Oxysterol-binding protein

Overview
NameOxysterol-binding protein
Smed IDSMED30018203
Length (bp)1814
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxysterol-binding protein (SMED30018203) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30018203) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxysterol-binding protein (SMED30018203) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30018203) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018203

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018203SMESG000016876.1 SmedASXL_009057SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30018203SMESG000016876.1 dd_Smed_v4_12759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018203SMESG000016876.1 dd_Smed_v4_12759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018203SMESG000016876.1 dd_Smed_v4_12759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30018203SMESG000016876.1 dd_Smed_v6_12759_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBPL2 (oxysterol binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:15761])

HSP 1 Score: 296.204 bits (757), Expect = 1.569e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   28 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 448          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBPL2 (oxysterol binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:15761])

HSP 1 Score: 296.59 bits (758), Expect = 1.839e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   48 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 468          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBPL2 (oxysterol binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:15761])

HSP 1 Score: 296.975 bits (759), Expect = 2.079e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   60 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 480          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBPL2 (oxysterol binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:15761])

HSP 1 Score: 296.975 bits (759), Expect = 2.079e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   60 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 480          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBPL2 (oxysterol binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:15761])

HSP 1 Score: 296.975 bits (759), Expect = 2.079e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   60 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 480          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-2 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:B2D6P3])

HSP 1 Score: 186.037 bits (471), Expect = 2.023e-52
Identity = 144/500 (28.80%), Postives = 232/500 (46.40%), Query Frame = 3
Query:  153 LFSKKMDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFK-IGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            LF +K D+ +  I+ + +    +  Q   R  LP       E+ ++W +++ N GKD S+ T+P+ +NEP+SFLQR+SE ++Y+ LL +A+  +D + R+E +  F ++ VS+ +KR  KPFNPLL ETFEL R    G  F++EQVSHHPPISA Y E++  F   G++ P L FW   L   P  +L +      E Y+W      I N+++GK+ +       I+   T   AV  + + G++   G D     +E H++   + K+K +YG W   LF  S D+   ++ +K +                  LR F                      +   S  D   + PG                       LW  +  P      + FT FT+ LNE+       + P+DSR+R D++ LE+G  D+A + K + E +QR+ R              +WF   +  +     W + G Y+ R++  C ++F
Sbjct:    4 LFREKKDMGSPKIQNFKRQTVLHKGQ---RTRLPATYIA-PEDVSIWDIIRPNLGKDFSRFTVPVFMNEPLSFLQRLSENVQYNYLLEKAAKCSDDMERIEYVAAFALATVSANHKRLSKPFNPLLLETFELERN---GVRFLAEQVSHHPPISAVYAESDE-FTVEGTVEPTLGFWMTKLLANPHAHLKLTFKKTGETYSWSAPKCAIYNVIMGKMYMNFTSHMKIESSGT-YDAVFSFDNKGYYNHKGGDV---HVEGHIFEGKN-KIKALYGNW--TLFLASCDNEDFKHHRKEY------------------LRMF----------------------NETVSEKDQGPVVPG--------------------SKILWVSNQIPKLFDDQFHFTNFTLSLNEMYPGMSDTVAPTDSRRRKDMKALEDGKNDEAEEFKHKYEEEQRERRTTKTGDV------PMWFAKNDEGH-----WAYKGGYWDRDYSNCLELF 417          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-2 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:B2D6P3])

HSP 1 Score: 183.341 bits (464), Expect = 1.639e-51
Identity = 135/459 (29.41%), Postives = 216/459 (47.06%), Query Frame = 3
Query:  276 EESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFK-IGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            E+ ++W +++ N GKD S+ T+P+ +NEP+SFLQR+SE ++Y+ LL +A+  +D + R+E +  F ++ VS+ +KR  KPFNPLL ETFEL R    G  F++EQVSHHPPISA Y E++  F   G++ P L FW   L   P  +L +      E Y+W      I N+++GK+ +       I+   T   AV  + + G++   G D     +E H++ +   K+K +YG W   LF  S D+   ++ +K +                  LR F                      +   S  D   + PG                       LW  +  P      + FT FT+ LNE+       + P+DSR+R D++ LE+G  D+A + K + E +QR+ R              +WF   +  +     W + G Y+ R++  C ++F
Sbjct:   31 EDVSIWDIIRPNLGKDFSRFTVPVFMNEPLSFLQRLSENVQYNYLLEKAAKCSDDMERIEYVAAFALATVSANHKRLSKPFNPLLLETFELERN---GVRFLAEQVSHHPPISAVYAESDE-FTVEGTVEPTLGFWMTKLLANPHAHLKLTFKKTGETYSWSAPKCAIYNVIMGKMYMNFTSHMKIESSGT-YDAVFSFDNKGYYNHKGGDV---HVEGHIF-EGKNKIKALYGNW--TLFLASCDNEDFKHHRKEY------------------LRMF----------------------NETVSEKDQGPVVPG--------------------SKILWVSNQIPKLFDDQFHFTNFTLSLNEMYPGMSDTVAPTDSRRRKDMKALEDGKNDEAEEFKHKYEEEQRERRTTKTGDV------PMWFAKNDEGH-----WAYKGGYWDRDYSNCLELF 407          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 122.865 bits (307), Expect = 7.973e-30
Identity = 82/253 (32.41%), Postives = 143/253 (56.52%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNR-LEAHLYNKHSEKVK--VIYGRWNEVLFSVSADDWKLRNEK 1034
            NLWS++K+  GK+LSK  MP+N +EPIS LQR++E +EY+NLL +   +   + ++  +  +  S+ S+T  R+ KPFNPLLGETFE +R ++ G+  V+EQVSHHPP +A + E   +   +       +F GK L + P G  ++        +++  + + ++N+++GK+ I + G+  I    TN K +LK+    +F      SR +  + +   + +E +   V+ G W++ +  +    W   +EK
Sbjct:   65 NLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLL-ETGAKLSTLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGW-TMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYF------SREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEK 309          

HSP 2 Score: 61.2326 bits (147), Expect = 1.223e-9
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXX--------XXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYF----QRNWEICPDIF 1649
            +W  +P P ++   ++FT   + LNE P +    + P+DSR RPD RL+ENG  D+A+++K  +E KQ         +     K     +E +  WF   + E +      F G Y+    Q+NWE CPDIF
Sbjct:  322 IWTANPLPKNAEKMHNFTKLAIELNE-PEE---GVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 449          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 122.479 bits (306), Expect = 4.791e-29
Identity = 82/253 (32.41%), Postives = 143/253 (56.52%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNR-LEAHLYNKHSEKVK--VIYGRWNEVLFSVSADDWKLRNEK 1034
            NLWS++K+  GK+LSK  MP+N +EPIS LQR++E +EY+NLL +   +   + ++  +  +  S+ S+T  R+ KPFNPLLGETFE +R ++ G+  V+EQVSHHPP +A + E   +   +       +F GK L + P G  ++        +++  + + ++N+++GK+ I + G+  I    TN K +LK+    +F      SR +  + +   + +E +   V+ G W++ +  +    W   +EK
Sbjct:  243 NLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLL-ETGAKLSTLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWT-MYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYF------SREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEK 487          

HSP 2 Score: 61.2326 bits (147), Expect = 1.263e-9
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXX--------XXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYF----QRNWEICPDIF 1649
            +W  +P P ++   ++FT   + LNE P +    + P+DSR RPD RL+ENG  D+A+++K  +E KQ         +     K     +E +  WF   + E +      F G Y+    Q+NWE CPDIF
Sbjct:  500 IWTANPLPKNAEKMHNFTKLAIELNE-PEEG---VAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 627          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 122.479 bits (306), Expect = 6.540e-29
Identity = 82/253 (32.41%), Postives = 143/253 (56.52%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNR-LEAHLYNKHSEKVK--VIYGRWNEVLFSVSADDWKLRNEK 1034
            NLWS++K+  GK+LSK  MP+N +EPIS LQR++E +EY+NLL +   +   + ++  +  +  S+ S+T  R+ KPFNPLLGETFE +R ++ G+  V+EQVSHHPP +A + E   +   +       +F GK L + P G  ++        +++  + + ++N+++GK+ I + G+  I    TN K +LK+    +F      SR +  + +   + +E +   V+ G W++ +  +    W   +EK
Sbjct:  382 NLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLL-ETGAKLSTLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGW-TMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYF------SREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEK 626          

HSP 2 Score: 61.6178 bits (148), Expect = 1.321e-9
Identity = 44/132 (33.33%), Postives = 67/132 (50.76%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXX--------XXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYF----QRNWEICPDIF 1649
            +W  +P P ++   ++FT   + LNE P +    + P+DSR RPD RL+ENG  D+A+++K  +E KQ         +     K     +E +  WF   + E +      F G Y+    Q+NWE CPDIF
Sbjct:  639 IWTANPLPKNAEKMHNFTKLAIELNE-PEEG---VAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 766          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0343288)

HSP 1 Score: 275.018 bits (702), Expect = 1.168e-85
Identity = 173/476 (36.34%), Postives = 265/476 (55.67%), Query Frame = 3
Query:  228 QYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELP--PSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            ++  R  LP  M  + E S +W+++K+  GKDLSK TMP+ LNEP+SFLQR+ EYMEY+ LL +A+ +  P +R++ +  F +S ++S ++R GKPFNPLLGET+EL + +   Y  V EQVSHHPP+SAF+ E++  F+F G++ PK++FWGKS+E+ PKG + +     NE Y+W NV   ++N+++G++ I   G+  I    T   A L +KS G        + +R+E  + +     +  +YG+W E +   SA+ +    ++   +    D S  G   K+    F   +SF +    SL + D S  ++            P        P S     L +P    LW   PRP +   YY FT+F + LN +  +    L   P+DSR RPDI  LE GN+D ASKEK+RLE KQR TRK+ K+   S +    WF    + ++ I +W+++G Y+ R ++    IF
Sbjct:    8 EHVERTELPATMISRKEVS-IWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAESKD-FKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAG----SGAKNLHRVEGFVKDASETNLYFLYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKM----FSKLNSFKLNSFRSLSIQDVSSDSY------------PPMEQEGDIPKSDSAYSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTN-SDDWSPRWFKYATNPHTKIDDWLYSGGYWDRKYDNTDTIF 457          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0072201)

HSP 1 Score: 274.248 bits (700), Expect = 2.396e-85
Identity = 173/476 (36.34%), Postives = 267/476 (56.09%), Query Frame = 3
Query:  228 QYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELP--PSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            ++  R  LP  M  + E S +W+++K+  GKDLSK TMP+ LNEP+SFLQR+ EYMEY+ LL +A+ +  P +R++ +  F +S ++S ++R GKPFNPLLGET+EL + +   Y  V EQVSHHPP+SAF+ E++  F+F G++ PK++FWGKS+E+ PKG + +     NE Y+W NV   ++N+++G++ I   G+  I    T   A L +KS G        + +R+E  + +     +  +YG+W E +   SA+ +    ++   +    D S  G   K+    F   +SF +    SL + DS     +   P++ +   P          S     L +P    LW   PRP +   YY FT+F + LN +  +    L   P+DSR RPDI  LE GN+D ASKEK+RLE KQR TRK+ K+   S +    WF    + ++ I +W+++G Y+ R ++    IF
Sbjct:    8 EHVERTELPATMISRKEVS-IWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAESKD-FKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAG----SGAKNLHRVEGFVKDASETNLYFLYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKM----FSKLNSFKLNSFRSLSIQDS-----DSYPPMEQEGDIP---------KSDSAYSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTN-SDDWSPRWFKYATNPHTKIDDWLYSGGYWDRKYDNTDTIF 455          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: Osbp (gene:FBgn0020626 transcript:FBtr0084801)

HSP 1 Score: 159.844 bits (403), Expect = 5.170e-41
Identity = 85/235 (36.17%), Postives = 137/235 (58.30%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKC--LTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWN 983
            +LW ++K+  GKDLSK  MPIN NEP+S LQR+ E  EY+ +L  A+   D   +L  I  F +S  ++T  R+GKPFNPLLGET+E +R ++ G+  ++EQVSHHPP++A + E++ +   W       +F GK ++I P G +Y+   +    Y+W  V + +NN+++GK+ +   GE  I+        K +L +    +F    D  R+ ++  + NK +E   V+ G W+
Sbjct:  399 SLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNW-TCWQEFSMTSKFRGKYVQINPLGGVYVQFPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFS--RDVQRS-VKGVVMNKDNEVKWVVRGTWD 629          

HSP 2 Score: 60.4622 bits (145), Expect = 3.971e-9
Identity = 46/133 (34.59%), Postives = 69/133 (51.88%), Query Frame = 3
Query: 1287 FLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQEC--------QALWFDLKESEYSNIPEWVFNGKYFQ----RNWEICPDIF 1649
              W+  P PP S  +Y+FT     LNE        + P+DSR RPD RL+E G+ D+++KEK RLE KQR  R++ + +              + +WF  ++ E S     VF   Y++    +N+E CPDI+
Sbjct:  656 LAWRRRPAPPDSDKFYNFTTLACQLNEEEEG----VAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQRTERRRRENEAEEAAAEGRPYPAYEPMWFKREKEEGSEEYVHVFKNTYWEAKAAQNFEGCPDIY 784          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG42668 (gene:FBgn0261550 transcript:FBtr0302666)

HSP 1 Score: 108.997 bits (271), Expect = 1.473e-24
Identity = 80/261 (30.65%), Postives = 128/261 (49.04%), Query Frame = 3
Query:  279 ESNLWSLVKS-NTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERG--YIFVSEQVSHHPPISAFYVE-AEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNE-------------VLFSVSAD 1010
            +S +W +VK    G DLSK  +P  + EP SFL ++S+   +++LL +A  E+D   R++L+  + +S      K   KP+NP+LGE F    +   G    +++EQVSHHPP+SAFYV   E  F    S+  K +F+G S     +G   + LL   E YT     +    +L+G +++   G+  I+C  T  +  L++K   +   G D +   +      K  E +  I G W++             VLF V A+
Sbjct:  103 KSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLSKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAEQVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATTPYAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKPFLG-GADATNVVVGKIKLGK--ETLATINGHWDKECRVKDSKTGEETVLFKVDAE 360          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG42668 (gene:FBgn0261550 transcript:FBtr0306633)

HSP 1 Score: 109.383 bits (272), Expect = 1.713e-24
Identity = 81/261 (31.03%), Postives = 128/261 (49.04%), Query Frame = 3
Query:  279 ESNLWSLVKS-NTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERG--YIFVSEQVSHHPPISAFYVE-AEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNE-------------VLFSVSAD 1010
            +S +W +VK    G DLSK  +P  + EP SFL ++S+   +++LL +A  E+D   R++L+  + +S      K   KP+NP+LGE F    +   G    +++EQVSHHPP+SAFYV   E  F    S+  K +F+G S     +G   + LL   E YT     +    +L+G +++   G+  I+C  T  +  L++K    F  G D +   +      K  E +  I G W++             VLF V A+
Sbjct:  468 KSLIWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLSKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAEQVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATTPYAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKP-FLGGADATNVVVGKIKLGK--ETLATINGHWDKECRVKDSKTGEETVLFKVDAE 725          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbpl2b (oxysterol binding protein-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6138])

HSP 1 Score: 291.582 bits (745), Expect = 1.082e-91
Identity = 185/471 (39.28%), Postives = 265/471 (56.26%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  + + S +WS++K   G +LSK TMPI  NEP+SFLQR++EYME++ LL +A L+ND I R++ +  F +S V+S + R+GKPFNPLLGET+EL R E++G+  +SEQVSHHPPISAF+ E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K  VIYG+W E ++SV  D       +KL +   TD+                       +    E P++   + +    +                   +E    +P    LW++S RPP S   Y+FT F M LNE+       L P+D R RPDIR +ENGN+D+AS+EK RLE KQR  RK+       +E    WF L  + Y+   +W++ G YF R +  CPDI+
Sbjct:   51 RSCLPAPMFSRNDFS-VWSILKKCIGLELSKITMPIVFNEPLSFLQRLTEYMEHTYLLQKACLQNDSIERMQTVAAFAVSAVASQWDRTGKPFNPLLGETYELTR-EDQGFRLISEQVSHHPPISAFHTESLMGDFVFHGSIYPKLKFWGKSVEAEPKGTITLELHKHKEAYTWTNPFCCVHNVILGKLWIEQYGTVEIINHSTGEKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRCVIYGKWTECMWSV--DPQAYEAHRKLEKKGTTDT-----------------------KKQKQEEPEAVNEDADEMPEV-------------------QETVAVIPGSTLLWRISSRPPLSAEMYNFTNFAMALNELEPGMEGVLAPTDCRLRPDIRAMENGNMDEASREKERLEEKQRAARKERAKN--EEEWSTRWFQLGTNPYTGSQDWLYTGGYFDRKYRNCPDIY 469          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbpl2a (oxysterol binding protein-like 2a [Source:ZFIN;Acc:ZDB-GENE-091116-46])

HSP 1 Score: 290.041 bits (741), Expect = 5.704e-91
Identity = 182/471 (38.64%), Postives = 255/471 (54.14%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  + + S +W  +K   G +LSK TMPI  NEP+SFLQRI+EYME++ L+ +A   +D I R++ +  F +S V+S + R+GKPFNPLLGETFEL R++E GY  +SEQVSHHPPISAFY E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E H+ +K  +K  V+YG+W E ++S+         E K++         +G  SK                       D   G  +     D                  +E    +P    LW+V+PRPP S   Y+FT F M LNE+       L P+D R RPDIR +ENG+ID AS+EK RLE KQR  R++       ++    WF    + Y+   +W++ G YF R +   PDI+
Sbjct:   58 RTTLPAPMFSRNDFS-VWGFLKKCIGMELSKITMPIVFNEPLSFLQRITEYMEHTYLIHKACTLSDSIERMQFVAAFAVSAVASQWDRTGKPFNPLLGETFELTREDE-GYRMISEQVSHHPPISAFYAESLNQDFSFHGSIYPKLKFWGKSVEAEPKGTMTLELSKHREAYTWTNPMCCVHNVILGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGHIQDKSKKKHWVMYGKWTECMYSI---------EPKVYEANKKAEKKSGGESKKHK-------------------QDQGTGGEDADEMPDV-----------------QETVTMIPGSKLLWRVAPRPPQSTEMYNFTNFAMTLNELEPGMTEVLAPTDCRLRPDIRAMENGDIDSASREKERLEEKQRAARRERAKD--EEDWSTRWFQQGNNPYTGTADWIYKGGYFDRRYSELPDIY 475          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbpl2a (oxysterol binding protein-like 2a [Source:ZFIN;Acc:ZDB-GENE-091116-46])

HSP 1 Score: 289.656 bits (740), Expect = 6.113e-91
Identity = 182/471 (38.64%), Postives = 255/471 (54.14%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  + + S +W  +K   G +LSK TMPI  NEP+SFLQRI+EYME++ L+ +A   +D I R++ +  F +S V+S + R+GKPFNPLLGETFEL R++E GY  +SEQVSHHPPISAFY E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E H+ +K  +K  V+YG+W E ++S+         E K++         +G  SK                       D   G  +     D                  +E    +P    LW+V+PRPP S   Y+FT F M LNE+       L P+D R RPDIR +ENG+ID AS+EK RLE KQR  R++       ++    WF    + Y+   +W++ G YF R +   PDI+
Sbjct:   50 RTTLPAPMFSRNDFS-VWGFLKKCIGMELSKITMPIVFNEPLSFLQRITEYMEHTYLIHKACTLSDSIERMQFVAAFAVSAVASQWDRTGKPFNPLLGETFELTREDE-GYRMISEQVSHHPPISAFYAESLNQDFSFHGSIYPKLKFWGKSVEAEPKGTMTLELSKHREAYTWTNPMCCVHNVILGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGHIQDKSKKKHWVMYGKWTECMYSI---------EPKVYEANKKAEKKSGGESKKHK-------------------QDQGTGGEDADEMPDV-----------------QETVTMIPGSKLLWRVAPRPPQSTEMYNFTNFAMTLNELEPGMTEVLAPTDCRLRPDIRAMENGDIDSASREKERLEEKQRAARRERAKD--EEDWSTRWFQQGNNPYTGTADWIYKGGYFDRRYSELPDIY 467          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbpl2b (oxysterol binding protein-like 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6138])

HSP 1 Score: 289.271 bits (739), Expect = 7.931e-91
Identity = 184/471 (39.07%), Postives = 265/471 (56.26%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  + + S +WS++K   G +LSK TMPI  NEP+SFLQR++EYME++ LL +A L++D I R++ +  F +S V+S + R+GKPFNPLLGET+EL R E++G+  +SEQVSHHPPISAF+ E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K  VIYG+W E ++SV  D       +KL +   TD+                       +    E P++   + +    +                   +E    +P    LW++S RPP S   Y+FT F M LNE+       L P+D R RPDIR +ENGN+D+AS+EK RLE KQR  RK+       +E    WF L  + Y+   +W++ G YF R +  CPDI+
Sbjct:   54 RSCLPAPMFSRNDFS-VWSILKKCIGLELSKITMPIVFNEPLSFLQRLTEYMEHTYLLQKACLQSDSIERMQTVAAFAVSAVASQWDRTGKPFNPLLGETYELTR-EDQGFRLISEQVSHHPPISAFHTESLMGDFVFHGSIYPKLKFWGKSVEAEPKGTITLELHKHKEAYTWTNPFCCVHNVILGKLWIEQYGTVEIINHSTGEKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRCVIYGKWTECMWSV--DPQAYEAHRKLEKKGTTDT-----------------------KKQKQEEPEAVNEDADEMPEV-------------------QETVAVIPGSTLLWRISSRPPLSAEMYNFTNFAMALNELEPGMEGVLAPTDCRLRPDIRAMENGNMDEASREKERLEEKQRAARKERAKN--EEEWSTRWFQLGTNPYTGSQDWLYTGGYFDRKYRNCPDIY 472          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: CABZ01084566.1 (oxysterol-binding protein-related protein 1-like [Source:NCBI gene;Acc:100331149])

HSP 1 Score: 204.142 bits (518), Expect = 8.968e-59
Identity = 113/256 (44.14%), Postives = 171/256 (66.80%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV 1001
            HR  LP  M  +   S +WS++K   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +A+   D I+R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ ++SEQVSHHPPISAF+ E  +  F F GS+YPKL+FWGKS+E  P+G + + L   +E YTW N    ++N+++G++ I   G   I    T  +  L +KS G F  G++   +++E ++ +K  +KV  +YG+W E L+SV
Sbjct:   36 HRSALPAAMFSRNNIS-MWSVLKKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHRANASQDSIHRMKCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRWISEQVSHHPPISAFHAEGIKKDFMFHGSIYPKLKFWGKSVEAEPRGIISLELPGHSEAYTWTNPTCCVHNIIMGQLWIEQYGNVEIINHKTGERCCLTFKSCGIF--GKEL--HKVEGYILDKSKKKVCALYGKWTECLYSV 285          

HSP 2 Score: 102.834 bits (255), Expect = 6.731e-23
Identity = 56/126 (44.44%), Postives = 78/126 (61.90%), Query Frame = 3
Query: 1272 LPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +P    +W++SPRP +S  YY FT F + LNE+  +    LPP+D R RPDIR LENGNID AS EK+RLE KQR  RK       ++E +  WF    + ++  P+W++N  Y+ RN+   PDI+
Sbjct:  329 IPGSELIWRISPRPDNSGKYYAFTTFALQLNELDVEMEKVLPPTDCRLRPDIRALENGNIDIASAEKNRLEEKQRTARKDRSKS--NEEWKIRWFHQGSNPHTGAPDWLYNDNYWSRNYSQLPDIY 452          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ndufb10 (NADH:ubiquinone oxidoreductase subunit B10 [Source:Xenbase;Acc:XB-GENE-5887772])

HSP 1 Score: 278.485 bits (711), Expect = 3.619e-86
Identity = 178/477 (37.32%), Postives = 270/477 (56.60%), Query Frame = 3
Query:  231 YCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS---VSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +C R  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR+SEYME++ L+ +A+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I    T  K +L +K    F    D   +++E ++ +K  +K+  +YG+W E L++    + D +K +N+KK       DS+               SS+ +  +P  + +PDS                              E + + +P    LW+++PRPP+S   Y+FT F + LNE  +D    +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        +E +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:   86 FC-RTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLSEYMEHTYLIHKANQCSDTVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGINNDFVFHGSIYPKLKFWGKSVEAEPKGIITLELLKHKEAYTWTNPTCCVHNIIVGKLWIEQYGNMEITNHKTGEKCILNFKPSRLF----DKELHKVEGYIQDKSKKKLCSLYGKWTECLYTTDPATFDAFK-KNDKK------EDST---------------SSAGNAEEPDEMPLPDS------------------------------ESVQV-IPGSTQLWRIAPRPPNSAQMYNFTNFALALNEFDKDMEGTIPKTDCRLRPDIRAMENGEIDSASEEKKRLEEKQRAARKSRSKT--DEEWKTRWFRQGPNPYNGSQDWLYSGNYWDRNYSNLPDIY 500          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ndufb10 (NADH:ubiquinone oxidoreductase subunit B10 [Source:Xenbase;Acc:XB-GENE-5887772])

HSP 1 Score: 278.485 bits (711), Expect = 2.209e-85
Identity = 170/471 (36.09%), Postives = 264/471 (56.05%), Query Frame = 3
Query:  249 LPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS---VSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR+SEYME++ L+ +A+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I    T  K +L +K    F    D   +++E ++ +K  +K+  +YG+W E L++    + D +K  ++K++    +        V + GN            +P  + +PDS                              E + + +P    LW+++PRPP+S   Y+FT F + LNE  +D    +P +D R RPDIR +ENG ID AS+EK RLE   +Q   +    K  +E +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:  145 LPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLSEYMEHTYLIHKANQCSDTVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGINNDFVFHGSIYPKLKFWGKSVEAEPKGIITLELLKHKEAYTWTNPTCCVHNIIVGKLWIEQYGNMEITNHKTGEKCILNFKPSRLF----DKELHKVEGYIQDKSKKKLCSLYGKWTECLYTTDPATFDAFKKNDKKEVEEKQVK-------VKQAGNAE----------EPDEMPLPDS------------------------------ESVQV-IPGSTQLWRIAPRPPNSAQMYNFTNFALALNEFDKDMEGTIPKTDCRLRPDIRAMENGEIDSASEEKKRLEE--KQRAARKSRSKTDEEWKTRWFRQGPNPYNGSQDWLYSGNYWDRNYSNLPDIY 559          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ndufb10 (NADH:ubiquinone oxidoreductase subunit B10 [Source:Xenbase;Acc:XB-GENE-5887772])

HSP 1 Score: 283.493 bits (724), Expect = 6.694e-84
Identity = 175/475 (36.84%), Postives = 267/475 (56.21%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS---VSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR+SEYME++ L+ +A+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I    T  K +L +K    F    D   +++E ++ +K  +K+  +YG+W E L++    + D +K  ++K++    +        V + GN            +P  + +PDS                              E + + +P    LW+++PRPP+S   Y+FT F + LNE  +D    +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        +E +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:  538 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLSEYMEHTYLIHKANQCSDTVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGINNDFVFHGSIYPKLKFWGKSVEAEPKGIITLELLKHKEAYTWTNPTCCVHNIIVGKLWIEQYGNMEITNHKTGEKCILNFKPSRLF----DKELHKVEGYIQDKSKKKLCSLYGKWTECLYTTDPATFDAFKKNDKKEVEEKQVK-------VKQAGNAE----------EPDEMPLPDS------------------------------ESVQV-IPGSTQLWRIAPRPPNSAQMYNFTNFALALNEFDKDMEGTIPKTDCRLRPDIRAMENGEIDSASEEKKRLEEKQRAARKSRSKT--DEEWKTRWFRQGPNPYNGSQDWLYSGNYWDRNYSNLPDIY 956          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ndufb10 (NADH:ubiquinone oxidoreductase subunit B10 [Source:Xenbase;Acc:XB-GENE-5887772])

HSP 1 Score: 279.641 bits (714), Expect = 5.669e-83
Identity = 176/475 (37.05%), Postives = 265/475 (55.79%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS---VSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR+SEYME++ L+ +A+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I    T  K +L +K    F    D   +++E ++ +K  +K+  +YG+W E L++    + D +K +N+KK                + GN            +P  + +PDS                              E + + +P    LW+++PRPP+S   Y+FT F + LNE  +D    +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        +E +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:  474 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLSEYMEHTYLIHKANQCSDTVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGINNDFVFHGSIYPKLKFWGKSVEAEPKGIITLELLKHKEAYTWTNPTCCVHNIIVGKLWIEQYGNMEITNHKTGEKCILNFKPSRLF----DKELHKVEGYIQDKSKKKLCSLYGKWTECLYTTDPATFDAFK-KNDKK----------------EAGNAE----------EPDEMPLPDS------------------------------ESVQV-IPGSTQLWRIAPRPPNSAQMYNFTNFALALNEFDKDMEGTIPKTDCRLRPDIRAMENGEIDSASEEKKRLEEKQRAARKSRSKT--DEEWKTRWFRQGPNPYNGSQDWLYSGNYWDRNYSNLPDIY 882          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ndufb10 (NADH:ubiquinone oxidoreductase subunit B10 [Source:Xenbase;Acc:XB-GENE-5887772])

HSP 1 Score: 279.641 bits (714), Expect = 1.020e-82
Identity = 173/471 (36.73%), Postives = 265/471 (56.26%), Query Frame = 3
Query:  249 LPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS---VSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR+SEYME++ L+ +A+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I    T  K +L +K    F    D   +++E ++ +K  +K+  +YG+W E L++    + D +K  ++K++    +        V + GN            +P  + +PDS                              E + + +P    LW+++PRPP+S   Y+FT F + LNE  +D    +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        +E +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:  511 LPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLSEYMEHTYLIHKANQCSDTVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGINNDFVFHGSIYPKLKFWGKSVEAEPKGIITLELLKHKEAYTWTNPTCCVHNIIVGKLWIEQYGNMEITNHKTGEKCILNFKPSRLF----DKELHKVEGYIQDKSKKKLCSLYGKWTECLYTTDPATFDAFKKNDKKEVEEKQVK-------VKQAGNAE----------EPDEMPLPDS------------------------------ESVQV-IPGSTQLWRIAPRPPNSAQMYNFTNFALALNEFDKDMEGTIPKTDCRLRPDIRAMENGEIDSASEEKKRLEEKQRAARKSRSKT--DEEWKTRWFRQGPNPYNGSQDWLYSGNYWDRNYSNLPDIY 925          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl2 (oxysterol binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2442832])

HSP 1 Score: 302.368 bits (773), Expect = 1.334e-95
Identity = 195/502 (38.84%), Postives = 286/502 (56.97%), Query Frame = 3
Query:  153 LFSKKMDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWK--LRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            L + K   S  N EK   P   N  Q  HR  LP PM  +++ S +WS++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS ++ P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAFY E     FRF GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N+++G++ I   G   I    T  K +L +K  G F  G++   +R+E ++ +K+ +K+ ++YG+W E L+ +    ++   + EK+            G  ++   +                   D  P   N   P D     P           ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ RK+   +    E +  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   36 LDTSKSTRSGKNGEK---PQQENGIQK-HRTALPAPMFTRSDFS-VWSILKKCIGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHKASSQSQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFYSEGLNQDFRFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVILGQLWIEQYGIVEIVNHRTGDKCILHFKPCGLF--GKEL--HRVEGYIQDKNRKKLFIMYGKWTECLWGIDPASYESFKKQEKR------------GDQARKAKM-------------------DDGPEKANSDVPGDVADDVP----------VAQETVQVIPGSKLLWRINSRPPNSAQMYNFTSFTVSLNELESGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARKERAKEDA--EWRTRWFSPGNNPYTGAPDWLYAGHYFERNFSDCPDIY 484          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl1a (oxysterol binding protein-like 1A [Source:MGI Symbol;Acc:MGI:1927551])

HSP 1 Score: 291.197 bits (744), Expect = 7.741e-92
Identity = 185/474 (39.03%), Postives = 272/474 (57.38%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV--SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LLD NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV  +  D   +N+KK                +  N +   SS     +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:   20 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLDHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKK-------------NTEEKKNSKQTSSSE----ESDEMPVPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 437          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl1a (oxysterol binding protein-like 1A [Source:MGI Symbol;Acc:MGI:1927551])

HSP 1 Score: 291.197 bits (744), Expect = 7.741e-92
Identity = 185/474 (39.03%), Postives = 272/474 (57.38%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV--SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LLD NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV  +  D   +N+KK                +  N +   SS     +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:   20 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLDHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKK-------------NTEEKKNSKQTSSSE----ESDEMPVPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 437          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl1a (oxysterol binding protein-like 1A [Source:MGI Symbol;Acc:MGI:1927551])

HSP 1 Score: 291.197 bits (744), Expect = 7.741e-92
Identity = 185/474 (39.03%), Postives = 272/474 (57.38%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV--SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LLD NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV  +  D   +N+KK                +  N +   SS     +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:   20 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLDHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKK-------------NTEEKKNSKQTSSSE----ESDEMPVPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 437          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl1a (oxysterol binding protein-like 1A [Source:MGI Symbol;Acc:MGI:1927551])

HSP 1 Score: 291.197 bits (744), Expect = 7.741e-92
Identity = 185/474 (39.03%), Postives = 272/474 (57.38%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV--SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LLD NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV  +  D   +N+KK                +  N +   SS     +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:   20 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLDHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYKKNDKK-------------NTEEKKNSKQTSSSE----ESDEMPVPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 437          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q8BX94|OSBL2_MOUSE (Oxysterol-binding protein-related protein 2 OS=Mus musculus OX=10090 GN=Osbpl2 PE=1 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 9.332e-95
Identity = 195/502 (38.84%), Postives = 286/502 (56.97%), Query Frame = 3
Query:  153 LFSKKMDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWK--LRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            L + K   S  N EK   P   N  Q  HR  LP PM  +++ S +WS++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS ++ P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAFY E     FRF GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N+++G++ I   G   I    T  K +L +K  G F  G++   +R+E ++ +K+ +K+ ++YG+W E L+ +    ++   + EK+            G  ++   +                   D  P   N   P D     P           ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ RK+   +    E +  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   36 LDTSKSTRSGKNGEK---PQQENGIQK-HRTALPAPMFTRSDFS-VWSILKKCIGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHKASSQSQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFYSEGLNQDFRFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVILGQLWIEQYGIVEIVNHRTGDKCILHFKPCGLF--GKEL--HRVEGYIQDKNRKKLFIMYGKWTECLWGIDPASYESFKKQEKR------------GDQARKAKM-------------------DDGPEKANSDVPGDVADDVP----------VAQETVQVIPGSKLLWRINSRPPNSAQMYNFTSFTVSLNELESGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARKERAKEDA--EWRTRWFSPGNNPYTGAPDWLYAGHYFERNFSDCPDIY 484          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q9H1P3|OSBL2_HUMAN (Oxysterol-binding protein-related protein 2 OS=Homo sapiens OX=9606 GN=OSBPL2 PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 9.983e-93
Identity = 185/472 (39.19%), Postives = 276/472 (58.47%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPY-FRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  +++ S +W+++K   G +LSK TMPI  NEP+SFLQRI+EYME+  L+ +AS +  P+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+ F+SEQVSHHPPISAF+ E   + F F GS+YPKL+FWGKS+E  P+G + + LL  NE YTW N    ++N++IGK+ I   G   I    T  K VL +K  G F  G++   +++E H+ +K+ +K+ +IYG+W E L+ +                P++  S      +  +LR            + L+  DS   + +    +                  ++E    +P    LW+++ RPP+S   Y+FT FT+ LNE+       LPP+D R RPDIR +ENGN+D AS+EK RLE KQR+ R++   ++   E Q  WF    + Y+  P+W++ G YF+RN+  CPDI+
Sbjct:   60 HRTSLPAPMFSRSDFS-VWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIR-EDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLF--GKEL--HKVEGHIQDKNKKKLFMIYGKWTECLWGID---------------PVSYESFKKQERRGDHLR-----------KAKLD-EDSGKADSDVADDVPV----------------AQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQREARRERAKEEA--EWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY 480          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q8K4M9|OSBL1_RAT (Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus OX=10116 GN=Osbpl1a PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 2.754e-87
Identity = 184/475 (38.74%), Postives = 274/475 (57.68%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV---SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL+ NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV   + D +K +N+KK   T    +S     S+               +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  + +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:  533 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSFSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYK-KNDKK--NTEEKKTSKQASTSE---------------ESDEMPVPDS-------------------------------ESVFVIPGSALLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMETVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 950          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q91XL9|OSBL1_MOUSE (Oxysterol-binding protein-related protein 1 OS=Mus musculus OX=10090 GN=Osbpl1a PE=1 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 5.094e-87
Identity = 186/475 (39.16%), Postives = 274/475 (57.68%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV---SADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LLD NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+SV   + D +K +N+KK                +  N +   SS     +   + VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV ++  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + YS   +W+++G Y+ RN+   PDI+
Sbjct:  533 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLDHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLYSVDPATFDAYK-KNDKK-------------NTEEKKNSKQTSSSE----ESDEMPVPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKEMESVIPKTDCRLRPDIRAMENGEIDLASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYSGAQDWIYSGSYWDRNYFNLPDIY 950          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q9BXW6|OSBL1_HUMAN (Oxysterol-binding protein-related protein 1 OS=Homo sapiens OX=9606 GN=OSBPL1A PE=1 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 1.574e-85
Identity = 182/472 (38.56%), Postives = 267/472 (56.57%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++   G +LSK TMP+  NEP+SFLQR++EYME++ L+ +AS  +DP+ R++ +  F +S V+S ++R+GKPFNPLLGET+EL R ++ G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL+ NE YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K  +K+  +YG+W E L+  S D       KK  +    +   +  +S    L   P             VPDS                               E    +P    LW+++PRPP+S   Y+FT F M+LNEV +D  S +P +D R RPDIR +ENG ID AS+EK RLE KQR  RK        ++ +  WF    + Y+   +W+++G Y+ RN+   PDI+
Sbjct:  533 HRTSLPSPMFSRNDFS-IWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVERMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-DDLGFRLISEQVSHHPPISAFHAEGLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKLWIEQYGNVEIINHKTGDKCVLNFKPCGLF--GKEL--HKVEGYIQDKSKKKLCALYGKWTECLY--SVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMP-------------VPDS-------------------------------ESVFIIPGSVLLWRIAPRPPNSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKS--EEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY 950          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A210PSS7 (Oxysterol-binding protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT23318 PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 3.139e-108
Identity = 195/477 (40.88%), Postives = 277/477 (58.07%), Query Frame = 3
Query:  219 NSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            + D+Y +R  LP PM  + + S +WS++K   GK+LSK TMP+  NEP+SF+QRISEYMEY++LL +AS+ +DP  R   ++ F +S +SS + R GKPFNPLLGETFELNR  + G+  V EQVSHHPP+SAF VE++ +F+  GS++PKL+FWGKS+EI PKG + + L    EVYTW NV   ++N+++GK+ I H G   I C  T  K+VL +K  GWF  G+D   +++E ++Y+K+  K K +YG W   LF +   D+                              F  +S     PS     + + G+ +    I  K ++                DLH+P Q  +W + PRP  S  Y+ FT F M LNE+  D   +L P+DSR RPDIRLLE G ID A+ EK+R+E KQR  RK+ K +    E   ++F    + ++   +W+F G Y+ R+W  CPDIF
Sbjct:   17 SDDRYIYRSRLPVPMFDRNDFS-IWSILKQCIGKELSKITMPVVFNEPLSFIQRISEYMEYTSLLEKASMASDPAERFAYVSAFAVSAISSNWDRIGKPFNPLLGETFELNR-SDLGFRLVGEQVSHHPPVSAFLVESK-HFKIHGSIHPKLKFWGKSVEINPKGMITLELTRHGEVYTWSNVNCCVHNVIVGKIWIEHYGVMEILCHKTGWKSVLNFKQSGWF--GKDL--HKVEGYVYDKNKVKRKALYGSWVYDLFMLDVADYD----------------------------GFMKNSASTQSPSHSAKSNGASGSSDVNDDISVKHLST--------------YDLHIPGQECIWTIHPRPEKSLQYFSFTLFAMALNELTPDIAGQLAPTDSRLRPDIRLLEEGQIDAAAAEKNRIEEKQRFARKERKRR--KDEWTPVFFKFGTNPHTGKEDWLFKGNYWDRDWSKCPDIF 442          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: V4AYH1 (Oxysterol-binding protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_171854 PE=3 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 6.796e-107
Identity = 193/455 (42.42%), Postives = 281/455 (61.76%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +LWS++K   GK+LSK TMP+  NEP+SFLQR++EYMEYS LL +AS  +DPI RL+ ++ F +S +SS ++R GKPFNPLLGET+EL+R  E G+  +SEQVSHHPPISAF++++ P ++F G +YPKL+FWGKS++I+PKG + + L   NEVYTW+NV   ++N+++GK+ + H G   I    T  +AVL +K  GWF  G+D   +++E ++Y+   +K+K I+G W   LFSV+A  +              D+ V  +          PSS      P + +V  +     + +  + CK  N                DL++P Q  LW+ +PRP  S  Y+ FT F M LNE+  +    LPP+DSRKRPDIR LE G ID+A+  K+RLE KQRQ RK+ K +    + Q LWF+  +++Y+   EW + G Y++R++  C DIF
Sbjct:    8 SLWSILKQCIGKELSKITMPVVFNEPLSFLQRLTEYMEYSYLLDRASQTSDPIERLQYVSAFAVSAISSNWERLGKPFNPLLGETYELDR-SELGFRLISEQVSHHPPISAFHIDS-PLYKFHGQIYPKLKFWGKSVDIHPKGYVTLELKKFNEVYTWQNVNCCVHNIIVGKLWVEHSGPMEIINHQTKHRAVLNFKQGGWF--GKDL--HKVEGYIYDPDKKKLKAIWGNWLMGLFSVNAGTY--------------DAHVAAM----------PSSP-----PHTPKVNGAGGDAEDASDELPCKSFN--------------SFDLNIPGQITLWQATPRPEDSAKYFSFTLFAMTLNEMMPEMNITLPPTDSRKRPDIRYLEEGKIDEAADAKNRLEEKQRQARKERKKQ--KGDWQPLWFETVKNQYTGKEEWAYKGDYWERDFSKCGDIF 411          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A267D9Z6 (Oxysterol-binding protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023375g1 PE=3 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.669e-102
Identity = 192/489 (39.26%), Postives = 284/489 (58.08%), Query Frame = 3
Query:  192 EKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNE-VPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNI-PEWVFNGKYFQRNWEICPDIF 1649
            E W QP          R  LP  M  + E+ ++W  +K+  GK+L++  MP++ NEP+SFLQR+ EY+EYS+LLF+A   +DP+ RLELIT F +S  SS + R GKPFNPL GETFEL+R ++R +  V EQVSHHPP SAF+ EA +  + F G++ PKL F GKS+EI P+G + +      EVYTW+NV   I+N+++GK+ + H GE +I+C     ++ LKW S     IG D  R++L  ++ +   +KVK +YG+W + L+S+  D WK   +    R  +++ S+  V S  G  R+    SF +  P   E   +S    +   P +C+       S AS+       DL +P Q  LW+ +PRP  SR Y+ FT FT+ LN+    +  + LP +D+R+RPD+R LE G++  A  EKSRLE KQRQ  ++            +WF    + ++    +W+F G Y+ R+W  CPDI+
Sbjct:    8 EAWNQP-------LLARSRLPVEMRPR-EDFSVWEFLKNCVGKELTRIAMPVHFNEPLSFLQRVCEYLEYSHLLFEAERCDDPVQRLELITAFAVSGASSNWARLGKPFNPLQGETFELDRSQDRCFRAVCEQVSHHPPTSAFHAEATDGSWIFHGAVTPKLSFLGKSVEINPRGTVTLEFPKRLEVYTWQNVLCKIHNIIVGKLWVEHYGELSIRCHGNGYRSELKWNSHS--LIGTD-QRHKLHGYIVDPAGKKVKAMYGKWMDALYSLPMDTWKRHKKGGSGRKRISELSIGAVGSGDGRPRW---KSFSVELPMQQEQSTNSEPTSSTAGPDNCEDREGDEESGASTL-----ADLSIPGQALLWRRAPRPADSRRYFSFTRFTLALNDNSDAELLARLPGTDTRRRPDVRALELGDLALAQAEKSRLEEKQRQALRR-------NSSGGVWFRPGRNRHTGWEADWMFTGDYWARDWAGCPDIY 470          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A1I8GSY8 (Oxysterol-binding protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 9.446e-102
Identity = 184/461 (39.91%), Postives = 275/461 (59.65%), Query Frame = 3
Query:  276 EESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNE-VPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNI-PEWVFNGKYFQRNWEICPDIF 1649
            E+ ++W  +K+  GK+L++  MP++ NEP+SFLQR+ EY+EYS+LLF+A   +DP+ RLELIT F +S  SS + R GKPFNPL GETFEL+R ++R +  V EQVSHHPP SAF+ EA +  + F G++ PKL F GKS+EI P+G + +      EVYTW+NV   I+N+++GK+ + H GE +I+C     ++ LKW S     IG D  R++L  ++ +   +KVK +YG+W + L+S+  D WK   +    R  +++ S+  V S  G  R+    SF +  P   E   +S    +   P +C+       S AS+       DL +P Q  LW+ +PRP  SR Y+ FT FT+ LN+    +  + LP +D+R+RPD+R LE G++  A  EKSRLE KQRQ  ++            +WF    + ++    +W+F G Y+ R+W  CPDI+
Sbjct:    5 EDFSVWEFLKNCVGKELTRIAMPVHFNEPLSFLQRVCEYLEYSHLLFEAERCDDPVQRLELITAFAVSGASSNWARLGKPFNPLQGETFELDRSQDRCFRAVCEQVSHHPPTSAFHAEATDGSWIFHGAVTPKLSFLGKSVEINPRGTVTLEFPKRLEVYTWQNVLCKIHNIIVGKLWVEHYGELSIRCHGNGYRSELKWNSHSL--IGTD-QRHKLHGYIVDPAGKKVKAMYGKWMDALYSLPMDTWKRHKKGGSGRKRISELSIGAVGSGDGRPRW---KSFSVELPMQQEQSTNSEPTSSTAGPDNCEDREGDEESGASTL-----ADLSIPGQALLWRRAPRPADSRRYFSFTRFTLALNDNSDAELLARLPGTDTRRRPDVRALELGDLALAQAEKSRLEEKQRQALRR-------NSSGGVWFRPGRNRHTGWEADWMFTGDYWARDWAGCPDIY 447          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A023GKQ0 (Oxysterol-binding protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 3.484e-101
Identity = 194/474 (40.93%), Postives = 276/474 (58.23%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTP---LTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNH-NCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  K + S LWS++K   GK+LSK TMP+  NEP+SFLQRISE MEYS LL QA    DP++R+EL+T F +S +SS  +R  KPFNPLLGET+EL R ++ G+  V EQVSHHPP+SAF+ E+  +F+  GS+YPKL+FWGKS+EI P+G+L + LL   E YTW NV   I+N+++GK+     G   I C  +   + L +K  GWF        +R+E  +Y+K   +++ +YG+W + L +    +++   +   +R P   L  S      S   +    P   +  +   +  +   S G+     SP  C  ++ G    + S        L +P+   LW+ +PRP ++  YY+FT F M LNE+       LPP+D R RPD+RLLE G++D A+ EK+RLE KQR+ RK  K  K   E   LWF   +  +S+  EW F GKY+ R++  CPDIF
Sbjct:   20 RTRLPVPMFSKNDFS-LWSILKQCIGKELSKITMPVVFNEPLSFLQRISENMEYSELLVQADEATDPVDRIELVTAFAVSALSSNLERLSKPFNPLLGETYELVR-DDVGFRMVCEQVSHHPPVSAFHAESS-HFKVHGSVYPKLKFWGKSIEIKPEGHLSVELLSHGETYTWTNVNCCIHNIIVGKLWFEQYGLMEIVCQKSGLTSALTFKQAGWFYK----DLHRIEGFIYDKLKSRLRFLYGKWTDYLKAAPVAEYEEYMQTHNFRAPPDHLPPSGTATSASAGPSPAHTPKRMYAKLNSLTRSLTGGSQGDMPGPKSPEPC-DLDDGEIPKSDST-----YSLDIPNSRLLWRATPRPEYAAQYYNFTLFAMALNEMEEGMNKTLPPTDCRLRPDMRLLEAGDLDGAAAEKNRLEEKQREARKHRKKHKDVWE--PLWFQHVKGAHSHSDEWQFTGKYWDRDFSSCPDIF 478          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbpl2b (oxysterol-binding protein-related protein 2 [Source:NCBI gene;Acc:103040272])

HSP 1 Score: 296.59 bits (758), Expect = 4.758e-93
Identity = 188/473 (39.75%), Postives = 272/473 (57.51%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWK--LRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  +   S +WS++K   G +LSK TMPI  NEP+SFLQRI+EYME++ L+ +A   +D I+R++ +  F +S V+S + R+GKPFNPLLGET+EL R E++G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K  VIYG+W E ++SV    ++   +N+KK      TD+                       +P   EV ++   +       D  ++              +E    +P    LW+VSPRPP+S   Y+FT FT+ LNE+       L P+D R RPDIR +ENG++D+AS+EK RLE KQR  RK+      S+E    WF+L  + Y+   +W++ G YF R +  CPDI+
Sbjct:  106 RSGLPAPMFSRNNFS-VWSILKKCIGLELSKITMPIVFNEPLSFLQRITEYMEHTYLIHKACTLSDSIDRMQAVAAFAVSAVASQWDRTGKPFNPLLGETYELTR-EDQGFRLISEQVSHHPPISAFHAEGLSQDFLFHGSIYPKLKFWGKSVEAEPKGTITLELLKHKEAYTWSNPFCCVHNVIVGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRCVIYGKWTECMWSVDPQVYESHRKNDKK----GTTDTKK--------------------QKPEEAEVAENEDAD-------DMPEV--------------QETVAVIPGSTLLWRVSPRPPNSAEMYNFTNFTITLNELEPGMEGVLAPTDCRLRPDIRAMENGDMDEASREKERLEEKQRAARKERAKD--SEEWSTRWFELATNPYTGSQDWLYTGGYFDRKYTDCPDIY 525          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbpl2b (oxysterol-binding protein-related protein 2 [Source:NCBI gene;Acc:103040272])

HSP 1 Score: 296.975 bits (759), Expect = 5.271e-93
Identity = 187/471 (39.70%), Postives = 270/471 (57.32%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  +   S +WS++K   G +LSK TMPI  NEP+SFLQRI+EYME++ L+ +A   +D I+R++ +  F +S V+S + R+GKPFNPLLGET+EL R E++G+  +SEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  PKG + + LL   E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K  VIYG+W E ++SV  D     + +K  +   TD+                       +P   EV ++   +       D  ++              +E    +P    LW+VSPRPP+S   Y+FT FT+ LNE+       L P+D R RPDIR +ENG++D+AS+EK RLE KQR  RK+      S+E    WF+L  + Y+   +W++ G YF R +  CPDI+
Sbjct:  123 RSGLPAPMFSRNNFS-VWSILKKCIGLELSKITMPIVFNEPLSFLQRITEYMEHTYLIHKACTLSDSIDRMQAVAAFAVSAVASQWDRTGKPFNPLLGETYELTR-EDQGFRLISEQVSHHPPISAFHAEGLSQDFLFHGSIYPKLKFWGKSVEAEPKGTITLELLKHKEAYTWSNPFCCVHNVIVGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRCVIYGKWTECMWSV--DPQVYESHRKNDKKGTTDTKK--------------------QKPEEAEVAENEDAD-------DMPEV--------------QETVAVIPGSTLLWRVSPRPPNSAEMYNFTNFTITLNELEPGMEGVLAPTDCRLRPDIRAMENGDMDEASREKERLEEKQRAARKERAKD--SEEWSTRWFELATNPYTGSQDWLYTGGYFDRKYTDCPDIY 542          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbpl2a (oxysterol-binding protein-related protein 2-like [Source:NCBI gene;Acc:103046556])

HSP 1 Score: 285.034 bits (728), Expect = 2.885e-89
Identity = 181/471 (38.43%), Postives = 256/471 (54.35%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  + + S +W  +K   G +LSK TMPI  NEP+SFLQRISEYME++ L+ +A   +D I R++++  F +S V+S + R+GKPFNPLLGETFEL R++E GY  +SEQVSHHPPISAFY E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K ++IYG+W E L+++     K+    K       DS       K G                + E+PD                               +E    +P    LW+++PRP HS   Y+FT F M LNE+       LPP+D R RPDIR +ENG++D AS EK RLE KQR  R++       ++    WF    + +    +W++ G YF R +   PDI+
Sbjct:   50 RTTLPAPMFSRNDFS-IWGFLKKCIGMELSKITMPIVFNEPLSFLQRISEYMEHTYLIHKACTLSDSIERMQVVAAFAVSAVASQWDRTGKPFNPLLGETFELTREDE-GYRLISEQVSHHPPISAFYAESLSQDFVFHGSIYPKLKFWGKSVEAEPKGIMTLELSKHKEAYTWTNPMCCVHNVILGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRRIIYGKWTECLYTIEP---KVYEANKKAEKKSGDSKKHKQEQKTGG-----------SADDADEMPD------------------------------VQETVTMIPGSTLLWRIAPRPAHSAQMYNFTSFAMTLNELSPGMEEVLPPTDCRLRPDIRAMENGDMDTASLEKERLEEKQRAARRERAKD--EEDWSTRWFHQGTNPHLGSSDWIYQGGYFDRKYSDLPDIY 468          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbpl2a (oxysterol-binding protein-related protein 2-like [Source:NCBI gene;Acc:103046556])

HSP 1 Score: 283.108 bits (723), Expect = 6.790e-89
Identity = 179/474 (37.76%), Postives = 258/474 (54.43%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKL--RNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +R  LP PM  + + S +W  +K   G +LSK TMPI  NEP+SFLQRISEYME++ L+ +A   +D I R++++  F +S V+S + R+GKPFNPLLGETFEL R++E GY  +SEQVSHHPPISAFY E+    F F GS+YPKL+FWGKS+E  PKG + + L    E YTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G++   +R+E ++ +K  +K ++IYG+W E L+++    ++   + EKK   +        G                      + E+PD                               +E    +P    LW+++PRP HS   Y+FT F M LNE+       LPP+D R RPDIR +ENG++D AS EK RLE KQR  R++       ++    WF    + +    +W++ G YF R +   PDI+
Sbjct:   26 YRTTLPAPMFSRNDFS-IWGFLKKCIGMELSKITMPIVFNEPLSFLQRISEYMEHTYLIHKACTLSDSIERMQVVAAFAVSAVASQWDRTGKPFNPLLGETFELTREDE-GYRLISEQVSHHPPISAFYAESLSQDFVFHGSIYPKLKFWGKSVEAEPKGIMTLELSKHKEAYTWTNPMCCVHNVILGKLWIEQYGTVEIVNHSTGDKCVLNFKPCGMF--GKEL--HRVEGYIQDKSKKKRRIIYGKWTECLYTIEPKVYEANKKAEKKSGDSKKHKQKTGGSAD------------------DADEMPD------------------------------VQETVTMIPGSTLLWRIAPRPAHSAQMYNFTSFAMTLNELSPGMEEVLPPTDCRLRPDIRAMENGDMDTASLEKERLEEKQRAARRERAKD--EEDWSTRWFHQGTNPHLGSSDWIYQGGYFDRKYSDLPDIY 443          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbpl1a (oxysterol-binding protein-related protein 1 [Source:NCBI gene;Acc:103034756])

HSP 1 Score: 284.263 bits (726), Expect = 3.352e-85
Identity = 176/474 (37.13%), Postives = 268/474 (56.54%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKL--RNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS+++ + G +LSK TMP+  NEP+SFLQR++EYME+++L+ QA+   D I R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E  +  F F GS+YPKL+FWGKS+E  PKG + + L   NE YTW N    ++N+++G++ I   G   +    T  +  L +K  G F  G++   +++E ++ +K  +KV ++YG+W E +++V    ++   +N+KK+  T    SS  G                     SS E  +S     +    I                          P    LWK+ PRP +S   Y FT F M LNE+  +  + +P +D R RPDIR +ENG+ID AS+EK RLE KQR  RK        ++ +A WF    + ++N P+W+F+  Y+ R++   PDI+
Sbjct:  419 HRTSLPAPMFSRNDFS-IWSILRKSIGMELSKITMPVIFNEPLSFLQRLTEYMEHTSLIHQANKSTDSIERMKCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGMQKDFVFHGSIYPKLKFWGKSVEAEPKGTITLELPKYNEAYTWTNPTCCVHNIIVGQLWIEQYGNVEVINHRTGERCCLNFKPCGLF--GKEL--HKVEGYILDKSKKKVCMLYGKWTECMYTVDPATFEAHKKNDKKV--TEEKKSSKQG---------------------SSAEAEESPQQGGDSLEVI--------------------------PGSQLLWKIDPRPANSAQMYSFTSFAMQLNELDEEIEAVIPKTDCRLRPDIRAMENGDIDQASQEKKRLEEKQRAARKNRSKS--DEDWKARWFHQGPNPHNNTPDWLFSTAYWSRDYSEVPDIY 835          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl1a (oxysterol binding protein-like 1A [Source:ZFIN;Acc:ZDB-GENE-050208-657])

HSP 1 Score: 266.929 bits (681), Expect = 1.437e-83
Identity = 175/473 (37.00%), Postives = 258/473 (54.55%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKL--RNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            R  LP PM  ++  S +WS ++   G +LSK TMP+  NEP+SFLQR+ EYME++ L+ +A+  +  I R++ +  F +S V+S ++R+GKPFNPLLGET+E+ R E+ G+  VSEQVSHHPPISAF+ E     F F GS+YPKL+FWGKS+E  P+G + + L    E YTW N    ++N+++GK+ I   G   I       KA L +++     I +  SR  L A   +   +KV VIYG+W EVL+SV    +++  +N+KK                KL  L    SS     Q  + E  D           I   ++               E    LP    LW+V PRP +S   Y+FT F + LNE+ ++    L P+D R RPD++ +E G+ID A +EK+RLE   +Q   + +  K  +E    WF    + +++  +W++ G YF R +E CP+IF
Sbjct:    1 RTSLPAPMFSRSNFS-IWSFLRRCIGMELSKITMPVIFNEPLSFLQRLCEYMEHTYLIHKANTSSSSIERMQCVAAFAVSAVASNWERTGKPFNPLLGETYEMVR-EDLGFRLVSEQVSHHPPISAFFAEGLNKDFVFHGSVYPKLKFWGKSVEAEPRGIITLELPRYGEAYTWTNPSCCVHNVIVGKLWIEQYGTVEITNHKRGFKASLSFRARN---ITKRKSRRPLSAFRIDS-KKKVSVIYGKWTEVLWSVDPGIYEVGKKNDKK-------------STEKLAKLVAAESSGPSGQQAEADEADD-----------IPTPEV--------------PETVTVLPGSKLLWRVHPRPANSTQMYNFTSFALTLNEMEKEMEGLLAPTDCRLRPDMKAMEQGDIDLAGEEKNRLEE--KQRAARKQRAKTEEEWHTRWFRQDLNPHTSTADWIYAGNYFDRRYENCPNIF 427          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 192.586 bits (488), Expect = 1.221e-52
Identity = 107/282 (37.94%), Postives = 162/282 (57.45%), Query Frame = 3
Query:  228 QYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRS-GKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGE--------NTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWR 1046
            Q   R  LP P    T    LW +++ N GKDLSK  MP+ LNEP++ LQR+ E MEYS+LL +A+  +DP  R+ L+ TF +S  +ST  R+ GKPFNP+LGET+E  R E+RG+ F++EQVSHHPPIS  + +++  F  W  +  K +FWGKS+EI P G + + LL   + Y W  V S I+N++ G+  I H GE        N  +C     KA   W S+           N+++  + +++   +  ++G+WNE ++  +      R+ + +WR
Sbjct:  515 QTGRRMHLPAPAAD-TSSIGLWDILRKNIGKDLSKVAMPVELNEPLNVLQRLCEEMEYSDLLDRAADTDDPAQRMVLVATFAVSTYASTISRAGGKPFNPVLGETYECIR-EDRGFRFIAEQVSHHPPISVCHCDSKK-FVLWQDVRLKNKFWGKSMEIIPVGTVNVKLLKYGDEYEWNKVTSCIHNIMGGQRWIEHYGEVIIKNKKSNVCQCKINFIKASY-WSSEA----------NQVQGTVMDQNGRVLHRLFGKWNEGMYCGAQ-----RSARCIWR 777          

HSP 2 Score: 61.2326 bits (147), Expect = 5.415e-10
Identity = 29/65 (44.62%), Postives = 39/65 (60.00%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLE 1484
            +W+    P    LYY FT F + LNE+       LPP+D+R RPD R LE GN++ A +EK R+E
Sbjct:  775 IWRPGSLPQDHELYYGFTRFAIELNELDPVLRPHLPPTDTRFRPDQRFLEEGNMESAQREKLRIE 839          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbp (oxysterol binding protein [Source:ZFIN;Acc:ZDB-GENE-090312-18])

HSP 1 Score: 169.474 bits (428), Expect = 4.823e-45
Identity = 90/236 (38.14%), Postives = 139/236 (58.90%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVL 992
            NLWS++K+  GKDLSK  MP+N NEP+S LQR++E +EY +LL +A+     + +L  +  F +S  S+T  R+GKPFNPLLGETFEL+R EE GY  + EQVSHHPP +A +V++   +R W  +    +F GK L I P G ++         YTW+ V + ++N+++G++ I   G+  I    T  K  LK+ +  +F    D  R ++   + +       ++ G W+E +
Sbjct:  347 NLWSIMKNCIGKDLSKIPMPVNFNEPLSMLQRLTEDLEYFDLLDKAAKCESSLEQLCYVAAFSVSSYSTTVYRTGKPFNPLLGETFELDRLEECGYRSICEQVSHHPPAAAHHVDSRRGWRLWQEITVSSKFRGKYLSIIPLGTIHCEFPSSGNHYTWKKVTTTVHNIIVGRLWIDQSGDIDIVNHHTGDKCQLKFIAYSYF--SRDIPR-KVSGVVMDAEGNAHYILSGTWDEKM 579          

HSP 2 Score: 68.5514 bits (166), Expect = 2.730e-12
Identity = 49/136 (36.03%), Postives = 70/136 (51.47%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCS------------QECQALWFDLKESEYSNIPEWVFNGKYFQ----RNWEICPDIF 1649
            LWK  P P +S   Y FT   + LNE        + P+DSR RPD RL+ENG  D+A+ EK RLE KQR  R++ + +  S            Q  + +WF+ KE  ++     V+ G Y++    + W+I  DIF
Sbjct:  610 LWKRYPLPENSDNMYYFTELALTLNETEEG----VAPTDSRLRPDQRLMENGKWDEANAEKQRLEEKQRLVRRRREAELASAAEPNGDAGRKHQSYRPMWFERKEDPFTREVSCVYRGGYWETKEKQEWKISQDIF 741          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 138.272 bits (347), Expect = 3.056e-35
Identity = 83/165 (50.30%), Postives = 114/165 (69.09%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSG-KPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHL 731
            R FLP P    T   +LW+++++N GKDL+K +MP+ LNEP++ LQR+ E +EYS LL QAS   DP  R+ L   F +S  + TY RSG KPFNP+LGET+E  R E++G+ FV+EQVSHHPPISA + E++  F  W  +  K +FWGKS+EI P G + ++L
Sbjct:  344 RSFLPAP-CPDTSGVSLWNILRNNIGKDLAKVSMPVELNEPLNTLQRLCEELEYSELLEQASDTEDPAQRMVLAAAFAVSAYAPTYYRSGNKPFNPVLGETYECIR-EDKGFRFVAEQVSHHPPISACHCESK-TFVLWQDVRWKNKFWGKSMEILPLGTVSLNL 505          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: OSBPL8 (oxysterol binding protein like 8 [Source:HGNC Symbol;Acc:HGNC:16396])

HSP 1 Score: 107.071 bits (266), Expect = 1.807e-24
Identity = 73/242 (30.17%), Postives = 128/242 (52.89%), Query Frame = 3
Query:  288 LWSLVKS-NTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFE---LNRKEERGYIFVSEQVSHHPPISAFYVE-AEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWN-EVLF 995
            +W+L+K    G DLSK  +P  + EP SFL ++S+Y  ++++L QA++E +  +R++ +  + +S      K   KP+NP++GETF    ++ +      ++SEQVSHHPPISAF++   +  F   G++  + +F+G SL     G   +  L+  E Y      +    +L G + +   G+  I C  TN KA +++K   +  +G   S N++   +     E +  + G W+ EVL 
Sbjct:  337 IWTLLKQLRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADILSQAAVEENAYDRIKQVVRWYLSGFYKKPKGLKKPYNPIIGETFRCMWIHPQTSSKTYYISEQVSHHPPISAFFISNRKDGFCISGNILARSKFYGNSLSAILDGEGKLTFLNRGEEYLMTMPYAHCKGILYGTMTLELGGKIIIDCEKTNYKAEIEFKLKPF--LGSSDSVNQVSGKI-KLGKEVLATLQGHWDREVLI 575          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH2 (Member of an oxysterol-binding protein family with seven members; in S. cerevisiae, family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane and at the nuclear envelope; regulated by sterol binding; OSH2 has a paralog, SWH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002177])

HSP 1 Score: 173.326 bits (438), Expect = 5.226e-46
Identity = 95/242 (39.26%), Postives = 141/242 (58.26%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLL----DINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS 998
            +LW+++KS  GKD+++ T+P+  NEP S LQR++E +EYS LL QA+   D   R   +  F  S  +ST KR  KPFNPLLGETFE +R +++ Y F +EQVSHHPPISA + E+ P + FWG  +   +F G+S  +   G  +I L     +  E+YTW+   + +  +LIG   + + GE  +   TT     L +K+ GW   G       +   +YNK  +KV ++ G WNE +F+
Sbjct:  897 SLWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDKQ-YRFFTEQVSHHPPISATWTES-PRWDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRSSGA----YEITGEVYNKKKQKVWILGGHWNEAIFA 1132          

HSP 2 Score: 53.1434 bits (126), Expect = 1.065e-7
Identity = 42/125 (33.60%), Postives = 62/125 (49.60%), Query Frame = 3
Query: 1287 FLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYF--QRNWEI--CPDIF 1649
             +WK + RP      ++ T F + LN         LPP+D+R RPD R +E+G  D+A  EK R+E KQR  R+K +      E    WF       +    W + GKY+  +R+ ++  C DIF
Sbjct: 1164 LIWKANDRPEEP---FNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRKREENNL--EYHPQWFVRDTHPITKAKYWRYTGKYWVKRRDHDLKDCGDIF 1283          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: SWH1 (Protein similar to mammalian oxysterol-binding protein; contains ankyrin repeats and FFAT motif; interacts with ER anchor Scs2p at the nucleus-vacuole junction; regulated by sterol binding; SWH1 has a paralog, OSH2, that arose from the whole genome duplication [Source:SGD;Acc:S000000081])

HSP 1 Score: 157.918 bits (398), Expect = 5.451e-41
Identity = 90/243 (37.04%), Postives = 139/243 (57.20%), Query Frame = 3
Query:  288 LWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYI-----HLLDI-NEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFS 998
            LWS++KS  G+DL+K T+P++ NEP S LQR+SE +EYS++L QA+   D   R+  +  F  S  +ST  R  KPFNPLLGETFE  R + + Y F +EQVSHHPPISA + E+ P + F+G       F G++  +   G  YI     H + +  E Y+W+   + +  +L+GK  + + G+  +   TT    +L +K+ GW   G       +   ++NK  +K+ V+ G WN+ ++ 
Sbjct:  800 LWSVLKSMVGQDLTKLTLPVSFNEPTSLLQRVSEDIEYSHILDQAATFEDSSLRMLYVAAFTASMYASTTNRVSKPFNPLLGETFEYARTDGQ-YRFFTEQVSHHPPISATWTES-PKWDFYGECNVDSSFNGRTFAVQHLGLWYITIRPDHNISVPEETYSWKKPNNTVIGILMGKPQVDNSGDVKVTNHTTGDYCMLHYKAHGWTSAGA----YEVRGEVFNKDDKKLWVLGGHWNDSIYG 1036          

HSP 2 Score: 66.2402 bits (160), Expect = 9.821e-12
Identity = 42/125 (33.60%), Postives = 67/125 (53.60%), Query Frame = 3
Query: 1287 FLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQR----NWEICPDIF 1649
             +WK + RP    + ++ T F + LN +P      L P+DSR RPD R +ENG  D A+ EK R+E   +Q   K + ++  +E +  WF  +E   +    W FNG+Y+ +    +++ C DIF
Sbjct: 1069 LIWKANERPS---VPFNLTSFALTLNALPPHLIPYLAPTDSRLRPDQRAMENGEYDKAAAEKHRVE--VKQRAAKKEREQKGEEYRPKWFVQEEHPVTKSLYWKFNGEYWNKRKNHDFKDCADIF 1188          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH3 (Member of an oxysterol-binding protein family; this family has seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane; regulated by sterol binding [Source:SGD;Acc:S000001115])

HSP 1 Score: 125.561 bits (314), Expect = 2.092e-30
Identity = 71/175 (40.57%), Postives = 105/175 (60.00%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSG---KPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGK 800
            +L S ++ N GKDLS   MP+  NEPIS LQ ISE  EY+ LL +A+   DPI     ++ F IS +S    ++    KPFNPLL ETFEL R E+ G+  +SE+VSH PP+ AF+ E   +   + ++ P  +FWGKS+E+  +G L +      E++ W    +++ NL+ G+
Sbjct:  642 SLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPIT---FVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIR-EDMGFRLISEKVSHRPPVFAFFAEHLDWECSY-TVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGE 811          

HSP 2 Score: 55.8398 bits (133), Expect = 1.323e-8
Identity = 29/65 (44.62%), Postives = 38/65 (58.46%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLE 1484
            +W+V     + +  Y FT FT  LNE+       LPP+DSR RPDIR  E GN+D A + K +LE
Sbjct:  881 IWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLE 945          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH6 (Member of an oxysterol-binding protein family; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; GFP-fusion protein localizes to the cell periphery; overexpression extends lifespan by promoting vacuolar fusion; OSH6 has a paralog, OSH7, that arose from the whole genome duplication [Source:SGD;Acc:S000001711])

HSP 1 Score: 97.0561 bits (240), Expect = 6.020e-22
Identity = 74/240 (30.83%), Postives = 117/240 (48.75%), Query Frame = 3
Query:  315 GKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETF----ELNRKEERGYIFVSEQVSHHPPISA-FYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINE--------VYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLF 995
            G DL++ T+P  + E  S L+R++  +++   L QA  E DP+ R   +  + ++      K   KP NP+LGE F    +L  K++  YI  SEQ SHHPP  A FY+  E   R  G + PK +F G S      G+  +  LDI +        V T  NV   +  +L GK+ I       IK  + N +A +++K+ G+     D     ++ +  N + E    I G+WN+V++
Sbjct:   61 GCDLTRITLPTFILEKKSMLERVTNQLQFPEFLLQAHSEKDPLKRFLYVMKWYLAGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAYYI--SEQTSHHPPECAYFYMIPESSIRVDGVVIPKSRFLGNSSAAMMDGSTVLQFLDIKDGNGKPEKYVLTQPNV--YVRGILFGKMRIELGDHMIIK--SPNFQADIEFKTKGYVFGTYDAIEGTVKDYDGNAYYE----ISGKWNDVMY 290          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH7 (Oxysterol-binding protein; part of family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; OSH7 has a paralog, OSH6, that arose from the whole genome duplication [Source:SGD;Acc:S000001043])

HSP 1 Score: 86.6557 bits (213), Expect = 1.203e-18
Identity = 66/238 (27.73%), Postives = 115/238 (48.32%), Query Frame = 3
Query:  315 GKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETF----ELNRKEERGYIFVSEQVSHHPPISA-FYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDIN------EVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLF 995
            G DLS+ T+P  + E  S L+RI+  +++ ++L +A    D + R   +  + ++      +   KP NP+LGE F    +L  K++  YI  +EQ SHHPP SA FY+  E   R  G + PK +F G S     +G   +  LDI       E YT          +L GK+ I   G++ +  +    +  +++K+ G+     D     +E  + +   ++   I G+WN++++
Sbjct:   61 GCDLSRITLPTFILEKKSMLERITNQLQFPDVLLEAHSNKDGLQRFVKVVAWYLAGWHIGPRAVKKPLNPILGEHFTAYWDLPNKQQAFYI--AEQTSHHPPESAYFYMIPESNIRVDGVVVPKSKFLGNSSAAMMEGLTVLQFLDIKDANGKPEKYTLSQPNVYARGILFGKMRI-ELGDHMV-IMGPKYQVDIEFKTKGFISGTYDA----IEGTIKDYDGKEYYQISGKWNDIMY 290          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO39767 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S940])

HSP 1 Score: 186.037 bits (471), Expect = 3.217e-53
Identity = 100/254 (39.37%), Postives = 156/254 (61.42%), Query Frame = 3
Query:  279 ESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVK-VIYGRWNEVLFSVSADDWKLRNEKK 1037
            E ++W+++K   GKDLS+ TMP+  NEP++FLQRI+EYMEYS LL  A+ ++DP  RL++                GKPFNPLLGET+EL R    G+  V+EQVSHHPPI+A   E++ +  F  ++ PKL+FWGK +E+ PKG + +     NEVYTW NV S ++N+++G++ I   G+  I  L++  +A + +K  GWF  G++   N++EA ++    +K +  + G W + +    ++    R + K
Sbjct:    6 EFSVWTVLKQCIGKDLSRITMPVIFNEPLTFLQRITEYMEYSELLHTAASQDDPTRRLQV----------------GKPFNPLLGETYELVRP---GFRLVAEQVSHHPPITALQCESDDFI-FHVTVQPKLKFWGKGVEVQPKGMVTLKFPKHNEVYTWNNVNSCVHNIIVGQLWIEQYGQIEISSLSSGDRATIHFKPAGWF--GKEL--NKVEATIHCAQDKKKRYTLKGDWTDKITCYRSETHVTRKQSK 235          

HSP 2 Score: 103.99 bits (258), Expect = 3.638e-24
Identity = 59/121 (48.76%), Postives = 80/121 (66.12%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEV-PRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            LW  S RPPHS+  Y+FT F M LNE+ PRD  + LPP+DSR RPD R LENG++D A+ EK RLE KQR  R++ +     QE    WF  + + Y+   +W+++G Y+ R+W+ CPDIF
Sbjct:  261 LWTCSHRPPHSKEMYNFTSFAMQLNELLPRDKET-LPPTDSRLRPDCRALENGDLDRATAEKIRLEEKQRAARRERQKS--DQEWAPRWFKEEMNPYTGQMDWLYSGGYWDRDWQECPDIF 378          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO44125 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7RWH9])

HSP 1 Score: 172.555 bits (436), Expect = 6.524e-46
Identity = 91/233 (39.06%), Postives = 139/233 (59.66%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWN 983
            NLWS++K+  GK+L+K  MP+N NEP+S LQRI+E +EYS +L +A+     + ++  +  F +S  S+T  R+ KPFNPLLGETFE +R E+ G+  ++EQVSHHPP SAF+ E + +  FW       +F GK L+I P+G  ++  +     YTW  V + ++N+++GK+ I   GE  I   TTN    LK+ +  +F  G D  R ++   + +       VI G W+
Sbjct:  339 NLWSILKNCIGKELTKIPMPVNFNEPLSMLQRITEELEYSEVLDKAAACTSSLEQMCYVAAFTVSSYSTTSNRTNKPFNPLLGETFECDRSEDYGWRSLAEQVSHHPPASAFHAEHKDWI-FWQEFSATSKFRGKYLQIIPQGIAHLKFIKSGNHYTWRKVTTTVHNIIVGKLWIDQSGEMDIANHTTNENCHLKYDAYNYF--GRDTPR-KVTGVVTDSTKTVRYVISGTWD 567          

HSP 2 Score: 67.3958 bits (163), Expect = 9.727e-12
Identity = 46/132 (34.85%), Postives = 73/132 (55.30%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQAL--------WFDLKESEYSNIPEWVFNGKYFQ----RNWEICPDIF 1649
            LWK    PP +   Y  T F + LNE P D+   + P+DSR RPD RL+EN + ++A++EK R+E++QR  R+K + +        +        WF+    E +++P  V+ G Y++    ++W  CPDIF
Sbjct:  603 LWKRVLPPPENEKMYAMTSFAITLNE-PEDH---VAPTDSRFRPDQRLMENCHWEEANQEKLRIEDQQRTRRRKREQEAAEALSDGIFYEGYSPSWFEKIVDELTDMPMHVYKGGYWEAKEKKDWGSCPDIF 730          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO41441 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S4A2])

HSP 1 Score: 140.198 bits (352), Expect = 2.726e-36
Identity = 94/326 (28.83%), Postives = 160/326 (49.08%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKW----KSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCK 1205
            R  LP    + +  S L S +K+  GKD++K TMP++ NEP+SFLQR+SE +EY+++L +A +  + + +L  +  F  S  ++   R  KPFNPLLGETFE     + G+  ++EQVSHHPPISA + E+  ++ FW       +F G+  ++ P G+ ++        ++W+   + I+N+L+G + +  +G+  +   TT     + +    K    FK        +L+  + +   +   VI G W++ L  +  D     +   LW         T V     + + +  + F I     L  PD     +  T P DC+
Sbjct:   41 RTALPATRERSSIRS-LISFMKTVVGKDMTKVTMPVHFNEPVSFLQRLSEDLEYADILNRACVCKNNLVKLAHVAAFASSTYATVLSRFWKPFNPLLGETFEYI-DNDNGFALIAEQVSHHPPISALHAESS-HWVFWQEYKLDTKFRGQFFKVIPTGHCHLKFKTNGHHFSWKKPVTTIHNILVGSLYVDQEGDMVVTNHTTKETCTVHFMPVRKVQDNFK--------KLKGEVKDPEGKVRYVIEGSWDKSLECIPQDTGFNDDSIDLW---------TAVARPDDSYKMYAFTRFTI----QLNDPD-----YGVTCPTDCR 337          

HSP 2 Score: 58.9214 bits (141), Expect = 2.898e-9
Identity = 45/112 (40.18%), Postives = 60/112 (53.57%), Query Frame = 3
Query: 1290 LWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCS----QECQALWFDLKESEYSNIPEWVFNGKY 1613
            LW    RP  S   Y FT FT+ LN+     Y    P+D R RPDIR LE G ID ++ EK RLE KQR +R++  TK  +     + +  WF  KE  Y+   ++V+ G Y
Sbjct:  300 LWTAVARPDDSYKMYAFTRFTIQLNDPD---YGVTCPTDCRNRPDIRQLELGKIDSSAAEKHRLEEKQRASRRERDTKGEAWTPRYDKKDRWFVPKEDPYTRTFDYVYRGGY 408          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO35914 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7SK18])

HSP 1 Score: 116.701 bits (291), Expect = 1.808e-27
Identity = 79/228 (34.65%), Postives = 121/228 (53.07%), Query Frame = 3
Query:  252 PCPMTKKTEE------SNLWSLVKS-NTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERG--YIFVSEQVSHHPPISAFYVE-AEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWK-SDGWFKIGE 902
            P    + TEE      S LW+L+K    G DLS+ T+P  + EP SFL ++S++  ++++L +A+ E +P +R++ +  + +S      K   KP+NP++GE F    +  +G    FVSEQVSHHPP+SAFYV   +  F   G++  K +F+G S      G   + LL   E YT     +    +LIG + +   G  TI C  T  KA +++K    W K GE
Sbjct:  226 PGAAGEATEEIEDENKSILWALLKQVKPGMDLSRVTLPTFILEPRSFLDKLSDFYYHTDILSRAACEENPYSRMKEVIRWYLSGFYKKPKGLKKPYNPIIGEMFRCYWQHPQGSRTFFVSEQVSHHPPVSAFYVSNRQDGFVINGAILAKSKFYGNSSSAILDGAATLALLRFGEEYTMTMPYAHCKGILIGTLTMELGGTVTINCEKTGYKAEIEFKLKPFWKKSGE 453          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO28432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6H1])

HSP 1 Score: 83.1889 bits (204), Expect = 2.162e-19
Identity = 51/107 (47.66%), Postives = 71/107 (66.36%), Query Frame = 3
Query: 1332 YDFTYFTMILNEV-PRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            Y+FT F M LNE+ PRD  + LPP+DSR RPD R LENG++D A+ EK RLE KQR  R++ +     QE    WF  + + Y+   +W+++G Y+ R+W+ CPDIF
Sbjct:    2 YNFTSFAMQLNELLPRDKET-LPPTDSRLRPDCRALENGDLDRATAEKIRLEEKQRAARRERQKS--DQEWAPRWFKEEMNPYTGQMDWLYSGGYWDRDWQECPDIF 105          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbpl2a (oxysterol-binding protein-related protein 2 [Source:NCBI gene;Acc:101170760])

HSP 1 Score: 284.263 bits (726), Expect = 5.270e-89
Identity = 176/471 (37.37%), Postives = 267/471 (56.69%), Query Frame = 3
Query:  240 RKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            RK LP  M  ++  S +WS++K   G +LSK  MP+  NEP+SFLQRISEYME+++L+ +A   +D ++R++++  F +S V+S ++R+GKPFNPLLGET+EL R++E GY ++SEQVSHHPP+SAF+ ++ +  F F GS+YPKL+FWGKS+E  PKG + + LL   EVYTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G+D   +++E ++ +K  +K +VIYG+W E ++SV                                             P S +    + G+     P   K+ N      A      +E    +P    LW+++PRP HS   Y+FT F + LNE+       L P+D R RPDIR +ENG+++ AS EK RLE KQR  R++   ++ +   +  WF L  + ++   +W + G YF RN+  CP+I+
Sbjct:   48 RKTLPAQMISRSNFS-IWSILKKCIGMELSKIAMPVEFNEPLSFLQRISEYMEHTHLIHKACSLSDSVDRMQVVAAFAVSAVASQWERTGKPFNPLLGETYELIREDE-GYRWISEQVSHHPPVSAFHAQSLKQEFEFHGSIYPKLKFWGKSVEAEPKGTMVLDLLKHKEVYTWTNPMCCVHNIILGKLWIEQYGSVEIINHSTGDKCVLNFKPCGMF--GKDL--HKVEGYIQDKSKKKRRVIYGKWTECIYSVD--------------------------------------------PKSYDAYKRAAGD-----PKRLKQENSCEGEEADEMPDVQETVTVIPGSALLWRITPRPAHSAQIYNFTSFAVTLNELEPGMEKLLAPTDCRLRPDIRAMENGDMELASAEKERLEEKQRAARRERSEEEETWSTR--WFQLGVNPHTGAEDWFYTGGYFDRNYSDCPNIY 461          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbpl1a (oxysterol-binding protein-related protein 1 [Source:NCBI gene;Acc:101166541])

HSP 1 Score: 271.937 bits (694), Expect = 2.138e-80
Identity = 173/478 (36.19%), Postives = 264/478 (55.23%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSP-IDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQA-----LWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            HR  LP PM  + + S +WS++++  G +LSK TMP+  NEP+SFLQR++EYME++ L+ QA+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R E+ G+  +SEQVSHHPP+SAF+ E  +  F F GS+YPKL+FWGKS+E  PKG + + L   NE YTW N    ++N+++G++ I   G   +    T  K  L +K  G F  G++   +++E H+++K  +K+  +YG+W E L  V+   ++   +     +    SS  G                            SS    +  SP  D  ++ PGS                      LW+++PRP +S   Y FT F M LNE+  +    +P +D R RPDIR +ENGNID AS+EK RLE KQR  RK     +   + ++      WF   ++ ++   +W+F+G Y+ R +   PDI+
Sbjct:  463 HRMSLPAPMFSRNDFS-IWSILRNCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHQANASSDSVERMKCVAAFAVSAVASQWERTGKPFNPLLGETYELVR-EDLGFRLISEQVSHHPPVSAFHAEGLKQDFVFHGSIYPKLKFWGKSVEAEPKGTITLELPKYNEAYTWTNPTCCVHNIIVGQLWIEQYGNVEVINHRTGEKCCLNFKPCGLF--GKEL--HKVEGHIFDKSKKKLCALYGKWTECLHVVNTAAFEAHKKNDKKSSEDKKSSKAG----------------------------SSGDQEDVPSPAADTVEVIPGS--------------------QLLWRIAPRPTNSTQMYSFTCFAMQLNELTPEMEGVIPQTDCRLRPDIRAMENGNIDLASEEKKRLEEKQRAARKNRSKSEEDWKSRSPALGPRWFQQGQNPHTRSQDWLFSGGYWDRTYPNLPDIY 886          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbpl1a (oxysterol-binding protein-related protein 1 [Source:NCBI gene;Acc:101166541])

HSP 1 Score: 267.7 bits (683), Expect = 1.339e-78
Identity = 170/469 (36.25%), Postives = 261/469 (55.65%), Query Frame = 3
Query:  249 LPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSP-IDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            LP PM  + + S +WS++++  G +LSK TMP+  NEP+SFLQR++EYME++ L+ QA+  +D + R++ +  F +S V+S ++R+GKPFNPLLGET+EL R  + G+  +SEQVSHHPP+SAF+ E  +  F F GS+YPKL+FWGKS+E  PKG + + L   NE YTW N    ++N+++G++ I   G   +    T  K  L +K  G F  G++   +++E H+++K  +K+  +YG+W E L  V+   ++   +     +    SS  G                            SS    +  SP  D  ++ PGS                      LW+++PRP +S   Y FT F M LNE+  +    +P +D R RPDIR +ENGNID AS+EK RLE KQR  RK        ++ ++ WF   ++ ++   +W+F+G Y+ R +   PDI+
Sbjct:  509 LPAPMFSRNDFS-IWSILRNCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHQANASSDSVERMKCVAAFAVSAVASQWERTGKPFNPLLGETYELVRW-DLGFRLISEQVSHHPPVSAFHAEGLKQDFVFHGSIYPKLKFWGKSVEAEPKGTITLELPKYNEAYTWTNPTCCVHNIIVGQLWIEQYGNVEVINHRTGEKCCLNFKPCGLF--GKEL--HKVEGHIFDKSKKKLCALYGKWTECLHVVNTAAFEAHKKNDKKSSEDKKSSKQG----------------------------SSGDQEDVPSPAADTVEVIPGS--------------------QLLWRIAPRPTNSTQMYSFTCFAMQLNELTPEMEGVIPQTDCRLRPDIRAMENGNIDLASEEKKRLEEKQRAARKNRSKS--EEDWKSRWFQQGQNPHTRSQDWLFSGGYWDRTYPNLPDIY 921          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbpl2a (oxysterol-binding protein-related protein 2 [Source:NCBI gene;Acc:101170760])

HSP 1 Score: 215.312 bits (547), Expect = 4.402e-63
Identity = 117/254 (46.06%), Postives = 177/254 (69.69%), Query Frame = 3
Query:  243 KFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV 1001
            K LP  M  ++  S +WS++K   G +LSK  MP+  NEP+SFLQRISEYME+++L+ +A   +D ++R++++  F +S V+S ++R+GKPFNPLLGET+EL R++E GY ++SEQVSHHPP+SAF+ ++ +  F F GS+YPKL+FWGKS+E  PKG + + LL   EVYTW N    ++N+++GK+ I   G   I   +T  K VL +K  G F  G+D   +++E ++ +K  +K +VIYG+W E ++SV
Sbjct:   27 KTLPAQMISRSNFS-IWSILKKCIGMELSKIAMPVEFNEPLSFLQRISEYMEHTHLIHKACSLSDSVDRMQVVAAFAVSAVASQWERTGKPFNPLLGETYELIREDE-GYRWISEQVSHHPPVSAFHAQSLKQEFEFHGSIYPKLKFWGKSVEAEPKGTMVLDLLKHKEVYTWTNPMCCVHNIILGKLWIEQYGSVEIINHSTGDKCVLNFKPCGMF--GKDL--HKVEGYIQDKSKKKRRVIYGKWTECIYSV 274          

HSP 2 Score: 95.1301 bits (235), Expect = 2.017e-20
Identity = 50/126 (39.68%), Postives = 76/126 (60.32%), Query Frame = 3
Query: 1272 LPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +P    LW+++PRP HS   Y+FT F + LNE+       L P+D R RPDIR +ENG+++ AS EK RLE KQR  R++   ++ +   +  WF L  + ++   +W + G YF RN+  CP+I+
Sbjct:  315 IPGSALLWRITPRPAHSAQIYNFTSFAVTLNELEPGMEKLLAPTDCRLRPDIRAMENGDMELASAEKERLEEKQRAARRERSEEEETWSTR--WFQLGVNPHTGAEDWFYTGGYFDRNYSDCPNIY 438          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbpl2b (oxysterol-binding protein-related protein 2 [Source:NCBI gene;Acc:101158354])

HSP 1 Score: 209.149 bits (531), Expect = 1.947e-60
Identity = 117/256 (45.70%), Postives = 170/256 (66.41%), Query Frame = 3
Query:  237 HRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEA-EPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSV 1001
            HR  LP PM  +   S +WS++K   G +LSK TMPI  NEP+SFLQR++EYME++ L+ +A   +D I R++ +  F +S V+S + R+GKPFNPLLGET+EL R EE+G+  +SEQVSHHPP+SAF+ E     F F GS+YPKL+FWGKS+E  PKG + + ++   E YTW N    ++N+++GK+ I   G   I    T  K VL +K  G F  G++   +++E ++ +K+ +K  VIYG+W E ++SV
Sbjct:   53 HRTSLPAPMFSRNTVS-VWSILKKCIGLELSKITMPIAFNEPLSFLQRMTEYMEHTYLINKACSLSDSIERMQAVAAFAVSAVASQWDRTGKPFNPLLGETYELVR-EEQGFRLISEQVSHHPPVSAFHAEGLAGDFAFHGSIYPKLKFWGKSVEAEPKGTITLEIIKHKEAYTWSNPYCCVHNIILGKLWIEQYGNVEIVNHRTGDKCVLNFKPCGMF--GKEL--HKVEGYIQDKNKKKHCVIYGKWTECMWSV 302          

HSP 2 Score: 105.145 bits (261), Expect = 1.335e-23
Identity = 56/126 (44.44%), Postives = 77/126 (61.11%), Query Frame = 3
Query: 1272 LPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            +P    LW++  RP HS   Y+FT F M LNE+     + L P+D R RPDIR +ENGNID+ASKEK RLE KQR  RK+       ++    WF L  + ++   +W++NG YF RN++  PDI+
Sbjct:  347 VPGSTLLWRIDSRPAHSSRMYNFTTFAMSLNELEPGMEAMLAPTDCRFRPDIRAMENGNIDEASKEKERLEEKQRAARKERAKN--DEDWSTRWFHLSTNPHTGNQDWIYNGDYFNRNYKDLPDIY 470          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000016876.1 (SMESG000016876.1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 493/494 (99.80%), Postives = 494/494 (100.00%), Query Frame = 3
Query:  168 MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENKQRQTRK+FKTKKCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF
Sbjct:    1 MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENKQRQTRKQFKTKKCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 494          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000016876.1 (SMESG000016876.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 462/463 (99.78%), Postives = 463/463 (100.00%), Query Frame = 3
Query:  261 MTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            MTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENKQRQTRK+FKTKKCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF
Sbjct:    1 MTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENKQRQTRKQFKTKKCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 463          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000016876.1 (SMESG000016876.1)

HSP 1 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 428/430 (99.53%), Postives = 429/430 (99.77%), Query Frame = 3
Query:  168 MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDD 1457
            MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNI +
Sbjct:    1 MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINPGSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIGN 430          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000065901.1 (SMESG000065901.1)

HSP 1 Score: 315.079 bits (806), Expect = 4.894e-101
Identity = 195/499 (39.08%), Postives = 273/499 (54.71%), Query Frame = 3
Query:  231 YCHRKFLPCPMTKKTEESNLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKV-KVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSSVTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNC--------TSPIDCKKINPGXXXXXXXXXXXEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLE-----------------NXXXXXXXXXXXXXCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF 1649
            Y +R  LP PM  K   S +W+ +K   GK+LSK TMPI  NEPISFLQR++EY+EYS LL QA  E DPI R+E I  F +S  +S + R GKPFNPLLGET+EL+R     + +VSEQ+ HHPP+SAF+VE+ P F+F+G+++PKL FWGKS+ I PKGN+ + LL  NEVYTW+NV   ++N++IGK+ I H G   I   + N  A L + S GWF  G++  R   + +   + S  V + +YG+W E LFSVS + W              DSS               +S  H+     +E  +    N+N          +P D K +N                      Q  +WK  PRP +S ++Y+FT FTM LN++   +  ELPP+DSR R D+R +E G +D+A+  K+ LE                 N  + +     T   +Q+   +WF  K + Y+N  EW F G+Y+ R+W +CPDIF
Sbjct:   25 YTYRTGLPKPMPSKLNFS-VWTFLKQCIGKELSKITMPIVFNEPISFLQRLTEYIEYSELLDQAVAEIDPIKRMEKICAFAVSGGASNWGRIGKPFNPLLGETYELHRP---NFKYVSEQICHHPPVSAFHVES-PTFKFYGAIHPKLNFWGKSVVITPKGNITLELLPWNEVYTWQNVVCTVHNVIIGKIWIEHSGPMRIINHSNNCIADLTFHSVGWF--GKNMHRVDGDIYYGQRKSRHVERKVYGKWTEALFSVSPEVWN------------DDSS---------------TSKRHVNSTDQIENDEKGDNNNNDIDDPLPQDNTPCDMKLLN----------------------QRLIWKAKPRPDNSAIFYNFTSFTMGLNQITDSFSRELPPTDSRFRQDMRYMEEGLLDEAANAKNYLEEKQRAKRVALKSSNSKKNMNKSSSSHEITDIRNQKEGPVWFAEKLNSYTNKMEWQFTGEYWNRDWSVCPDIF 467          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000008795.1 (SMESG000008795.1)

HSP 1 Score: 162.155 bits (409), Expect = 8.323e-42
Identity = 89/236 (37.71%), Postives = 138/236 (58.47%), Query Frame = 3
Query:  285 NLWSLVKSNTGKDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITTFVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISAFYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENVPSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRNRLEAHLYNKHSEKVKVIYGRWNEVL 992
            NLWS+VK+  GKDLSK  MP+N +EPIS LQR++E  EYS++L +A+   +PI ++  +  F +S  ++T  R  KPFNPLLGET+EL+R ++ G+   +EQ+ HHPP  A + E+  +   W       +F GK ++I+P G  ++        Y WE +P  I+N+++G+V I + GE  I  LTT  K  L +K    F    + +  R+   + +K +    V+ G W+E L
Sbjct:  433 NLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWV-CWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMF---SNDTPKRVTGAITDKLNNVCCVLNGTWDEKL 664          

HSP 2 Score: 76.6406 bits (187), Expect = 2.712e-14
Identity = 48/129 (37.21%), Postives = 72/129 (55.81%), Query Frame = 3
Query: 1287 FLWKVSPRPPHSRLYYDFTYFTMILNEVPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENXXXXXXXXXXXXXCSQEC----QALWFDLKESEYSNIPEWVFNGKYFQ----RNWEICPDIF 1649
             LW+  P PP+   YY F+ F + LNE+  D    + P+DSR RPD +L+E G  D+A+KEK+RLE +QR  R +      ++E     + LWFD      +    + FNGKY++    ++W +C  IF
Sbjct:  690 LLWQRYPLPPNFDKYYYFSSFAITLNEIEED----IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 814          
The following BLAST results are available for this feature:
BLAST of Oxysterol-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OSBPL21.569e-9339.19oxysterol binding protein like 2 [Source:HGNC Symb... [more]
OSBPL21.839e-9339.19oxysterol binding protein like 2 [Source:HGNC Symb... [more]
OSBPL22.079e-9339.19oxysterol binding protein like 2 [Source:HGNC Symb... [more]
OSBPL22.079e-9339.19oxysterol binding protein like 2 [Source:HGNC Symb... [more]
OSBPL22.079e-9339.19oxysterol binding protein like 2 [Source:HGNC Symb... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
obr-22.023e-5228.80Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-21.639e-5129.41Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-17.973e-3032.41Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-14.791e-2932.41Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-16.540e-2932.41Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG38601.168e-8536.34gene:FBgn0034951 transcript:FBtr0343288[more]
CG38602.396e-8536.34gene:FBgn0034951 transcript:FBtr0072201[more]
Osbp5.170e-4136.17gene:FBgn0020626 transcript:FBtr0084801[more]
CG426681.473e-2430.65gene:FBgn0261550 transcript:FBtr0302666[more]
CG426681.713e-2431.03gene:FBgn0261550 transcript:FBtr0306633[more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbpl2b1.082e-9139.28oxysterol binding protein-like 2b [Source:ZFIN;Acc... [more]
osbpl2a5.704e-9138.64oxysterol binding protein-like 2a [Source:ZFIN;Acc... [more]
osbpl2a6.113e-9138.64oxysterol binding protein-like 2a [Source:ZFIN;Acc... [more]
osbpl2b7.931e-9139.07oxysterol binding protein-like 2b [Source:ZFIN;Acc... [more]
CABZ01084566.18.968e-5944.14oxysterol-binding protein-related protein 1-like [... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndufb103.619e-8637.32NADH:ubiquinone oxidoreductase subunit B10 [Source... [more]
ndufb102.209e-8536.09NADH:ubiquinone oxidoreductase subunit B10 [Source... [more]
ndufb106.694e-8436.84NADH:ubiquinone oxidoreductase subunit B10 [Source... [more]
ndufb105.669e-8337.05NADH:ubiquinone oxidoreductase subunit B10 [Source... [more]
ndufb101.020e-8236.73NADH:ubiquinone oxidoreductase subunit B10 [Source... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osbpl21.334e-9538.84oxysterol binding protein-like 2 [Source:MGI Symbo... [more]
Osbpl1a7.741e-9239.03oxysterol binding protein-like 1A [Source:MGI Symb... [more]
Osbpl1a7.741e-9239.03oxysterol binding protein-like 1A [Source:MGI Symb... [more]
Osbpl1a7.741e-9239.03oxysterol binding protein-like 1A [Source:MGI Symb... [more]
Osbpl1a7.741e-9239.03oxysterol binding protein-like 1A [Source:MGI Symb... [more]
back to top
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BX94|OSBL2_MOUSE9.332e-9538.84Oxysterol-binding protein-related protein 2 OS=Mus... [more]
sp|Q9H1P3|OSBL2_HUMAN9.983e-9339.19Oxysterol-binding protein-related protein 2 OS=Hom... [more]
sp|Q8K4M9|OSBL1_RAT2.754e-8738.74Oxysterol-binding protein-related protein 1 OS=Rat... [more]
sp|Q91XL9|OSBL1_MOUSE5.094e-8739.16Oxysterol-binding protein-related protein 1 OS=Mus... [more]
sp|Q9BXW6|OSBL1_HUMAN1.574e-8538.56Oxysterol-binding protein-related protein 1 OS=Hom... [more]
back to top
BLAST of Oxysterol-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PSS73.139e-10840.88Oxysterol-binding protein OS=Mizuhopecten yessoens... [more]
V4AYH16.796e-10742.42Oxysterol-binding protein OS=Lottia gigantea OX=22... [more]
A0A267D9Z61.669e-10239.26Oxysterol-binding protein OS=Macrostomum lignano O... [more]
A0A1I8GSY89.446e-10239.91Oxysterol-binding protein OS=Macrostomum lignano O... [more]
A0A023GKQ03.484e-10140.93Oxysterol-binding protein OS=Amblyomma triste OX=2... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbpl2b4.758e-9339.75oxysterol-binding protein-related protein 2 [Sourc... [more]
osbpl2b5.271e-9339.70oxysterol-binding protein-related protein 2 [Sourc... [more]
osbpl2a2.885e-8938.43oxysterol-binding protein-related protein 2-like [... [more]
osbpl2a6.790e-8937.76oxysterol-binding protein-related protein 2-like [... [more]
osbpl1a3.352e-8537.13oxysterol-binding protein-related protein 1 [Sourc... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbpl1a1.437e-8337.00oxysterol binding protein-like 1A [Source:ZFIN;Acc... [more]
osbpl61.221e-5237.94oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
osbp4.823e-4538.14oxysterol binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
osbpl63.056e-3550.30oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
OSBPL81.807e-2430.17oxysterol binding protein like 8 [Source:HGNC Symb... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
OSH25.226e-4639.26Member of an oxysterol-binding protein family with... [more]
SWH15.451e-4137.04Protein similar to mammalian oxysterol-binding pro... [more]
OSH32.092e-3040.57Member of an oxysterol-binding protein family; thi... [more]
OSH66.020e-2230.83Member of an oxysterol-binding protein family; fam... [more]
OSH71.203e-1827.73Oxysterol-binding protein; part of family with sev... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO397673.217e-5339.37Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO441256.524e-4639.06Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO414412.726e-3628.83Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO359141.808e-2734.65Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO284322.162e-1947.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbpl2a5.270e-8937.37oxysterol-binding protein-related protein 2 [Sourc... [more]
osbpl1a2.138e-8036.19oxysterol-binding protein-related protein 1 [Sourc... [more]
osbpl1a1.339e-7836.25oxysterol-binding protein-related protein 1 [Sourc... [more]
osbpl2a4.402e-6346.06oxysterol-binding protein-related protein 2 [Sourc... [more]
osbpl2b1.947e-6045.70oxysterol-binding protein-related protein 2 [Sourc... [more]
back to top
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016876.10.000e+099.80SMESG000016876.1[more]
SMESG000016876.10.000e+099.78SMESG000016876.1[more]
SMESG000016876.10.000e+099.53SMESG000016876.1[more]
SMESG000065901.14.894e-10139.08SMESG000065901.1[more]
SMESG000008795.18.323e-4237.71SMESG000008795.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018203 ID=SMED30018203|Name=Oxysterol-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1814bp
CTTCCGATCTATTGTTAAGTAGTGGATATTGTATTTCAGTATCAATCAGC
AAACCAATGAGCTGTGGCAGATTATCAATACCTTAGCAATTTATTTTCTT
TTGTAATCGAAATTGAATTCTTTAAAATCTCTTACGAATTTGCAACATTG
GATTATTTAGTAAAAAAATGGATATTTCTAACTCGAATATTGAAAAATGG
TTACAACCGGATTATCCGAACAGTGATCAATATTGCCATAGAAAGTTTTT
ACCTTGCCCAATGACAAAAAAAACTGAAGAATCAAATCTTTGGAGCTTAG
TTAAGTCAAATACTGGAAAGGATTTGTCTAAAACAACCATGCCAATCAAC
CTAAATGAACCAATCAGCTTTCTTCAAAGGATATCAGAATATATGGAATA
TTCCAATTTACTGTTCCAAGCTTCCTTAGAAAACGATCCAATCAACAGAC
TAGAACTCATTACGACATTTGTAATTTCTGACGTGTCCTCAACTTACAAG
CGATCTGGGAAACCATTTAATCCACTGTTGGGAGAAACATTCGAATTAAA
CAGAAAAGAAGAAAGGGGTTACATATTTGTAAGTGAACAAGTTAGTCACC
ATCCTCCAATTAGTGCTTTCTATGTTGAAGCAGAGCCATATTTTCGATTC
TGGGGATCTCTGTATCCAAAGCTTCAATTTTGGGGAAAGTCATTGGAAAT
CTATCCAAAAGGAAACTTATACATTCATTTGTTGGATATAAATGAAGTTT
ACACATGGGAAAATGTTCCATCTGTGATAAATAATCTTTTGATTGGAAAA
GTGAATATATGCCATCAAGGAGAAAATACCATAAAATGTTTAACTACAAA
TACGAAAGCAGTTTTGAAATGGAAGTCTGATGGTTGGTTCAAAATCGGTG
AAGATTGTAGTAGAAATAGGTTGGAAGCTCATCTTTACAATAAACATTCA
GAAAAAGTTAAGGTCATTTATGGACGATGGAATGAGGTTCTATTTTCAGT
GTCAGCAGACGACTGGAAATTAAGAAATGAAAAAAAGTTATGGAGAACCC
CATTGACTGATTCTTCGGTGACTGGTGTTGTATCGAAACTCGGAAATCTG
AGATTTTTCCCGAGTTCATCATTCCACATAATGCAACCGTCGTCTCTAGA
GGTTCCCGATTCCAGCCCCGGTAATCACAATTGCACATCTCCAATAGATT
GCAAGAAAATAAACCCGGGCAGTAGTAGTTGTGCCTCTTCACCAACAAGT
TCTGAGGAGATTGATCTTCATCTACCTCATCAAAATTTCCTATGGAAAGT
ATCCCCTCGTCCCCCTCATAGCAGACTATATTATGACTTTACTTATTTTA
CAATGATTCTAAATGAGGTTCCTAGAGATTACTATAGCGAGTTGCCCCCC
AGTGATAGCAGGAAACGGCCCGATATTCGTTTATTAGAAAATGGCAACAT
AGATGATGCTTCAAAAGAAAAAAGCCGATTGGAAAATAAACAAAGACAAA
CTAGAAAGAAATTCAAGACGAAAAAATGTTCCCAAGAATGTCAAGCTTTG
TGGTTTGATCTCAAAGAATCGGAATACAGCAATATTCCCGAATGGGTTTT
TAACGGTAAATATTTTCAGAGAAATTGGGAGATTTGCCCAGATATCTTTT
GACAAGGAGCAATCTCGATTTCCATTTAGATGATGTAGTTTGTAGATAGT
ATCCAAATGTTAGGGAATAAATAATTATTTGTAATGATTGTTGATGAAGA
TTTTATCAGTGGTCATCCTTTATTGCTATTGTTTGGTTCTGAATGTCGTG
TTGCTTTGCCCTAG
back to top

protein sequence of SMED30018203-orf-1

>SMED30018203-orf-1 ID=SMED30018203-orf-1|Name=SMED30018203-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MDISNSNIEKWLQPDYPNSDQYCHRKFLPCPMTKKTEESNLWSLVKSNTG
KDLSKTTMPINLNEPISFLQRISEYMEYSNLLFQASLENDPINRLELITT
FVISDVSSTYKRSGKPFNPLLGETFELNRKEERGYIFVSEQVSHHPPISA
FYVEAEPYFRFWGSLYPKLQFWGKSLEIYPKGNLYIHLLDINEVYTWENV
PSVINNLLIGKVNICHQGENTIKCLTTNTKAVLKWKSDGWFKIGEDCSRN
RLEAHLYNKHSEKVKVIYGRWNEVLFSVSADDWKLRNEKKLWRTPLTDSS
VTGVVSKLGNLRFFPSSSFHIMQPSSLEVPDSSPGNHNCTSPIDCKKINP
GSSSCASSPTSSEEIDLHLPHQNFLWKVSPRPPHSRLYYDFTYFTMILNE
VPRDYYSELPPSDSRKRPDIRLLENGNIDDASKEKSRLENKQRQTRKKFK
TKKCSQECQALWFDLKESEYSNIPEWVFNGKYFQRNWEICPDIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000648Oxysterol-bd
IPR018494Oxysterol-bd_CS
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006869lipid transport