D+C++ PC  G  C D + DF C C  G  GK C H + ++  +  +C       D G+T+   C    +   C+  K  +C   PC         G      CK G    +   N   C   PC     C+   + Y
Sbjct:  189 CLEGWSGPDCN--TAICRQGCSTEHGLC-KEPGG---CDCLYGWQGQYCDKCIP--HPGCVHG-------TCVEPWQCLCETNWGGHLCDKDLNYCGTRQPCLNGGTCINTGPDKYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCAPGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNGYKCHCPSQWTGKTCLIDANECDSKPCVNA-NSC------------RNLIGGY-----------FCECLPGWMGQNCDININDCK-DQCQNGGTCKDLVNGYRCLCPPGFTGELCERDVDECASSPCLNGGRC---QDEV-NGFQCLCLTGFSGNLCQL-DIDYCSQNPCQNGAPC--FNRANDYVCACPEDYEGRNCSHLKDHCRTTTCTVIDSCTVAVASNSTPGGERYISSNVCGPHGRCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEHCEINIDDCSTSPCHNGGTCRDLVTDFFCECKNGWKGKTC-HSRESQCDE-ATCNNGGTCHDEGDTFQCRCSPGWEGTTCNIAKNSSCLPNPCENGGTCVVKGESFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGDNWY 773          
BLAST of Delta-like protein vs. Ensembl Medaka
Match: ENSORLT00000022384.2 (protein jagged-2 [Source:NCBI gene;Acc:101163046])

HSP 1 Score: 412.535 bits (1059), Expect = 5.484e-156
Identity = 288/872 (33.03%), Postives = 400/872 (45.87%), Query Frame = 2
Query:  827 NWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCEL-NIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSG-----IKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH---IDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCL----QANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARC-IKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI-YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKK 3388
            NWGG  CD+ LNYC  N PCKNGG C N  +E   Y C CP G+ G++C+I    C  NPC   GTC +    F C C   W+G  C +DT  C  N C +GG C   EN N  C+C   + G  C +     + QC++   C+  +     Y+C+CQPG+ G++C+ + N C   PCKN G C   ++ + C C   F G  CE+ N  C+  PC N   C      + C C   + G  C   K  C  N CL                                       A D+C++    N +      I  N C  +G C+S     F C C  GF G  C  +I+DC +NPCKNGG CID IN+F CIC  G+ G  C+   + C + PC N G C+    +L NDF C C +NW G+ CH  + S CDSN C NGG+C      + F C C  GW G  C        D  P      C+N G C+  G + FTC CK G+EG  C  N ++C P+PC+NGG CID +N +RC CA GF G +C++N DEC S PCA G+ CVD I+ + C CP G+ G  C  +     P    C +    +  G  W   C +C C  G V C  V CG   CL     +       AC  G  C   PF    C  PPC     C   + S  P          H  C+PNS    N CA + L FNK  +P G T++ +C  +K L   + L        L I CD++   S  V VA+ +   + +   + K        ++G ++K       +N++ F  ++++ +    +  +      L+  L V      +  ++   W  +++
Sbjct:  291 NWGGLLCDKDLNYCGTNWPCKNGGTCMN--TEPDEYNCACPDGYSGKNCQIVEHACVSNPCANGGTCHEVPSGFECHCPPGWSGPTCAKDTDECSSNPCAHGGTCIDMEN-NFECLCTPSWTGKTCQIDLNSCHGQCQNGGACKESANG---YQCVCQPGFVGRHCEVQRNLCSSGPCKNGGHCHALLDHFLCECPQGFTGATCEVQNDPCRPNPCHNKAQCFRRLNDFYCSCSNEHEGKTCSEAKDHCKTNTCL---------------------------------------AIDSCTVGVFTNDTQQLVRRISSNVCRPHGRCISLTAGNFSCSCDSGFTGLYCHENINDCASNPCKNGGTCIDGINSFRCICPGGWEGLLCDSEVNECSRLPCQNGGQCV----DLLNDFYCNCVDNWKGKTCH-SRESHCDSNTCNNGGTC--YDHGDSFVCSCPAGWGGRTCSTGKNNSCDSSP------CENGGTCVGAG-DSFTCICKEGWEGLTCTQNVDDCKPHPCYNGGICIDGVNWFRCECAPGFAGPDCRINIDECQSSPCADGSTCVDEINRYLCVCPPGKAGPRCHEMIEVVKP----CRHSGLQYPHGSQWEEECNSCQCVNGDVHCTKVRCGRRPCLLEKSSSAAETSAQACPGGHECVQHPF--LTCLSPPCRQWGVCSAPDPSPAP----------HTQCEPNSGYLDNRCAHVTLIFNKDKIPQGTTVESVCWELKYLPVTRML---ATEHVLLILCDLSYLRSDAVEVAMSFENNKQLKESDCKQVEKAVGAITGALSK------HHNSSIFAAVMEVNVE---MRVECPSVGYLVPVLCVVFSLLWIFCIVICVWRIQRR 1075          

HSP 2 Score: 160.614 bits (405), Expect = 5.484e-156
Identity = 93/287 (32.40%), Postives = 138/287 (48.08%), Query Frame = 3
Query:   12 IFCFL-EIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTV-PCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYK---------FTIKSSWPGSITLIIEAYD--TSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNG---GHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            + CFL  ++    +    F L++        Q L G CC    S     C    C   F +CL+ Y   V+       TG C YG  +T+++G +  +F  +                  + +WP + T+I+EA+D   S  +   + +I+R ++K  + P         V      +  Q+++ + C   YYG  C++ C+      GHY CD +G + C  GW G DC   IC+PGCH IHG C  PGEC+C+ GW G  CD+C+ YPGC HGTC + PW CSCE
Sbjct:   13 VVCFLLTVWAEVSQCTGYFELQLLSLDNPRGQLLSGDCCDSTRSAAGGFCGEDECDTYFRVCLKEYQTEVT------TTGACTYGSEITKVFGGNIFRFKSDQKSGQNRNHDAGKIVIPFQFAWPRAYTVIVEAWDWDNSTHSSDEELLIERSIHKGMINPGEEKQT---VEHKTSVTSMQYTVRVRCHEHYYGSKCNQVCRPRDDYFGHYVCDQSGNRNCMEGWTGPDCKTAICKPGCHSIHGTCSVPGECKCKYGWDGLLCDQCLPYPGCFHGTC-NEPWECSCE 289          

HSP 3 Score: 81.6481 bits (200), Expect = 1.493e-18
Identity = 61/186 (32.80%), Postives = 90/186 (48.39%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI---DPCFPNPCKK-GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGV 1366
            +NW G+ C    ++C ++N C NGG C         + C CP+G+ GR C     + C  +PC+  GTC+ +   F C C E W G  C Q+   C  + C NGG C    N   RC C  G+ G +C +    C++S C     C  +   +  Y C+C PG  G  C + I   V  PC+++G+
Sbjct:  661 DNWKGKTCHSRESHC-DSNTCNNGGTC---YDHGDSFVCSCPAGWGGRTCSTGKNNSCDSSPCENGGTCVGAGDSFTCICKEGWEGLTCTQNVDDCKPHPCYNGGICIDGVNW-FRCECAPGFAGPDCRINIDECQSSPCADGSTCVDE---INRYLCVCPPGKAGPRCHEMIE--VVKPCRHSGL 836          

HSP 4 Score: 32.3426 bits (72), Expect = 1.493e-18
Identity = 25/70 (35.71%), Postives = 31/70 (44.29%), Query Frame = 3
Query:  624 CDYGWMG-------SDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCD----ECMKYPGCKHGTCVD 800
            CD G+ G       +DC +  C+ G   I G   N   C C  GW+G  CD    EC + P    G CVD
Sbjct:  583 CDSGFTGLYCHENINDCASNPCKNGGTCIDGI--NSFRCICPGGWEGLLCDSEVNECSRLPCQNGGQCVD 650          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 1828.53 bits (4735), Expect = 0.000e+0
Identity = 927/927 (100.00%), Postives = 927/927 (100.00%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN 3604
            NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKINNNNLQSQPLNPVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN
Sbjct:  286 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKINNNNLQSQPLNPVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN 1212          

HSP 2 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 274/274 (100.00%), Postives = 274/274 (100.00%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE
Sbjct:   12 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 285          

HSP 3 Score: 231.491 bits (589), Expect = 1.546e-61
Identity = 177/545 (32.48%), Postives = 253/545 (46.42%), Query Frame = 2
Query: 1079 DQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE--LNIACQNQPCKNGGVCQEVDTG---YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCES----AYDACSMPQMLNSSGIKHNYCGKYGTC-------------LSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH---------IDFQPCR----------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID----DFECRCPEGRDGKLCDHVKNN 2578
            D     CD+    NGG    D NG +  +C  G+ GS+C+      N+ C+     +I        +C C+ G+ G +CD    EC+  P   +G C DS   + C+C  ++ G+ C+  LN   +N PCKNGG+C+ + +    Y C C +G+ G +CEI    C PNPC  G  C     +FYC C + + GK C+     C   SC++      D     + +   G K + C     C              S     + C C PG+ G  C+ +I++C  NPCKN G+C DSIN+++C C   F GK CE     C   PC N GVC     E+   + C+CK  + G  C + K   C  NPCLNG  C  ++    F CHCN+ + G  C+              +  C           + N C   G C++     F C C PGFEG  C+I+ ++C  NPC NGG CID +N++ CIC  GF+G  C+   D C   PC    +C+   D    DF C C     G+LC   K++
Sbjct:  192 DYYGEFCDRYCKNNGGHYKCDINGEK--VCDYGWMGSDCN------NTICQPGCH-RIHGYCENPGECRCRAGWQGTFCD----ECMKYPGCKHGTCVDS--PWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVC----QEVDTGYTCKCKTGYTGTNCEIYKTG-CSPNPCLNGAYCYTIN--QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS 710          

HSP 4 Score: 102.449 bits (254), Expect = 1.614e-21
Identity = 97/317 (30.60%), Postives = 140/317 (44.16%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSR-LSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAIC---VDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGK-----VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARC 2836
            EC C  G+ G  C+E    C+K P   +G C+       + + C C+NNWGG+ C    +   ++NPC NGG C   LS +  ++C C  G+ G  C+       PC++    K++G        +F C C   + GK CD +T+ C+ N C NGG+C  D+  + RCIC +G+ GS C L    C +  C +   C      + D++C C  G  GK CD   N   P P  C       DS   +  NC      +GK     + C++ PC      Q   T     CK G    +       C   PC+  A C
Sbjct:  249 ECRCRAGWQGTFCDE----CMKYPGCKHGTCVD------SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKG--------EFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP--CKNNGVCTDSINDYKCNCSTSF--KGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYC 542          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000027402.1 (SMESG000027402.1)

HSP 1 Score: 1827.37 bits (4732), Expect = 0.000e+0
Identity = 927/927 (100.00%), Postives = 927/927 (100.00%), Query Frame = 2
Query:  824 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPXXXXXXXXXXXXKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKIXXXXXXXXXXXXVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN 3604
            NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKINNNNLQSQPLNPVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN
Sbjct:  279 NNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKNVPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAIYSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIHTLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYANSTKINNNNLQSQPLNPVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSRFAWPKFQHPFQN 1205          

HSP 2 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 274/274 (100.00%), Postives = 274/274 (100.00%), Query Frame = 3
Query:    3 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 824
            LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE
Sbjct:    5 LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTCVDSPWTCSCE 278          

HSP 3 Score: 231.106 bits (588), Expect = 1.616e-61
Identity = 177/545 (32.48%), Postives = 253/545 (46.42%), Query Frame = 2
Query: 1079 DQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE--LNIACQNQPCKNGGVCQEVDTG---YTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCES----AYDACSMPQMLNSSGIKHNYCGKYGTC-------------LSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLH---------IDFQPCR----------RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRID----DFECRCPEGRDGKLCDHVKNN 2578
            D     CD+    NGG    D NG +  +C  G+ GS+C+      N+ C+     +I        +C C+ G+ G +CD    EC+  P   +G C DS   + C+C  ++ G+ C+  LN   +N PCKNGG+C+ + +    Y C C +G+ G +CEI    C PNPC  G  C     +FYC C + + GK C+     C   SC++      D     + +   G K + C     C              S     + C C PG+ G  C+ +I++C  NPCKN G+C DSIN+++C C   F GK CE     C   PC N GVC     E+   + C+CK  + G  C + K   C  NPCLNG  C  ++    F CHCN+ + G  C+              +  C           + N C   G C++     F C C PGFEG  C+I+ ++C  NPC NGG CID +N++ CIC  GF+G  C+   D C   PC    +C+   D    DF C C     G+LC   K++
Sbjct:  185 DYYGEFCDRYCKNNGGHYKCDINGEK--VCDYGWMGSDCN------NTICQPGCH-RIHGYCENPGECRCRAGWQGTFCD----ECMKYPGCKHGTCVDS--PWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVC----QEVDTGYTCKCKTGYTGTNCEIYKTG-CSPNPCLNGAYCYTIN--QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHS 703          

HSP 4 Score: 102.449 bits (254), Expect = 1.380e-21
Identity = 97/317 (30.60%), Postives = 140/317 (44.16%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSR-LSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKC-IDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAIC---VDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCACDRGK-----VTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPCVPKARC 2836
            EC C  G+ G  C+E    C+K P   +G C+       + + C C+NNWGG+ C    +   ++NPC NGG C   LS +  ++C C  G+ G  C+       PC++    K++G        +F C C   + GK CD +T+ C+ N C NGG+C  D+  + RCIC +G+ GS C L    C +  C +   C      + D++C C  G  GK CD   N   P P  C       DS   +  NC      +GK     + C++ PC      Q   T     CK G    +       C   PC+  A C
Sbjct:  242 ECRCRAGWQGTFCDE----CMKYPGCKHGTCVD------SPWTCSCENNWGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKG--------EFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLA-APCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP--CKNNGVCTDSINDYKCNCSTSF--KGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYC 535          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000063217.1 (SMESG000063217.1)

HSP 1 Score: 299.671 bits (766), Expect = 1.135e-82
Identity = 224/664 (33.73%), Postives = 318/664 (47.89%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCA--ENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEID--PCFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECH-LAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGN-------ESCESAYDACSMPQMLNSSGIKH---------NYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLR-------------------------HSDELYNDFICECKNNWGGRLCH-------------------------------LPKHSICDSN--PCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCR--RKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVK 2572
            + G  C   ++ CA  E   C+NGG C   ++ V  Y+C C +GF G  CE D   C  + CK G TC+   G + C C   + G  C+   ++C+   C+NGG C +D + + +CIC   + G  C  +  PC+ + CK+   C+  S    DYKC+CQ G+ GK C+  I+ C    C N G C + I   KCNC   F+G NCE+N+  C+N+PC+N   C +++  YTC C  G TG NCEI    C+PNPCLNGA C      F C C + F G RCE     C         E C +  +  S  + +   G+++         N     G C+    E+  C C+PGFEG +CEI+I++C  NPC++G  C D  N++ CIC  GF GK CE   + C  +PC   G C+                          + +  YND IC   N +    C+                               L   S+ +S   PCLN   C  ++T   F C C+  + G  C+      +P    R + C+N   C N+  + F C C  GF G+ C+I  NEC  NPC N  KCID +N Y+CIC  GF G NC++N ++C    C     CVD+++ FEC+C E   G  C+H+K
Sbjct:  165 YTGDTCSNDIDECASYETPLCENGGTC---INTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGIC-RDFDEDYQCICGNQWTGKNCDDVKNPCKINPCKNNGFCE--SVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEE-KCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQC--INTNGSFICKCSSQYEGRQCE------KPLNNCRNDPCRNGATCDNLA-DGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLK 812          

HSP 2 Score: 298.516 bits (763), Expect = 3.357e-82
Identity = 224/653 (34.30%), Postives = 301/653 (46.09%), Query Frame = 2
Query:  854 SLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDP-CFPNPCKKG-TCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNP---CKNNGVCTDSINDYKCNCSTSFKGKNCELNIA-CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINV-----GY--------------------------------NDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETW-SYNCQNCACDRGK 2680
            SLN+C EN+ CKNG  C++ ++    Y C C  G++G  CE    C   PC+ G TC    G + CQC+  W G+ C+  +S C  + C+NGG C   E     C C + Y G  C L   C  SQ    ++ +      G+ KC C  GYTG  C  +I+EC       C+N G C +++  Y+C C   F G+ CE +I  C N  CKNGG C +    Y C C   Y GTNCE  +T C   PC NG  C   ++D+ C C  ++ GK C+  +  C                       K N C   G C S   + + C C  GFEG  CE  ID+C+   C NGG CI+ I   +C C  GF G  CE   + C   PC N   C+    +L ND+ C+C     G+ C +     C  NPCLNG  C     + GF C C QG++G  C+        C++   CK E +C+NV     GY                                N+  C C PGFEG+ C+I  NEC  NPC +G +C D  N Y CIC  GF G  C++N +ECA  PC     C+D +  F C+C     G  C    N   P  P+  Y + I   G  + SY+C NC+   G+
Sbjct:   20 SLNFC-ENHKCKNGATCQSDIN--GKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEF-SSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCELPNSC-GSQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKNPC-----------------------KINPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCI----DLNNDYTCDCPEGLTGKNCEINIDE-CTPNPCLNGARCE--DRVGGFTCQCLQGFVGLRCE---TKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTC---ANKLDPCNPNACYNDAICIPGNKYDSYHC-NCSTALGR 630          

HSP 3 Score: 291.197 bits (744), Expect = 6.886e-80
Identity = 221/679 (32.55%), Postives = 316/679 (46.54%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEI--DPCFPNPCKKGT-CMKSKGEFYCQCIERWTGKLCDQDTSICDQ-NSCQNGGQCGKDENGNR--RCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCN-----KEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNS-----------------------------------SGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRL-----------------------------------------STLNGFQCHCNQGWIGTVCQFLHID----FQPCRRKN------LCKNEGVCIN-VGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHV 2569
            + G  C+ ++N C EN PC+N   C +L ++   Y C CP G  G++CEI  D C PNPC  G  C    G F CQC++ + G  C+  + IC Q   C+    C    N     +CIC  G +  +  L+  C+N  C +     + +    + KC+C PG+ G+ C+ EINEC  NPC++   C D  NDY C C   FKGK CE+NI  C + PC   G C +   G+ C+C   Y+G  C      C+PN C N A C   N+    HCN       + G +CE     C  +  + A    ++  M NS                                   +  +++ C    TC  +  + F CRC+ GF G+ CEI+I++C+ NPC N   CID IN+++CIC +GF GK CE   + C +S C+ +G C+    +  N F C+C  N+ G  C   K   CDSNPCLN GSC                                            + L+ F+C CN  +IG  C+    +    +   + KN      +CK+ G C N      F C C+ G+ G  C++N ++C   PC NGG+C D    Y C C  GF G NCQ+N +EC S  C  G  C+D+I++F C CP G  G+ C+ +
Sbjct:  359 FEGNNCEINVNEC-ENKPCQNNAKCIDLNND---YTCDCPEGLTGKNCEINIDECTPNPCLNGARCEDRVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSK-CKNIVCVNGQCVDVNN----EEKCICIPGFEGRTCEIEINECFNNPCQHGSQCQDLFNDYLCICLPGFKGKKCEININECAHNPCGLNGQCIDEVYGFRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDPCRNGATC-DNLADGFRCRCVAGFTGERCEIEINECQHNPCSNDAKCIDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCV----DKVNGFECKCNENYIGTNCEHLKRP-CDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGK-CIDQINNFSCVCPRGVSGRFCETI 1021          

HSP 4 Score: 265.774 bits (678), Expect = 7.245e-72
Identity = 201/657 (30.59%), Postives = 294/657 (44.75%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKH---ALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCT--DSINDYKCNCSTS---FKGKNCELNIA---------------------CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCL-RHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHID----FQPCRRKN------LCKNEGVCIN---------------------VGYND------------------FTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCD 2563
            + G  C+   + C +  PCK   IC N+ +    YKCICP G +    E+  C    C  G C+    E  C CI  + G+ C+ + + C  N CQ+G QC +D   +  CIC  G+KG +C +      ++C H    L+ Q      G ++C C   Y+G  C  +++ C PN C N+ +C   +  + Y CNCST+   ++G  CE ++                       Q  PC N   C   +  + CKC + Y G  CE     C  +PC NGA C  +   F C C   F G+RCE     C                       +HN C     C+ H  + + C C  GF G +CEI+ +DC  + C   G C+D +N FEC C+  + G  CE     C  +PC+N G C+ R  ++    ++C C+  + G  C + K   C  NPC + G C   + L+ F+C CN  +IG  C+    +    +   + KN      +CK+ G C N                     V  +D                  + C C+PGF+G +C +NTNEC  N C N GKCID++N++ C+C +G  G  C+   D C    C  G IC + I DFEC CP+G  GKLC+
Sbjct:  435 FVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKCICPDGVQNCKKELSKCKNIVCVNGQCVDVNNEEKCICIPGFEGRTCEIEINECFNNPCQHGSQC-QDLFNDYLCICLPGFKGKKCEINI----NECAHNPCGLNGQCIDEVYG-FRCQCMLPYSGPTCANKLDPCNPNACYNDAICIPGNKYDSYHCNCSTALGRYEGSKCEKDVDECNLDRTQLALYGLALLSMSNSQIGPCLNDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDPCRNGATCDNLADGFRCRCVAGFTGERCEIEINEC-----------------------QHNPCSNDAKCIDHIND-YQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEI-KMDWCRGNPCGDFGVCE--TDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCE 1057          

HSP 5 Score: 228.409 bits (581), Expect = 3.782e-60
Identity = 166/490 (33.88%), Postives = 232/490 (47.35%), Query Frame = 2
Query: 1325 INECVPNPCKNNGVCTDSIN-DYKCNCSTSFKGKNCELNIACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTIN-QDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDC---KTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQ------NCACDRGKVTCESV-PCGV-WTCLQANGTDDPYAC 2755
            +N C  + CKN   C   IN  Y C C+  +KG  CE    C   PC+NGG C+ +   Y C+C   + G  CE + + C+ +PC NG  C ++    + C C K + G  CE                      + NS G   N CG  G C+     +  C C  G+ GD+C  DID+C   +T  C+NGG CI+++ +++C C  GF G+ CE     C    C N G CL    +    + C C NN+ G  C   K ++C+  PC NGG C        +QC C   W G  C  +     PC+  N CKN G C +V Y D+ C C+ GFEGK C+ + + C    CFNGG CI+ +   +C C  GF G+NC++N +EC + PC   A C+D  +D+ C CPEG  GK C+   +  +P P  C+   R  D      + CQ         C+     C+ + PC     CL  N T   Y C
Sbjct:   21 LNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCEQKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCE-FSSNCASSPCRNGGICKSLEIHKYECQCPKNYLGMNCE----------------------LPNSCG-SQNPCGVNGKCILANDGEVKCHCNKGYTGDTCSNDIDECASYETPLCENGGTCINTVGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCL----DKIGSYRCVCPNNYFGTNCE-NKRTLCELKPCKNGGICRDFDE--DYQCICGNQWTGKNCDDVK---NPCKI-NPCKNNGFCESVNYQDYKCICQRGFEGKRCETSIDNCQKISCFNGGSCINMIEGGKCNCLPGFEGNNCEINVNECENKPCQNNAKCIDLNNDYTCDCPEGLTGKNCEINIDECTPNP--CLNGARCED--RVGGFTCQCLQGFVGLRCETKSDICKQLTPCKTEEICLNVNNTRSGYKC 471          

HSP 6 Score: 214.157 bits (544), Expect = 9.983e-56
Identity = 184/640 (28.75%), Postives = 266/640 (41.56%), Query Frame = 2
Query:  974 EIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAA-PCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCE-LNIACQNQPCKNGGVC-----QEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSH-EKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGG-------------------------------------ICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMN--------------------------------YGVCLRHSDELYN------------------DFICECKNNWGGRLCHL-----PKHSICDSNPCLNGGSC-----SRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYND---FTCHCKPGFEGKHCDIN-TNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFEC-RCPEGRDGKLCD 2563
            +I PC         C+ + G F C+C  ++ G+ C++  + C  + C+NG  C    +G  RC C  G+ G  C +    C+++ C +   C      + DY+C+CQ G++GK C+   N+C  + C  +G C D +N ++C C+ ++ G NCE L   C + PC N G C      +   GY C C+ G+TG  CEI    C  NPC +   C T    F C CN E+ G+RCE  +     E+C+S     ++ +  N S I +  C  +G C +  E   F C C  G+ G  CE++IDDC + PC NGG                                      CID INNF C+C  G  G+ CE   DYC K  C N                                Y +    ++ + N                   F C CK  + G+ C        K     + PC N G C     + +     F C C  G+ G  C+   I+ + C+  N+CKN G+C     +D   F C C PG  G  C+I+  NEC    C+N G C++      C C KG  G  C++    C            D I D E  +C    D K+CD
Sbjct:  664 QIGPCL----NDNQCINTNGSFICKCSSQYEGRQCEKPLNNCRNDPCRNGATCDNLADG-FRCRCVAGFTGERCEIEINECQHNPCSNDAKC---IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKK----TETCKSY----AVEKFKNESLI-NKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSCNTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNPHGPCSPTGTLECLDRPGTFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCK---INSKKCQL-NVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSCVNGFGKAICHCNKGSCGEKCEITGSACNLASIDNSQTYQDEISDCELNKCASKADNKICD 1282          

HSP 7 Score: 183.726 bits (465), Expect = 2.303e-46
Identity = 181/602 (30.07%), Postives = 252/602 (41.86%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDP--CFPNPC-KKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQC-GKDENGNR---RCICQQGYKGSECHLAA------PCEN-SQCKHALD--------------CQIQSTAL-------------------------------GDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNI-ACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGT--CLSHEKEKFICRCMPGFEGDSCEIDIDDCK------TNPCKNGGICIDSINN-------FECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQ---CHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPC-FNGGKCIDKL 2398
            + G+ C+  +N C ++NPC N   C   +  +  Y+CIC SGF G++CEI+   C  + C   G C+     F C+C E + G  C+     CD N C N G C  +  N N     C C++G+ G  C +        PC +   C+  LD              C+I+ T                                 G +KC CQ GY G +C+  I++C   PC N G C D    Y C C   F+G NC++N   C +  C N G C +    ++C C  G +G  CE     C    C NG  C  +  DF C+C K F GK CE     C      +A +  S P         H  C   GT  CL      F C C   F G  CE  ID C+        PC N GIC++   N       F CIC NG+ G+ C+  +  C  + C N G+C     +    F CEC    GG  C +   + C S  C N GSC     +NGF    CHCN+G  G  C+   I    C   ++  ++     +   +    C    + K CD+   ECN   C F+GG+C+ ++
Sbjct:  727 FTGERCEIEINEC-QHNPCSNDAKC---IDHINDYQCICQSGFSGKNCEINDNDCTESSCLGHGQCVDKVNGFECKCNENYIGTNCEHLKRPCDSNPCLNKGSCINRKVNQNTPGYLCNCRRGFTGPRCEIKMDWCRGNPCGDFGVCETDLDSFKCKCNSEYIGERCEIKKTETCKSYAVEKFKNESLINKICKHHGNCFNDPETGGFKCSCQSGYGGSFCEVNIDDCASQPCINGGECGDGTGMYFCKCQPGFQGVNCQVNTNECYSNSC-NTGKCIDQINNFSCVCPRGVSGRFCETIVDYCKKMECQNGGICKNVIGDFECNCPKGFAGKLCETDINECKYNIAGNATNLISNP---------HGPCSPTGTLECLDRPG-TFHCSCKKYFTGKYCETRIDYCEKFRKSGNIPCFNNGICLNKYQNEVGRNYNFSCICPNGYGGERCKINSKKCQLNVCKNNGICRPFEIDDRMSFKCECPPGVGGLFCEIDYVNECLSTKCYNNGSC-----VNGFGKAICHCNKGSCGEKCE---ITGSACNLASIDNSQTYQDEISDCELN-KCASKADNKICDL---ECNKYACGFDGGECLHRV 1301          

HSP 8 Score: 155.221 bits (391), Expect = 1.474e-37
Identity = 105/286 (36.71%), Postives = 150/286 (52.45%), Query Frame = 2
Query: 1718 PQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDHVKN 2575
            P  ++ +  +++ C    TC S    K++C C  G++G  CE    +C   PC+NGG C     N+ C C N + G+ CE  ++ C  SPC N G+C   S E++  + C+C  N+ G  C LP +S    NPC   G C  L+     +CHCN+G+ G  C    ID        LC+N G CIN     + C CK GF G+ C+ +  +C  + C NGG C+DK+ SYRC+C   ++G+NC+     C   PC  G IC D  +D++C C     GK CD VKN
Sbjct:   16 PIAISLNFCENHKCKNGATCQSDINGKYVCECAYGYKGTYCE-QKSNCPITPCQNGGTCKLIAGNYVCQCLNEWVGEFCEFSSN-CASSPCRNGGIC--KSLEIH-KYECQCPKNYLGMNCELP-NSCGSQNPCGVNGKCI-LANDGEVKCHCNKGYTGDTCSN-DIDECASYETPLCENGGTCINT-VGSYQCKCKAGFNGERCENDIVDCTNDTCKNGGTCLDKIGSYRCVCPNNYFGTNCENKRTLCELKPCKNGGICRDFDEDYQCICGNQWTGKNCDDVKN 292          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.463e-51
Identity = 89/308 (28.90%), Postives = 128/308 (41.56%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAEN-NPCKNGGICENL--LSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI---------YKTGCSPNPCLNGAYCYT-----------------INQDFYCHCNKEFWGKRCE 1657
            WGG FC+  LNYC+ N N C+NGG C N   +   Q Y+CIC  G     C+I+              +  ++ C C E + G  C  + + CD N C    +C  D+    +C C  G+ G  C +    C +  C +   C  + +    + C+C  G++G  C    N+C    C N   C D  N   C C+T + G+ C  NI     NQPC N G+C +    Y C+C+  ++G  C +          +  C  NPC N   C                   I   + C CN  F G  CE
Sbjct:  281 WGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPG----KCKIN-------------VNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSG---FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 568          

HSP 2 Score: 111.694 bits (278), Expect = 1.463e-51
Identity = 81/272 (29.78%), Postives = 124/272 (45.59%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRL--TEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQF--SMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTC-VDS------PWTCSCE 824
            SK  F + I KY  +    L+ KCC    +   ++C+  C     ICL  Y  +       P+   C  G+    T+I G+ ++  N      Y   ++  W  +  +I++             ++     +  +KPS   S W    LS  +  +Q   S    C  +Y+GE CD+ CK   N  G Y C  NG+++C  G+ GS C+  +C   C  I+G C  P +CRC+ GW G  CD+C+ YPGC HG+C  D       P TC+C+
Sbjct:   23 SKGVFEIHIKKYTLFPTLNLN-KCCPTRKNST-NSCSEDCNIFMEICLSIYQKN-------PHRYACDIGETYIKTDILGNYAL--NDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPS---SSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCK 278          

HSP 3 Score: 150.984 bits (380), Expect = 1.175e-36
Identity = 137/468 (29.27%), Postives = 194/468 (41.45%), Query Frame = 2
Query: 1034 EFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVC-----TDSINDYKCNCSTSFKGKNCELNIA-CQNQP--CKNGGVCQ-----EVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI--DFQPCRRK---NLCKNEGVCI--------NVGYND--------FTCHCKPGFEGKHCD 2335
             F   C + + G+ CD+   +C + S    G      NG+R  IC  GY GS C              L   I    +G  +C CQ G+TG  CD    +C+P P   +G C     T  +    CNC   + G  C +++  C N P  C+NGG C      + +  Y C CK G    N    K                    + C C + F+G RC+ ++  C +                       N C     C++ +   F C+C PGF G +CEID D+C + PC NGG+CID  + F C+C  GF G  C+   + C K  CMN   C+  +    N   CEC   W GR+C+   +    + PCLN G C  + T   ++C C   W G  C    +  +     RK   N C+N G+CI        N+  N+        +TC C PGF G  C+
Sbjct:  169 SFRYTCSQNYHGEECDK---LC-KPSANERGFYNCSSNGDR--ICHTGYSGSYCDKVV---------CLKKCINGACVGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNK--------------------YICDCPESFYGDRCQFNQTSCDD-----------------------NPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRA----NRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC--IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 568          

HSP 4 Score: 120.553 bits (301), Expect = 3.092e-27
Identity = 79/243 (32.51%), Postives = 113/243 (46.50%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFI---CECKNNWGGRLCHLPKHSICDSNP--CLNGGSCSRLSTL---------------------NGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 2566
            +C C  G+ G +C    D CI  P   +G C    DE   + +   C CK  WGG  C++   + C +NP  C NGG C     +                     N + C C + + G  CQF     Q     N C     CI    + F C C PGF G++C+I+ +EC+  PC NGG CID+ + + C+C  GF G  CQ+N ++C    C  GA C+DR +  +C C  G  G++C+ 
Sbjct:  235 QCRCQTGWTGDSC----DQCIPYPGCVHGSC--RFDETTKELLPLTCNCKKKWGGMFCNI-DLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQF----NQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ 466          

HSP 5 Score: 119.398 bits (298), Expect = 6.620e-27
Identity = 110/386 (28.50%), Postives = 158/386 (40.93%), Query Frame = 2
Query:  923 VQPYKCICPSGFEGRDCEIDPCFPNP-CKKGTC-----MKSKGEFYCQCIERWTGKLCDQDTSICDQNS--CQNGGQC----GKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVC-TDSINDYKCNCSTSFKGKNCELN-IACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDI---------DDCKTNPCKNGGICI-----DSIN------------NFECICDNGFFGKTCEE 1960
            V P +C C +G+ G  C  D C P P C  G+C      K      C C ++W G  C+ D + C  N   C+NGG+C        N   RCIC+ G               +CK  ++          Y C C   + G  C      C  NPC  N  C TD  + +KC C   F G+NCE++   C ++PC NGG+C +  +G+ C C  G++G  C++ K  C    C+NGA C        C C   + G+ C  +             + C++ Q   ++GI  +  G Y            C+C   + G  C + I           C  NPC+N GICI      S+N             + C C+ GF G  CE+
Sbjct:  231 VGPNQCRCQTGWTGDSC--DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPG---------------KCKINVN-------TNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQN------------INECAINQPCLNNGICIDTPGSYR-----------CQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 569          

HSP 6 Score: 71.2478 bits (173), Expect = 4.177e-12
Identity = 58/197 (29.44%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKK------GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCEN----------SQCKHALDCQIQSTAL--------------GDYKCLCQPGYTGKYCDKEI 1327
            + G+ C+   + C+   PC NGG+C   +     + C+CP GF G  C+++    N C+K        CM       C+C   WTG++C+Q+ + C  N  C N G C  D  G+ RC CQ  + G  C+L     N          + C++   C + S                 G Y C C PG+TG  C+K I
Sbjct:  383 FTGRNCEIDEDECSSK-PCLNGGMC---IDRPSGFLCVCPVGFSGDRCQVNK---NDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 571          
BLAST of Delta-like protein vs. Planmine SMEST
Match: SMESG000022173.1 (SMESG000022173.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.538e-51
Identity = 89/308 (28.90%), Postives = 128/308 (41.56%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAEN-NPCKNGGICENL--LSEVQPYKCICPSGFEGRDCEIDPCFPNPCKKGTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHL-AAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIA--CQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEI---------YKTGCSPNPCLNGAYCYT-----------------INQDFYCHCNKEFWGKRCE 1657
            WGG FC+  LNYC+ N N C+NGG C N   +   Q Y+CIC  G     C+I+              +  ++ C C E + G  C  + + CD N C    +C  D+    +C C  G+ G  C +    C +  C +   C  + +    + C+C  G++G  C    N+C    C N   C D  N   C C+T + G+ C  NI     NQPC N G+C +    Y C+C+  ++G  C +          +  C  NPC N   C                   I   + C CN  F G  CE
Sbjct:  286 WGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPG----KCKIN-------------VNTNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSG---FLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGICIDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 573          

HSP 2 Score: 111.694 bits (278), Expect = 1.538e-51
Identity = 81/272 (29.78%), Postives = 124/272 (45.59%), Query Frame = 3
Query:   51 SKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQHTCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRL--TEIWGDSSMKFNKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLKPSYNSSMWNDVVLSNDRSVYQF--SMNLICKPDYYGEFCDRYCK---NNGGHYKCDINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFCDECMKYPGCKHGTC-VDS------PWTCSCE 824
            SK  F + I KY  +    L+ KCC    +   ++C+  C     ICL  Y  +       P+   C  G+    T+I G+ ++  N      Y   ++  W  +  +I++             ++     +  +KPS   S W    LS  +  +Q   S    C  +Y+GE CD+ CK   N  G Y C  NG+++C  G+ GS C+  +C   C  I+G C  P +CRC+ GW G  CD+C+ YPGC HG+C  D       P TC+C+
Sbjct:   28 SKGVFEIHIKKYTLFPTLNLN-KCCPTRKNST-NSCSEDCNIFMEICLSIYQKN-------PHRYACDIGETYIKTDILGNYAL--NDSVKRDYSILVRERWKRNFNIIVKIKHYDLITKKNVVIVTLSSSEVDVKPS---SSWITKQLSTPKDHFQLLVSFRYTCSQNYHGEECDKLCKPSANERGFYNCSSNGDRICHTGYSGSYCDKVVCLKKC--INGACVGPNQCRCQTGWTGDSCDQCIPYPGCVHGSCRFDETTKELLPLTCNCK 283          

HSP 3 Score: 150.599 bits (379), Expect = 1.437e-36
Identity = 137/468 (29.27%), Postives = 194/468 (41.45%), Query Frame = 2
Query: 1034 EFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVC-----TDSINDYKCNCSTSFKGKNCELNIA-CQNQP--CKNGGVCQ-----EVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWGGRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI--DFQPCRRK---NLCKNEGVCI--------NVGYND--------FTCHCKPGFEGKHCD 2335
             F   C + + G+ CD+   +C + S    G      NG+R  IC  GY GS C              L   I    +G  +C CQ G+TG  CD    +C+P P   +G C     T  +    CNC   + G  C +++  C N P  C+NGG C      + +  Y C CK G    N    K                    + C C + F+G RC+ ++  C +                       N C     C++ +   F C+C PGF G +CEID D+C + PC NGG+CID  + F C+C  GF G  C+   + C K  CMN   C+  +    N   CEC   W GR+C+   +    + PCLN G C  + T   ++C C   W G  C    +  +     RK   N C+N G+CI        N+  N+        +TC C PGF G  C+
Sbjct:  174 SFRYTCSQNYHGEECDK---LC-KPSANERGFYNCSSNGDR--ICHTGYSGSYCDKVV---------CLKKCINGACVGPNQCRCQTGWTGDSCD----QCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNK--------------------YICDCPESFYGDRCQFNQTSCDD-----------------------NPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRA----NRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC--IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCE 573          

HSP 4 Score: 120.553 bits (301), Expect = 3.361e-27
Identity = 79/243 (32.51%), Postives = 113/243 (46.50%), Query Frame = 2
Query: 1916 ECICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFI---CECKNNWGGRLCHLPKHSICDSNP--CLNGGSCSRLSTL---------------------NGFQCHCNQGWIGTVCQFLHIDFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPCFNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDDFECRCPEGRDGKLCDH 2566
            +C C  G+ G +C    D CI  P   +G C    DE   + +   C CK  WGG  C++   + C +NP  C NGG C     +                     N + C C + + G  CQF     Q     N C     CI    + F C C PGF G++C+I+ +EC+  PC NGG CID+ + + C+C  GF G  CQ+N ++C    C  GA C+DR +  +C C  G  G++C+ 
Sbjct:  240 QCRCQTGWTGDSC----DQCIPYPGCVHGSC--RFDETTKELLPLTCNCKKKWGGMFCNI-DLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPGKCKINVNTNKYICDCPESFYGDRCQF----NQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQ 471          

HSP 5 Score: 119.398 bits (298), Expect = 7.444e-27
Identity = 110/386 (28.50%), Postives = 158/386 (40.93%), Query Frame = 2
Query:  923 VQPYKCICPSGFEGRDCEIDPCFPNP-CKKGTC-----MKSKGEFYCQCIERWTGKLCDQDTSICDQNS--CQNGGQC----GKDENGNRRCICQQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCDKEINECVPNPCKNNGVC-TDSINDYKCNCSTSFKGKNCELN-IACQNQPCKNGGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFYCHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKYGTCLSHEKEKFICRCMPGFEGDSCEIDI---------DDCKTNPCKNGGICI-----DSIN------------NFECICDNGFFGKTCEE 1960
            V P +C C +G+ G  C  D C P P C  G+C      K      C C ++W G  C+ D + C  N   C+NGG+C        N   RCIC+ G               +CK  ++          Y C C   + G  C      C  NPC  N  C TD  + +KC C   F G+NCE++   C ++PC NGG+C +  +G+ C C  G++G  C++ K  C    C+NGA C        C C   + G+ C  +             + C++ Q   ++GI  +  G Y            C+C   + G  C + I           C  NPC+N GICI      S+N             + C C+ GF G  CE+
Sbjct:  236 VGPNQCRCQTGWTGDSC--DQCIPYPGCVHGSCRFDETTKELLPLTCNCKKKWGGMFCNIDLNYCSNNPNVCENGGECLNFGNIKTNQQYRCICKPG---------------KCKINVN-------TNKYICDCPESFYGDRCQFNQTSCDDNPCVGNSECITDKTSGFKCKCPPGFTGRNCEIDEDECSSKPCLNGGMCIDRPSGFLCVCPVGFSGDRCQVNKNDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQN------------INECAINQPCLNNGICIDTPGSYR-----------CQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEK 574          

HSP 6 Score: 71.2478 bits (173), Expect = 4.558e-12
Identity = 58/197 (29.44%), Postives = 86/197 (43.65%), Query Frame = 2
Query:  830 WGGQFCDQSLNYCAENNPCKNGGICENLLSEVQPYKCICPSGFEGRDCEIDPCFPNPCKK------GTCMKSKGEFYCQCIERWTGKLCDQDTSICDQNS-CQNGGQCGKDENGNRRCICQQGYKGSECHLAAPCEN----------SQCKHALDCQIQSTAL--------------GDYKCLCQPGYTGKYCDKEI 1327
            + G+ C+   + C+   PC NGG+C   +     + C+CP GF G  C+++    N C+K        CM       C+C   WTG++C+Q+ + C  N  C N G C  D  G+ RC CQ  + G  C+L     N          + C++   C + S                 G Y C C PG+TG  C+K I
Sbjct:  388 FTGRNCEIDEDECSSK-PCLNGGMC---IDRPSGFLCVCPVGFSGDRCQVNK---NDCQKLSCMNGAKCMDRANRIDCECTTGWTGRMCNQNINECAINQPCLNNGIC-IDTPGSYRCQCQATWSGQFCNLKIVVPNINYLERKCLINPCRNNGICILNSLPTSVNIPNNEYFKPIGGPYTCKCNPGFTGDLCEKVI 576          
The following BLAST results are available for this feature:
BLAST of Delta-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG12.568e-17235.65jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
JAG21.292e-16835.53jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
JAG21.780e-15433.84jagged canonical Notch ligand 2 [Source:HGNC Symbo... [more]
NOTCH14.331e-9536.30notch receptor 1 [Source:HGNC Symbol;Acc:HGNC:7881... [more]
NOTCH22.743e-8834.62notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clec-782.644e-6332.24C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531... [more]
crb-13.162e-4632.24Drosophila CRumBs homolog [Source:UniProtKB/TrEMB... [more]
lin-121.672e-4528.84pep chromosome:WBcel235:III:9060096:9071760:-1 gen... [more]
egas-29.363e-3527.63EGF plus ASC domain ion channel [Source:UniProtKB... [more]
glp-12.564e-3228.24pep chromosome:WBcel235:III:9092241:9099698:1 gene... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
N2.136e-9534.74gene:FBgn0004647 transcript:FBtr0304659[more]
N2.136e-9534.74gene:FBgn0004647 transcript:FBtr0070507[more]
Dl7.793e-7735.74gene:FBgn0000463 transcript:FBtr0083739[more]
Dl7.793e-7735.74gene:FBgn0000463 transcript:FBtr0083740[more]
Dl7.793e-7735.74gene:FBgn0000463 transcript:FBtr0304658[more]
back to top
BLAST of Delta-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jag1a4.960e-17234.23jagged canonical Notch ligand 1a [Source:NCBI gene... [more]
jag1a5.858e-17234.05jagged canonical Notch ligand 1a [Source:NCBI gene... [more]
jag1b2.556e-17133.60jagged canonical Notch ligand 1b [Source:NCBI gene... [more]
jag2b7.257e-17036.07jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
jag2b1.389e-16936.07jagged canonical Notch ligand 2b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plpp77.702e-17935.96phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp71.795e-17135.31phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp76.140e-16635.21phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp76.746e-16234.32phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
plpp74.931e-16132.89phospholipid phosphatase 7 (inactive) [Source:Xenb... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jag13.553e-17335.42jagged 1 [Source:MGI Symbol;Acc:MGI:1095416][more]
Jag25.270e-17236.11jagged 2 [Source:MGI Symbol;Acc:MGI:1098270][more]
Notch11.345e-9536.30notch 1 [Source:MGI Symbol;Acc:MGI:97363][more]
Notch22.839e-9135.03notch 2 [Source:MGI Symbol;Acc:MGI:97364][more]
Dll11.493e-8536.69delta like canonical Notch ligand 1 [Source:MGI Sy... [more]
back to top
BLAST of Delta-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXX0|JAG1_MOUSE2.170e-17235.42Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 ... [more]
sp|P78504|JAG1_HUMAN1.137e-17135.65Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 P... [more]
sp|Q63722|JAG1_RAT2.326e-17135.42Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q9QYE5|JAG2_MOUSE3.218e-17136.11Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 ... [more]
sp|Q90Y57|JAG1A_DANRE1.260e-17033.95Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a ... [more]
back to top
BLAST of Delta-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074ZZC90.000e+037.04Delta-like protein OS=Opisthorchis viverrini OX=61... [more]
A0A419PFZ42.820e-1937.35Delta-like protein OS=Clonorchis sinensis OX=79923... [more]
G7YV352.968e-1937.35Delta-like protein OS=Clonorchis sinensis OX=79923... [more]
A0A4E0RM296.064e-4138.00Delta-like protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A068WBH61.484e-3239.66Delta-like protein OS=Echinococcus granulosus OX=6... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jag2b1.756e-17234.24protein jagged-2 [Source:NCBI gene;Acc:103029720][more]
JAG12.093e-16634.35protein jagged-1a [Source:NCBI gene;Acc:103036342][more]
jag1b7.796e-16634.18jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
jag2b1.681e-16132.46protein jagged-2 [Source:NCBI gene;Acc:103029720][more]
ENSAMXT00000008576.21.681e-15133.11pep primary_assembly:Astyanax_mexicanus-2.0:25:391... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JAG15.017e-14434.20jagged canonical Notch ligand 1 [Source:HGNC Symbo... [more]
ENSPMAT00000000962.13.993e-12532.86pep scaffold:Pmarinus_7.0:GL477031:38805:53470:-1 ... [more]
ENSPMAT00000002643.14.593e-4933.52pep scaffold:Pmarinus_7.0:GL478752:33855:40482:1 g... [more]
ENSPMAT00000008695.14.205e-4026.45pep scaffold:Pmarinus_7.0:GL501129:36413:70075:1 g... [more]
ENSPMAT00000002014.11.885e-3738.86pep scaffold:Pmarinus_7.0:GL482490:2146:12219:-1 g... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Delta-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO462431.292e-10537.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297201.823e-10237.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415061.418e-9536.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340865.222e-9436.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391655.563e-9433.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Delta-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022382.28.865e-17235.40protein jagged-2 [Source:NCBI gene;Acc:101163046][more]
jag1b3.474e-16833.83jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
ENSORLT00000040656.12.737e-16433.83protein jagged-1a [Source:NCBI gene;Acc:101169088][more]
jag1b3.349e-15733.52jagged canonical Notch ligand 1 [Source:NCBI gene;... [more]
ENSORLT00000022384.25.484e-15633.03protein jagged-2 [Source:NCBI gene;Acc:101163046][more]
back to top
BLAST of Delta-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027402.11.546e-61100.00SMESG000027402.1[more]
SMESG000027402.11.616e-61100.00SMESG000027402.1[more]
SMESG000063217.11.135e-8233.73SMESG000063217.1[more]
SMESG000022173.11.463e-5128.90SMESG000022173.1[more]
SMESG000022173.11.538e-5128.90SMESG000022173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018205 ID=SMED30018205|Name=Delta-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3861bp
AATTGGAAATTATATTTTGTTTCTTGGAAATTTTTCATGGATTTGTTGAA
TCGAAATCTCAATTCTCATTGAAAATTACAAAATACATCAAATATTCATT
TCAGAGACTCGATGGAAAATGCTGTGGTGACCATGGCAGTGTAATTCAGC
ACACCTGTACAGTTCCCTGTATTCAACGTTTCAGCATTTGTTTGGAATAC
TATCACGCGTCTGTATCACCTAATGATCCAACACCTTATACTGGACACTG
CGCCTATGGAAAGCGATTAACAGAAATATGGGGAGATTCTAGCATGAAGT
TTAACAAAGAGTCAACTCATAGCTACAAATTCACAATTAAAAGTTCATGG
CCAGGTTCAATAACGTTAATCATTGAGGCGTATGACACTTCGGAAACTAA
TCCATATAGAAAGGCTGTAATTGACAGAGTTGTATACAAAAACTTTCTGA
AACCTTCGTATAATTCATCAATGTGGAATGATGTTGTGCTGTCAAATGAT
AGATCCGTATACCAATTTAGTATGAACCTCATTTGTAAGCCTGACTATTA
CGGAGAATTTTGTGATCGCTATTGTAAAAATAACGGAGGACATTATAAAT
GTGACATAAATGGCGAAAAGGTCTGTGATTATGGTTGGATGGGTTCTGAC
TGCAATAACACAATTTGCCAGCCAGGATGCCATCGAATCCATGGTTATTG
TGAAAATCCTGGAGAATGTCGTTGTCGAGCGGGGTGGCAAGGGACGTTTT
GTGATGAATGCATGAAATATCCTGGTTGCAAGCATGGAACTTGTGTTGAT
TCGCCATGGACATGTAGTTGTGAAATAACTGGGGCGGTCAATTTTGCGAT
CAGAGTCTCAATTATTGCGCGGAGAACAACCCGTGTAAGAATGGAGGAAT
CTGTGAAAACCTATTATCAGAAGTCCAACCATATAAATGCATTTGCCCAT
CAGGTTTTGAAGGCCGAGACTGTGAGATTGATCCTTGCTTTCCGAATCCA
TGTAAAAAAGGAACATGCATGAAATCAAAAGGTGAATTTTACTGCCAATG
TATTGAAAGGTGGACTGGAAAATTGTGCGATCAAGATACGAGTATTTGCG
ATCAGAATTCTTGTCAGAATGGCGGTCAGTGTGGTAAAGACGAAAATGGA
AATCGTCGATGTATTTGCCAGCAAGGTTATAAGGGGTCTGAATGCCATTT
AGCGGCACCGTGTGAAAATTCTCAGTGTAAGCATGCTTTGGATTGCCAGA
TCCAGTCAACTGCTTTGGGTGATTATAAGTGTCTTTGTCAACCTGGATAC
ACCGGAAAATACTGTGATAAAGAAATAAACGAATGCGTACCAAACCCTTG
TAAAAATAATGGAGTGTGCACGGATTCAATAAACGATTACAAATGTAACT
GCAGCACCAGTTTCAAAGGAAAGAATTGTGAGCTTAATATAGCTTGTCAG
AACCAACCCTGCAAGAATGGCGGTGTTTGCCAGGAAGTTGACACCGGATA
CACTTGTAAATGTAAAACTGGATATACTGGCACAAACTGCGAGATATATA
AAACCGGCTGCAGTCCAAATCCTTGTTTAAATGGTGCTTACTGTTACACT
ATCAATCAGGACTTTTACTGTCACTGCAATAAGGAATTTTGGGGTAAACG
CTGTGAACATTCACGACCTTATTGTGGTAATGAATCATGTGAAAGCGCCT
ACGATGCGTGTTCTATGCCACAAATGTTAAATTCTAGTGGTATTAAGCAT
AACTATTGCGGCAAATACGGAACATGTTTGAGTCATGAAAAGGAAAAGTT
CATATGCAGATGCATGCCAGGGTTTGAGGGTGACTCGTGTGAAATTGATA
TTGATGATTGTAAAACGAATCCGTGCAAAAACGGAGGAATATGCATTGAC
AGCATCAATAATTTTGAATGTATTTGTGACAACGGATTCTTTGGGAAAAC
TTGTGAAGAAAGAACGGATTATTGCATCAAAAGTCCTTGTATGAATTACG
GTGTCTGCCTCCGGCATTCGGATGAATTATATAACGATTTCATCTGTGAA
TGCAAAAATAATTGGGGAGGCAGACTTTGCCATCTTCCGAAACATTCGAT
ATGTGACAGTAATCCTTGTTTGAATGGAGGAAGTTGTTCTAGATTATCTA
CGTTAAATGGCTTTCAGTGCCATTGTAATCAAGGCTGGATTGGGACCGTT
TGTCAGTTTCTTCACATTGACTTTCAGCCTTGTAGAAGAAAAAATCTTTG
TAAAAATGAAGGGGTTTGTATCAACGTTGGCTATAATGATTTCACTTGTC
ACTGCAAACCGGGATTTGAAGGCAAGCATTGTGACATAAACACAAACGAA
TGCAATCCAAATCCTTGTTTCAACGGCGGGAAATGCATTGATAAACTAAA
TTCCTACAGATGCATTTGCGCAAAAGGATTTTACGGTTCAAACTGTCAGC
TAAATTATGATGAATGTGCATCTTTTCCTTGTGCGTACGGTGCGATTTGC
GTTGACAGAATTGATGATTTCGAGTGTCGGTGTCCTGAAGGTCGAGATGG
AAAACTTTGCGACCATGTAAAAAATAATGAATCTCCTCAACCTCCATCGT
GCGTATATTATAACAGGATTTTCGACAGTGGAGAAACTTGGTCGTATAAC
TGTCAGAATTGTGCATGTGATCGTGGAAAAGTCACTTGTGAAAGTGTTCC
CTGTGGAGTATGGACATGCTTACAAGCCAATGGAACTGATGACCCATATG
CATGTAAACCCGGTGAAATGTGTTACTCTTTCCCATTCAATCCGAAAAGG
TGTTTTGTTCCTCCTTGTGTTCCTAAAGCTCGCTGTATTAAAGAATACTC
TATTTATCCAAATAATCAAATATCCTGGCCGGGTGAATCGCATAAAGATT
GCCAACCGAATTCAATTAAAAATCATAATTATTGTGCCAAAATTATTCTT
ACTTTTAATAAGAAAAACGTTCCTATCGGAATAACAATCGACGATATTTG
TGATGGAATCAAAACTTTGAAATGTATTCAAGACCTAAATGGTACCCCAA
GGGGTAGATCCTTAGGAATAAGTTGCGATATTAATGAAAATAATTCAACT
ATTGTAAATGTGGCGATTTACTCGCCAATGGAAAACATATATATTGACGA
ATTGAAAAACTCCAGACCATTTGCTCACTACCTCAGTGGAGTTATTGCAA
AAGGTTTGATTGATGTAATAAAAAATAACAATACGTTTTTCACCGGCCTG
GTGGACATAACAATTCACACATTGTTATTGAATTCTGACTCCTTTGACCG
AGCAACTTTGATAAAGTACTTATTGGTACCAATAATCGCTTTTGGAGTTT
TAGTGCTGATCGGTGCCTATTGGTACCATCGGAAAAAAATGGTAGAGATT
CGTGAAAAATACGCAAACAGTACGAAAATAAATAACAACAACCTTCAATC
TCAACCTCTGAATCCCGTAAGATCTCAATATCCGATTATGAGACCAACAG
TGCAAAATAAACATTTAACTGAGCCGCCGAATTTCTACGAGAGAAACATT
TCCAATTCCACTTCGAGATTCGCTTGGCCGAAATTTCAGCATCCGTTTCA
AAATTGAACATTTTACAAGACCAAATCAAAATTGTGATTTTTGTACAGGA
TTTAATATCGACTGTAAATATTTTTTCCTTCTTTTTTATGTTAATGTCTG
TGTGTTTGTGTGTTTGTCTGTGTGTGTTCTTACGCGTGATTGTGTACGCG
CAAGTGCTTGTATGCCAGCTATTTCATTATTGTCATGTCATTTGTGATAA
GTTTTTTTTGGAATTCGTAGAATTCGCTAATTGAAAATATTTAAATTTCA
TCGATTTCCGG
back to top

protein sequence of SMED30018205-orf-1

>SMED30018205-orf-1 ID=SMED30018205-orf-1|Name=SMED30018205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
LEIIFCFLEIFHGFVESKSQFSLKITKYIKYSFQRLDGKCCGDHGSVIQH
TCTVPCIQRFSICLEYYHASVSPNDPTPYTGHCAYGKRLTEIWGDSSMKF
NKESTHSYKFTIKSSWPGSITLIIEAYDTSETNPYRKAVIDRVVYKNFLK
PSYNSSMWNDVVLSNDRSVYQFSMNLICKPDYYGEFCDRYCKNNGGHYKC
DINGEKVCDYGWMGSDCNNTICQPGCHRIHGYCENPGECRCRAGWQGTFC
DECMKYPGCKHGTCVDSPWTCSCEITGAVNFAIRVSIIARRTTRVRMEES
VKTYYQKSNHINAFAHQVLKAETVRLILAFRIHVKKEHA*
back to top

protein sequence of SMED30018205-orf-2

>SMED30018205-orf-2 ID=SMED30018205-orf-2|Name=SMED30018205-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=863bp
MKSKGEFYCQCIERWTGKLCDQDTSICDQNSCQNGGQCGKDENGNRRCIC
QQGYKGSECHLAAPCENSQCKHALDCQIQSTALGDYKCLCQPGYTGKYCD
KEINECVPNPCKNNGVCTDSINDYKCNCSTSFKGKNCELNIACQNQPCKN
GGVCQEVDTGYTCKCKTGYTGTNCEIYKTGCSPNPCLNGAYCYTINQDFY
CHCNKEFWGKRCEHSRPYCGNESCESAYDACSMPQMLNSSGIKHNYCGKY
GTCLSHEKEKFICRCMPGFEGDSCEIDIDDCKTNPCKNGGICIDSINNFE
CICDNGFFGKTCEERTDYCIKSPCMNYGVCLRHSDELYNDFICECKNNWG
GRLCHLPKHSICDSNPCLNGGSCSRLSTLNGFQCHCNQGWIGTVCQFLHI
DFQPCRRKNLCKNEGVCINVGYNDFTCHCKPGFEGKHCDINTNECNPNPC
FNGGKCIDKLNSYRCICAKGFYGSNCQLNYDECASFPCAYGAICVDRIDD
FECRCPEGRDGKLCDHVKNNESPQPPSCVYYNRIFDSGETWSYNCQNCAC
DRGKVTCESVPCGVWTCLQANGTDDPYACKPGEMCYSFPFNPKRCFVPPC
VPKARCIKEYSIYPNNQISWPGESHKDCQPNSIKNHNYCAKIILTFNKKN
VPIGITIDDICDGIKTLKCIQDLNGTPRGRSLGISCDINENNSTIVNVAI
YSPMENIYIDELKNSRPFAHYLSGVIAKGLIDVIKNNNTFFTGLVDITIH
TLLLNSDSFDRATLIKYLLVPIIAFGVLVLIGAYWYHRKKMVEIREKYAN
STKINNNNLQSQPLNPVRSQYPIMRPTVQNKHLTEPPNFYERNISNSTSR
FAWPKFQHPFQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR033108Jag2
IPR001774DSL
IPR011651Notch_ligand_N
IPR026219Jagged/Serrate
IPR000742EGF-like_dom
IPR001881EGF-like_Ca-bd_dom
IPR001007VWF_dom
IPR013032EGF-like_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0005112Notch binding
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007219Notch signaling pathway
GO:0007154cell communication
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000742EGF-like domainSMARTSM00181egf_5coord: 252..283
e-value: 0.16
score: 21.1
coord: 288..325
e-value: 8.8E-6
score: 35.2
coord: 221..251
e-value: 18.0
score: 12.9
IPR000742EGF-like domainPFAMPF00008EGFcoord: 289..322
e-value: 2.2E-7
score: 31.0
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 218..251
score: 10.324
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 255..283
score: 7.408
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 285..325
score: 20.634
IPR001774Delta/Serrate/lag-2 (DSL) proteinSMARTSM00051dsl11coord: 158..217
e-value: 1.6E-10
score: 50.9
IPR001774Delta/Serrate/lag-2 (DSL) proteinPFAMPF01414DSLcoord: 158..217
e-value: 2.0E-14
score: 53.6
IPR001774Delta/Serrate/lag-2 (DSL) proteinPROSITEPS51051DSLcoord: 176..217
score: 11.964
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 285..325
e-value: 0.0041
score: 21.1
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 288..329
e-value: 2.6E-11
score: 44.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 222..287
e-value: 2.5E-22
score: 80.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.140coord: 179..221
e-value: 1.3E-9
score: 40.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.3510coord: 19..178
e-value: 9.2E-24
score: 85.8
NoneNo IPR availablePANTHERPTHR24049FAMILY NOT NAMEDcoord: 10..339
NoneNo IPR availablePRODOMPD936484coord: 178..326
e-value: 2.0E-4
score: 109.0
NoneNo IPR availableCDDcd00054EGF_CAcoord: 287..325
e-value: 7.2786E-7
score: 43.009
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 292..327
IPR011651Notch ligand, N-terminal domainPFAMPF07657MNNLcoord: 20..97
e-value: 5.7E-14
score: 51.9
IPR033108Protein jagged-2PANTHERPTHR24049:SF18DELTA-LIKE PROTEINcoord: 10..339
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 239..250
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 271..282
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 313..324
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 313..324