SMED30018178

Overview
NameSMED30018178
Smed IDSMED30018178
Length (bp)1270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018178 (SMED30018178) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018178 (SMED30018178) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018178 (SMED30018178) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018178 (SMED30018178) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018178

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30018178h1SMcG0003199 dd_Smed_v4_16195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018178h1SMcG0003199 dd_Smed_v4_16195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018178 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014659:16748..19163 +6207
v31.004143:59729..62137 +6122
Homology
BLAST of SMED30018178 vs. Ensembl Human
Match: SYT15 (synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:17167])

HSP 1 Score: 54.299 bits (129), Expect = 2.429e-7
Identity = 69/289 (23.88%), Postives = 117/289 (40.48%), Query Frame = -3
Query:  165 PSEKSQHYFKSNRRRSVAMEVTHEVKSRVLSVKIF-------PQETIPDTYDIYLVNSKNTIQKSVRNHKTK--KFS----------NVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSR-IGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLS-SETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPS--GEKSKETIHWNLILSKPNENSIMLHNL 962
            P +KS+  F       +   V +E ++  L V +        P ET      +YL+  +    +S    KT   +F            + +R LK    ++    KH L      G + +PL+   N     D RRV  R +    +        ++ CL  +    +L V VLR KGL   E + I++ +  + L      +   +T      I+P ++E + F+ +  +L T  L   +V N   ++  QLGR+ +      + +E  HW+ +LSKP E     H L
Sbjct:  135 PEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQL-----LGQVLFPLK---NETLVGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHAL 415          
BLAST of SMED30018178 vs. Ensembl Human
Match: FO681492.2 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 54.299 bits (129), Expect = 2.471e-7
Identity = 69/289 (23.88%), Postives = 117/289 (40.48%), Query Frame = -3
Query:  165 PSEKSQHYFKSNRRRSVAMEVTHEVKSRVLSVKIF-------PQETIPDTYDIYLVNSKNTIQKSVRNHKTK--KFS----------NVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSR-IGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLS-SETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPS--GEKSKETIHWNLILSKPNENSIMLHNL 962
            P +KS+  F       +   V +E ++  L V +        P ET      +YL+  +    +S    KT   +F            + +R LK    ++    KH L      G + +PL+   N     D RRV  R +    +        ++ CL  +    +L V VLR KGL   E + I++ +  + L      +   +T      I+P ++E + F+ +  +L T  L   +V N   ++  QLGR+ +      + +E  HW+ +LSKP E     H L
Sbjct:  158 PEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQL-----LGQVLFPLK---NETLVGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHAL 438          
BLAST of SMED30018178 vs. Ensembl Human
Match: FO681492.1 (synaptotagmin-15 [Source:NCBI gene;Acc:102724488])

HSP 1 Score: 54.299 bits (129), Expect = 2.471e-7
Identity = 69/289 (23.88%), Postives = 117/289 (40.48%), Query Frame = -3
Query:  165 PSEKSQHYFKSNRRRSVAMEVTHEVKSRVLSVKIF-------PQETIPDTYDIYLVNSKNTIQKSVRNHKTK--KFS----------NVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSR-IGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLS-SETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPS--GEKSKETIHWNLILSKPNENSIMLHNL 962
            P +KS+  F       +   V +E ++  L V +        P ET      +YL+  +    +S    KT   +F            + +R LK    ++    KH L      G + +PL+   N     D RRV  R +    +        ++ CL  +    +L V VLR KGL   E + I++ +  + L      +   +T      I+P ++E + F+ +  +L T  L   +V N   ++  QLGR+ +      + +E  HW+ +LSKP E     H L
Sbjct:  158 PEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQL-----LGQVLFPLK---NETLVGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHAL 438          
BLAST of SMED30018178 vs. Ensembl Human
Match: DOC2A (double C2 domain alpha [Source:HGNC Symbol;Acc:HGNC:2985])

HSP 1 Score: 51.6026 bits (122), Expect = 1.461e-6
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = -3
Query:  165 KQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNL 524
            + L+V +LRC  L++ +     +PY    L     K S  +T  K   ++PE++E +F++I ++ L TK L   +   D       +G +S+  G + +   HW+  L +P+      H L
Sbjct:  266 RGLLVGILRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTL 386          

HSP 2 Score: 49.6766 bits (117), Expect = 7.162e-6
Identity = 39/147 (26.53%), Postives = 70/147 (47.62%), Query Frame = -3
Query:  153 TIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFND---TENEKVQLGRLSIPSGE-KSKETIHWNLILSK------PNENSIMLHNLK*YI 560
            T+E  L  D++   L   +LR KGL   +   + +PY  + L  G  K +  +TKT+ N ++P W+E   +    +D  T  +L+I V ++   + NE +  G + +P    K  +  H+N+ L +      P+  S  L  +  Y+
Sbjct:   92 TLEFDLLYDRASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFI--GEIRVPLRRLKPSQKKHFNICLERQVPLASPSSMSAALRGISCYL 236          
BLAST of SMED30018178 vs. Ensembl Human
Match: DOC2A (double C2 domain alpha [Source:HGNC Symbol;Acc:HGNC:2985])

HSP 1 Score: 51.6026 bits (122), Expect = 1.461e-6
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = -3
Query:  165 KQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNL 524
            + L+V +LRC  L++ +     +PY    L     K S  +T  K   ++PE++E +F++I ++ L TK L   +   D       +G +S+  G + +   HW+  L +P+      H L
Sbjct:  266 RGLLVGILRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTL 386          

HSP 2 Score: 49.6766 bits (117), Expect = 7.162e-6
Identity = 39/147 (26.53%), Postives = 70/147 (47.62%), Query Frame = -3
Query:  153 TIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFND---TENEKVQLGRLSIPSGE-KSKETIHWNLILSK------PNENSIMLHNLK*YI 560
            T+E  L  D++   L   +LR KGL   +   + +PY  + L  G  K +  +TKT+ N ++P W+E   +    +D  T  +L+I V ++   + NE +  G + +P    K  +  H+N+ L +      P+  S  L  +  Y+
Sbjct:   92 TLEFDLLYDRASCTLHCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAVCDEDKLSHNEFI--GEIRVPLRRLKPSQKKHFNICLERQVPLASPSSMSAALRGISCYL 236          
BLAST of SMED30018178 vs. Ensembl Fly
Match: Mctp (gene:FBgn0034389 transcript:FBtr0330004)

HSP 1 Score: 51.6026 bits (122), Expect = 1.237e-6
Identity = 32/102 (31.37%), Postives = 61/102 (59.80%), Query Frame = -3
Query:  249 CLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 548
            CL+  +    L VKV    GL++ +     +P+CV+EL  G +++   +T+T+Y  ++P W++ + F  N+ D+    +L+I VF++  + +V+ LG+L IP
Sbjct:  529 CLQNLRDVGHLTVKVFGATGLAAADIGGKSDPFCVLEL--GNARL---QTQTEYKTLTPNWNKIFTF--NVKDITQ--VLEITVFDEDRDHRVEFLGKLVIP 621          
BLAST of SMED30018178 vs. Ensembl Fly
Match: Mctp (gene:FBgn0034389 transcript:FBtr0330005)

HSP 1 Score: 51.6026 bits (122), Expect = 1.250e-6
Identity = 32/102 (31.37%), Postives = 61/102 (59.80%), Query Frame = -3
Query:  249 CLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 548
            CL+  +    L VKV    GL++ +     +P+CV+EL  G +++   +T+T+Y  ++P W++ + F  N+ D+    +L+I VF++  + +V+ LG+L IP
Sbjct:  571 CLQNLRDVGHLTVKVFGATGLAAADIGGKSDPFCVLEL--GNARL---QTQTEYKTLTPNWNKIFTF--NVKDITQ--VLEITVFDEDRDHRVEFLGKLVIP 663          
BLAST of SMED30018178 vs. Ensembl Fly
Match: Mctp (gene:FBgn0034389 transcript:FBtr0346955)

HSP 1 Score: 51.6026 bits (122), Expect = 1.280e-6
Identity = 32/102 (31.37%), Postives = 61/102 (59.80%), Query Frame = -3
Query:  249 CLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 548
            CL+  +    L VKV    GL++ +     +P+CV+EL  G +++   +T+T+Y  ++P W++ + F  N+ D+    +L+I VF++  + +V+ LG+L IP
Sbjct:  529 CLQNLRDVGHLTVKVFGATGLAAADIGGKSDPFCVLEL--GNARL---QTQTEYKTLTPNWNKIFTF--NVKDITQ--VLEITVFDEDRDHRVEFLGKLVIP 621          
BLAST of SMED30018178 vs. Ensembl Fly
Match: Mctp (gene:FBgn0034389 transcript:FBtr0345950)

HSP 1 Score: 51.6026 bits (122), Expect = 1.296e-6
Identity = 32/102 (31.37%), Postives = 61/102 (59.80%), Query Frame = -3
Query:  249 CLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 548
            CL+  +    L VKV    GL++ +     +P+CV+EL  G +++   +T+T+Y  ++P W++ + F  N+ D+    +L+I VF++  + +V+ LG+L IP
Sbjct:  510 CLQNLRDVGHLTVKVFGATGLAAADIGGKSDPFCVLEL--GNARL---QTQTEYKTLTPNWNKIFTF--NVKDITQ--VLEITVFDEDRDHRVEFLGKLVIP 602          
BLAST of SMED30018178 vs. Ensembl Fly
Match: Mctp (gene:FBgn0034389 transcript:FBtr0110970)

HSP 1 Score: 51.6026 bits (122), Expect = 1.296e-6
Identity = 32/102 (31.37%), Postives = 61/102 (59.80%), Query Frame = -3
Query:  249 CLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 548
            CL+  +    L VKV    GL++ +     +P+CV+EL  G +++   +T+T+Y  ++P W++ + F  N+ D+    +L+I VF++  + +V+ LG+L IP
Sbjct:  510 CLQNLRDVGHLTVKVFGATGLAAADIGGKSDPFCVLEL--GNARL---QTQTEYKTLTPNWNKIFTF--NVKDITQ--VLEITVFDEDRDHRVEFLGKLVIP 602          
BLAST of SMED30018178 vs. Ensembl Mouse
Match: Doc2a (double C2, alpha [Source:MGI Symbol;Acc:MGI:109446])

HSP 1 Score: 51.2174 bits (121), Expect = 1.345e-6
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = -3
Query:  165 LMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNL 518
            L+V ++RC  L++ +     +PY    L     K S  +T  K   ++PE++E +F++I ++ L TK L   +   D       +G +S+  G + +   HWN  L +P+      H L
Sbjct:  273 LLVGIVRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEAQKHWNDCLHQPDTALERWHTL 391          

HSP 2 Score: 49.6766 bits (117), Expect = 4.586e-6
Identity = 39/147 (26.53%), Postives = 71/147 (48.30%), Query Frame = -3
Query:  153 TIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFND---TENEKVQLGRLSIPSGE-KSKETIHWNLILSK------PNENSIMLHNLK*YI 560
            T+E  L  D++   L  ++LR KGL   +   + +PY  + L  G  K +  +TKT+ N ++P W+E   +    +D  T  +L+I V ++   + NE +  G + +P    K  +  H+N+ L +      P+  S  L  +  Y+
Sbjct:   97 TLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFI--GEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYL 241          
BLAST of SMED30018178 vs. Ensembl Mouse
Match: Doc2a (double C2, alpha [Source:MGI Symbol;Acc:MGI:109446])

HSP 1 Score: 49.6766 bits (117), Expect = 1.800e-6
Identity = 39/147 (26.53%), Postives = 71/147 (48.30%), Query Frame = -3
Query:  153 TIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFND---TENEKVQLGRLSIPSGE-KSKETIHWNLILSK------PNENSIMLHNLK*YI 560
            T+E  L  D++   L  ++LR KGL   +   + +PY  + L  G  K +  +TKT+ N ++P W+E   +    +D  T  +L+I V ++   + NE +  G + +P    K  +  H+N+ L +      P+  S  L  +  Y+
Sbjct:   27 TLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFI--GEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYL 171          
BLAST of SMED30018178 vs. Ensembl Mouse
Match: Doc2a (double C2, alpha [Source:MGI Symbol;Acc:MGI:109446])

HSP 1 Score: 50.0618 bits (118), Expect = 1.830e-6
Identity = 39/147 (26.53%), Postives = 71/147 (48.30%), Query Frame = -3
Query:  153 TIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFND---TENEKVQLGRLSIPSGE-KSKETIHWNLILSK------PNENSIMLHNLK*YI 560
            T+E  L  D++   L  ++LR KGL   +   + +PY  + L  G  K +  +TKT+ N ++P W+E   +    +D  T  +L+I V ++   + NE +  G + +P    K  +  H+N+ L +      P+  S  L  +  Y+
Sbjct:   97 TLEFDLLYDQASCMLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDDITHKVLRISVCDEDKLSHNEFI--GEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISCYL 241          
BLAST of SMED30018178 vs. UniProt/SwissProt
Match: sp|P59926|SYT15_RAT (Synaptotagmin-15 OS=Rattus norvegicus OX=10116 GN=Syt15 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 8.731e-7
Identity = 57/204 (27.94%), Postives = 93/204 (45.59%), Query Frame = -3
Query:  165 NVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNK--TIEICLRLDKSDKQLMVKVLRCKGLS-SETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEK-VQLGRLSIPS--GEKSKETIHWNLILSKPNENSIMLHNL 758
            +V +R LK    +I    KH L      G + +PL+   N     D+ RV  R  L   N E +++   ++ CL  +    +L V VLR KGL   E + +++ +  + L      +    T      ++P ++E + F+ + N+L T   L ++V   TE +K   LGR+ +      + KE  HWN +L KP E     H L
Sbjct:  223 SVAQRVLKFSVYHINKQRKHQL-----LGQVLFPLK---NETLAGDRHRVIWR-DLEAENLEPLSEFGDLQFCLSYNDYLSRLTVVVLRAKGLQLQEDRGVVSVFVKVSLMNHNKFVKCKRTSAVLGSVNPVYNETFSFKADANELDTAS-LSLVVLQITEGDKSYPLGRVVVGPYMYTRGKELEHWNEMLRKPKELVKRWHAL 416          
BLAST of SMED30018178 vs. UniProt/SwissProt
Match: sp|Q9BQS2|SYT15_HUMAN (Synaptotagmin-15 OS=Homo sapiens OX=9606 GN=SYT15 PE=1 SV=3)

HSP 1 Score: 54.299 bits (129), Expect = 1.166e-6
Identity = 69/289 (23.88%), Postives = 117/289 (40.48%), Query Frame = -3
Query:  165 PSEKSQHYFKSNRRRSVAMEVTHEVKSRVLSVKIF-------PQETIPDTYDIYLVNSKNTIQKSVRNHKTK--KFS----------NVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSR-IGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLS-SETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPS--GEKSKETIHWNLILSKPNENSIMLHNL 962
            P +KS+  F       +   V +E ++  L V +        P ET      +YL+  +    +S    KT   +F            + +R LK    ++    KH L      G + +PL+   N     D RRV  R +    +        ++ CL  +    +L V VLR KGL   E + I++ +  + L      +   +T      I+P ++E + F+ +  +L T  L   +V N   ++  QLGR+ +      + +E  HW+ +LSKP E     H L
Sbjct:  135 PEDKSETDFPDGCLGRLWFSVEYEQEAERLLVGLIKAQHLQAPSETCSPLVKLYLLPDERRFLQSKTKRKTSNPQFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQL-----LGQVLFPLK---NETLVGDCRRVIWRDLEAESLEPPSEFGDLQFCLSYNDYLSRLTVVVLRAKGLRLQEDRGIVSVFVKVSLMNHNKFVKCKKTSAVLGSINPVYNETFSFKADATELDTASLSLTVVQNMEGDKSQQLGRVVVGPYMYTRGRELEHWDEMLSKPKELVKRWHAL 415          
BLAST of SMED30018178 vs. UniProt/SwissProt
Match: sp|Q14183|DOC2A_HUMAN (Double C2-like domain-containing protein alpha OS=Homo sapiens OX=9606 GN=DOC2A PE=1 SV=5)

HSP 1 Score: 51.6026 bits (122), Expect = 7.017e-6
Identity = 32/121 (26.45%), Postives = 58/121 (47.93%), Query Frame = -3
Query:  165 KQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNL 524
            + L+V +LRC  L++ +     +PY    L     K S  +T  K   ++PE++E +F++I ++ L TK L   +   D       +G +S+  G + +   HW+  L +P+      H L
Sbjct:  266 RGLLVGILRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEARKHWSDCLQQPDAALERWHTL 386          
BLAST of SMED30018178 vs. UniProt/SwissProt
Match: sp|Q7TNF0|DOC2A_MOUSE (Double C2-like domain-containing protein alpha OS=Mus musculus OX=10090 GN=Doc2a PE=2 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 9.408e-6
Identity = 32/119 (26.89%), Postives = 57/119 (47.90%), Query Frame = -3
Query:  165 LMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNL 518
            L+V ++RC  L++ +     +PY    L     K S  +T  K   ++PE++E +F++I ++ L TK L   +   D       +G +S+  G + +   HWN  L +P+      H L
Sbjct:  273 LLVGIVRCAHLAAMDVNGYSDPYVKTYLRPDVDKKSKHKTCVKKKTLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEAQKHWNDCLHQPDTALERWHTL 391          
BLAST of SMED30018178 vs. TrEMBL
Match: A0A267GE30 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004812g1 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 9.857e-7
Identity = 69/280 (24.64%), Postives = 118/280 (42.14%), Query Frame = -3
Query:  162 VAMEVTHEVKSRVLSVKIFPQETIP------DTYDIY-----LVNSKNTIQKSVRNHKTKK-------FSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIE---ICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSK--ISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIV----FNDTEN-EKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 914
            +   +T++  SR LSVKI     +P       T D Y     L +  N +Q  VR+ K          F N     L +  L I+  +      ++  G   +PL  +     T D  R    +  NL  + +    +    + L  +    QL + ++R K L + +     +PYCV +L   K++       +      +SP+W+E++ F +  + +  +Y L+++V    F  +E   +++LG  S PS     ET HW  +LSKP +     H LK
Sbjct:  218 IRFSLTYDWTSRQLSVKICEARGLPAMDFPLGTSDPYCKVSILPDKANRVQTKVRSRKLNPTWNEVFLFENFPGERLLDRTLLIQVLDYDRFSRDDPIGDAQFPLVFLH----TVDGARRSLTLWRNLQPNRKTRGFVGELLLALSYNPHSNQLNLVLMRAKDLKAMDLSRTSDPYCVAKLVHSKTRRVCQRRRSTVVRRSLSPQWNESFTFGVPADKVH-EYHLELVVKDKDFLGSETIGRIRLGTRSCPS-----ETAHWTEVLSKPRQQVARWHTLK 487          
BLAST of SMED30018178 vs. TrEMBL
Match: A0A1I8GN25 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.078e-6
Identity = 69/280 (24.64%), Postives = 117/280 (41.79%), Query Frame = -3
Query:  162 VAMEVTHEVKSRVLSVKIFPQETIP------DTYDIY-----LVNSKNTIQKSVRNHKTKK-------FSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIE---ICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSK--ISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIV----FNDTEN-EKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 914
            +   +T++  SR LSVKI     +P       T D Y     L +  N +Q  VR  K          F N     L +  L I+  +      ++  G   +PL  +     T D  R    +  NL  + +    +    + L  +    QL + ++R K L + +     +PYCV +L   K++       +      +SP+W+E++ F +  + +  +Y L+++V    F  +E   +++LG  S PS     ET HW  +LSKP +     H LK
Sbjct:   55 IRFSLTYDWTSRQLSVKICEARGLPAMDFPLGTSDPYCKVSILPDKANRVQTKVRPRKLNPTWNEVFLFENFPGERLLDRTLLIQVLDYDRFSRDDPIGDAQFPLVFLH----TVDGARRSLTLWRNLQPNRKTRGFVGELLLALSYNPHSNQLNLVLMRAKDLKAMDLSRTSDPYCVAKLVHSKTRRVCQRRRSTVVRRSLSPQWNESFTFGVPADKVH-EYHLELVVKDKDFLGSETIGRIRLGTRSCPS-----ETAHWTEVLSKPRQQVARWHTLK 324          
BLAST of SMED30018178 vs. TrEMBL
Match: A0A3M7RWF8 (Synaptotagmin 1 isoform X1 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_034231 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.152e-6
Identity = 49/205 (23.90%), Postives = 92/205 (44.88%), Query Frame = -3
Query:  162 FSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEIC--LRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAY-FFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 764
            F N+   D+    L    Y+      ++  G ++ PL ++       + R ++   G    + E  NK  +IC  LR   +  +L V +L  K L   +   + +PY  + L+K   +I   +T  K N ++P ++E++ F ++N  D++   LL  +V  D       +G++ +    +  E  HW+ +L+ P     M H LK
Sbjct:  238 FKNLAYGDISGKTLVFAIYDFDRFSRHDQIGEVHVPLGQVDLGKVIQEWRDIQPPAG----DKENENKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKLSLYKNGKRIQKKKTSIKSNTLNPYFNESFTFIKLNTYDIRKVTLLVTVVDYDRIGTSDPIGKVVLGCSAQGSELRHWSDMLASPRRPIAMWHTLK 438          
BLAST of SMED30018178 vs. TrEMBL
Match: A0A1I8IHD6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.746e-6
Identity = 69/280 (24.64%), Postives = 117/280 (41.79%), Query Frame = -3
Query:  162 VAMEVTHEVKSRVLSVKIFPQETIP------DTYDIY-----LVNSKNTIQKSVRNHKTKK-------FSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIE---ICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSK--ISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIV----FNDTEN-EKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 914
            +   +T+   SR LSVKI     +P       T D Y     L + +N +Q  VR  K          F N     L +  L I+  +      ++  G   +PL  +     T D  R    +  NL  + +    +    + L  +    QL + ++R K L + +     +PYCV +L   K++       +      +SP+W+E++ F +  + +  +Y L+++V    F  +E   +++LG  S PS     ET HW  +LSKP +     H LK
Sbjct:   67 IRFSLTYNWTSRQLSVKICEARGLPAMDFPLGTSDPYCKVSILPDKENRVQTKVRPRKLNPTWNEVFLFENFPGERLLDRTLLIQVLDYDRFSRDDPIGDAQFPLVFLH----TVDGARRSLTLWRNLQPNRKTRGFVGELLLALSYNPHSNQLNLVLMRAKDLKAMDLSRTSDPYCVAKLVHSKTRRVCQRRRSTVVRRSLSPQWNESFTFGVPADKVH-EYHLELVVKDKDFLGSETIGRIRLGTRSCPS-----ETAHWTEVLSKPRQQVARWHTLK 336          
BLAST of SMED30018178 vs. Ensembl Cavefish
Match: mctp1b (multiple C2 domains, transmembrane 1b [Source:ZFIN;Acc:ZDB-GENE-090313-382])

HSP 1 Score: 49.6766 bits (117), Expect = 4.445e-6
Identity = 29/92 (31.52%), Postives = 56/92 (60.87%), Query Frame = -3
Query:  249 LMVKVLRCKGL-SSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQ-LGRLSIP 518
            + VKVLR +GL +++     +P+CV+EL   +      +T T Y  ++PEW++   F +N+ D+ +  +L+I VF++  ++    LGR+++P
Sbjct:  342 VQVKVLRAEGLMAADVTGKSDPFCVVELCNDR-----LQTHTVYKNLNPEWNKV--FTLNVKDVHS--VLEISVFDEDRDQSYDFLGRVAVP 424          
BLAST of SMED30018178 vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 55.8398 bits (133), Expect = 9.904e-9
Identity = 49/206 (23.79%), Postives = 92/206 (44.66%), Query Frame = -3
Query:  162 KTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 776
            +T  +  + E ++ +  L ++ +++ ++G N+  G  +  L K+LN NPT   +R  S I   L +       I++ L+ +     L V V+RC GL+S +     +PY    L     K S   T  +   ++PE++E + + I  ++L  K L   +   D       +G + +    +     HW  +L  PN+     H L+
Sbjct:   87 ETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINL-KLLNSNPTQTFKR--SLIPKALDSPHSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSALKHWYDMLKGPNQLHTQWHTLE 289          
BLAST of SMED30018178 vs. Planmine SMEST
Match: SMESG000035470.1 (SMESG000035470.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 354/355 (99.72%), Postives = 355/355 (100.00%), Query Frame = -3
Query:  162 MNFIRSACKCFCGVINNCLNLYQSNEDEKPLISKTIXXXXXXXXXXXXXXSKQDISLLKDSDSEVSDYMXXXXXXXXXXXXXRKASLCPSEKSQHYFKSNRRRSVAMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 1226
            MNFIRSACKCFCGVINNCLNLYQSNEDEKPLISKTISRKSSCTSFRSRSSSKQDISLLKDSDSEVSDYMSSRSSIISQANSQRKASLCPSEKSQHYFKSNRR+SVAMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK
Sbjct:    1 MNFIRSACKCFCGVINNCLNLYQSNEDEKPLISKTISRKSSCTSFRSRSSSKQDISLLKDSDSEVSDYMSSRSSIISQANSQRKASLCPSEKSQHYFKSNRRQSVAMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 355          
BLAST of SMED30018178 vs. Planmine SMEST
Match: SMESG000035473.1 (SMESG000035473.1)

HSP 1 Score: 141.739 bits (356), Expect = 1.262e-38
Identity = 84/250 (33.60%), Postives = 130/250 (52.00%), Query Frame = -3
Query:  162 AMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 911
             +E+ H     VLS+K+FP E IPD +DI +  +    +K    +K   F N++E DL    L + FY++ +    + +G I +PL+ IL     N  R   +   L   N +  N T+EI LR D  + QL V V   +  S++ Q  +N +CV+EL+K  +    ++T  K+N   P W+E + F I + +L     L I V+N+ E   + +G+L  PS E + ET HWN I +  N    MLH+LK
Sbjct:   64 PVEINHNHILNVLSIKVFPNEKIPDKFDISVKTNDKITKKISYFYKVITFDNISEDDLNTSFLSLTFYKRKTPDDKKSFGEIKFPLKLILKKKIQNSIRFYNTDFNLFQNNVKLSNGTLEIGLRFDHKNTQLTVNVYEGQNFSNQNQTPLNTFCVVELFKTHTLYMTYKTSVKFNSNCPIWNETFIFPIKLAELANHIKLIITVYNENETANLPIGKLFFPSSEMALETRHWNEIHTNSNLQIRMLHSLK 313          
BLAST of SMED30018178 vs. Planmine SMEST
Match: SMESG000035473.1 (SMESG000035473.1)

HSP 1 Score: 142.895 bits (359), Expect = 1.582e-38
Identity = 84/250 (33.60%), Postives = 130/250 (52.00%), Query Frame = -3
Query:  162 AMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIMLHNLK 911
             +E+ H     VLS+K+FP E IPD +DI +  +    +K    +K   F N++E DL    L + FY++ +    + +G I +PL+ IL     N  R   +   L   N +  N T+EI LR D  + QL V V   +  S++ Q  +N +CV+EL+K  +    ++T  K+N   P W+E + F I + +L     L I V+N+ E   + +G+L  PS E + ET HWN I +  N    MLH+LK
Sbjct:  113 PVEINHNHILNVLSIKVFPNEKIPDKFDISVKTNDKITKKISYFYKVITFDNISEDDLNTSFLSLTFYKRKTPDDKKSFGEIKFPLKLILKKKIQNSIRFYNTDFNLFQNNVKLSNGTLEIGLRFDHKNTQLTVNVYEGQNFSNQNQTPLNTFCVVELFKTHTLYMTYKTSVKFNSNCPIWNETFIFPIKLAELANHIKLIITVYNENETANLPIGKLFFPSSEMALETRHWNEIHTNSNLQIRMLHSLK 362          
BLAST of SMED30018178 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.090e-14
Identity = 56/182 (30.77%), Postives = 86/182 (47.25%), Query Frame = -3
Query:  246 RNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVN-SERVNKTIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPS 785
            R  + K FSN++E  L+   L +K  +          G IN  LQ +L  +  +DKR       L+ V  S++   +I + L ++   ++L+V VL+ KGL + E  N  NPYC+I+L    +K+    T  KY    P W+E   F I          LKI VF+     K ++G +  PS
Sbjct:  163 RFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPS 344          
BLAST of SMED30018178 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 74.3294 bits (181), Expect = 3.879e-14
Identity = 57/189 (30.16%), Postives = 88/189 (46.56%), Query Frame = -3
Query:  225 RNHKTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPTNDKRRVKSRIGLNLVN-SERVNKTIEICLRLDKSDKQLMVKVLRCKGLSS-ETQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLKTKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKET 785
            R  + K FSN++E  L+   L +K  +          G IN  LQ +L  +  +DKR       L+ V  S++   +I + L ++   ++L+V VL+ KGL + E  N  NPYC+I+L    +K+    T  KY    P W+E   F I          LKI VF+     K ++G +  PS   +  T
Sbjct:  225 RFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTNGT 413          
The following BLAST results are available for this feature:
BLAST of SMED30018178 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT152.429e-723.88synaptotagmin 15 [Source:HGNC Symbol;Acc:HGNC:1716... [more]
FO681492.22.471e-723.88synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
FO681492.12.471e-723.88synaptotagmin-15 [Source:NCBI gene;Acc:102724488][more]
DOC2A1.461e-626.45double C2 domain alpha [Source:HGNC Symbol;Acc:HGN... [more]
DOC2A1.461e-626.45double C2 domain alpha [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of SMED30018178 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mctp1.237e-631.37gene:FBgn0034389 transcript:FBtr0330004[more]
Mctp1.250e-631.37gene:FBgn0034389 transcript:FBtr0330005[more]
Mctp1.280e-631.37gene:FBgn0034389 transcript:FBtr0346955[more]
Mctp1.296e-631.37gene:FBgn0034389 transcript:FBtr0345950[more]
Mctp1.296e-631.37gene:FBgn0034389 transcript:FBtr0110970[more]
back to top
BLAST of SMED30018178 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Doc2a1.345e-626.89double C2, alpha [Source:MGI Symbol;Acc:MGI:109446... [more]
Doc2a1.800e-626.53double C2, alpha [Source:MGI Symbol;Acc:MGI:109446... [more]
Doc2a1.830e-626.53double C2, alpha [Source:MGI Symbol;Acc:MGI:109446... [more]
back to top
BLAST of SMED30018178 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P59926|SYT15_RAT8.731e-727.94Synaptotagmin-15 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|Q9BQS2|SYT15_HUMAN1.166e-623.88Synaptotagmin-15 OS=Homo sapiens OX=9606 GN=SYT15 ... [more]
sp|Q14183|DOC2A_HUMAN7.017e-626.45Double C2-like domain-containing protein alpha OS=... [more]
sp|Q7TNF0|DOC2A_MOUSE9.408e-626.89Double C2-like domain-containing protein alpha OS=... [more]
back to top
BLAST of SMED30018178 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A267GE309.857e-724.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GN251.078e-624.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3M7RWF81.152e-623.90Synaptotagmin 1 isoform X1 OS=Brachionus plicatili... [more]
A0A1I8IHD62.746e-624.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30018178 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mctp1b4.445e-631.52multiple C2 domains, transmembrane 1b [Source:ZFIN... [more]
back to top
BLAST of SMED30018178 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419339.904e-923.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30018178 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018178 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035470.10.000e+099.72SMESG000035470.1[more]
SMESG000035473.11.262e-3833.60SMESG000035473.1[more]
SMESG000035473.11.582e-3833.60SMESG000035473.1[more]
SMESG000038432.13.090e-1430.77SMESG000038432.1[more]
SMESG000038432.13.879e-1430.16SMESG000038432.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018178 ID=SMED30018178|Name=SMED30018178|organism=Schmidtea mediterranea sexual|type=transcript|length=1270bp
TCACAGTATTTTTCTTAAATTCTGAAAAAATGTTAAATGAGTAAAAACGG
ATTTGTTTACTTGCGCCATTTATAACGGTTTAAGAGCTAGTAAAATAATA
ATTTTTTATTTAAAAATTAAATAAAACACTAAACCCAGGCTGCAGTGATA
TTTATGTATTACTTTAGGTTATGCAACATAATTGAATTTTCATTAGGTTT
GGAAAGTATTAAATTCCAGTGAATGGTTTCCTTTGACTTTTCTCCCGAGG
GAATTGAGAGCCTCCCCAATTGAACCTTTTCGTTTTCAGTATCATTAAAC
ACTATGATTTTCAATAAATATTTTGTCTTTAGATCATTTATATTTATTTG
AAAAAAATATGCCTCATCCCATTCTGGAGAAATTTGATTATATTTAGTTT
TTGTTTCGAAATTGGAAATTTTCGATTTACCTTTCCAGAGTTCAATGACA
CAATAGGGATTAATAATATTTTGTGTTTCACTACTTAAGCCTTTACATCT
GAGAACTTTTACCATTAATTGTTTATCGCTTTTATCTAGCCGTAGGCATA
TTTCAATTGTTTTATTTACTCTCTCTGAATTGACTAAATTTAAGCCAATT
CTACTTTTTACGCGTCTTTTATCGTTTGTAGGGTTCATGTTTAATATTTT
CTGTAACGGATAATTAATAACTCCATAGTCTTCGTTGGCACCAAGGGAAT
GTTTTTCATAAAATTTTATATATAAATCAAAATTTTTCAGATCTCTTTCA
TTAACATTTGAAAATTTCTTTGTTTTATGATTACGTACTGATTTCTGAAT
TGTATTTTTTGAATTTACCAAGTAAATGTCATATGTATCCGGTATGGTTT
CTTGTGGGAAAATTTTAACTGACAATACTCTTGATTTTACTTCATGGGTC
ACTTCCATAGCTACACTTCGACGCCTGTTCGATTTGAAATAATGTTGAGA
TTTTTCACTGGGGCATAGAGATGCTTTCCTTTGAGAATTGGCTTGACTTA
TAATTGAAGATCGACTAGACATGTAGTCGCTTACCTCTGAATCACTGTCT
TTAAGCAGCGAAATATCTTGTTTTGAAGAACTTCGTGATCGGAAACTAGT
ACAGGAAGATTTTCTTGAAATTGTCTTTGAGATCAAAGGTTTCTCATCTT
CATTAGATTGATATAAATTCAAACAGTTGTTGATCACTCCGCAAAAACAT
TTGCAAGCTGACCTGATGAAATTCATTTGAAATTTTGTTTTTGTAAAATT
GCCATATAAGATTTATATAG
back to top

protein sequence of SMED30018178-orf-1

>SMED30018178-orf-1 ID=SMED30018178-orf-1|Name=SMED30018178-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=356bp
MNFIRSACKCFCGVINNCLNLYQSNEDEKPLISKTISRKSSCTSFRSRSS
SKQDISLLKDSDSEVSDYMSSRSSIISQANSQRKASLCPSEKSQHYFKSN
RRRSVAMEVTHEVKSRVLSVKIFPQETIPDTYDIYLVNSKNTIQKSVRNH
KTKKFSNVNERDLKNFDLYIKFYEKHSLGANEDYGVINYPLQKILNMNPT
NDKRRVKSRIGLNLVNSERVNKTIEICLRLDKSDKQLMVKVLRCKGLSSE
TQNIINPYCVIELWKGKSKISNFETKTKYNQISPEWDEAYFFQININDLK
TKYLLKIIVFNDTENEKVQLGRLSIPSGEKSKETIHWNLILSKPNENSIM
LHNLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 236..339
e-value: 1.7E-10
score: 50.8
IPR000008C2 domainPFAMPF00168C2coord: 236..337
e-value: 3.9E-10
score: 39.9
IPR000008C2 domainPROSITEPS50004C2coord: 236..324
score: 12.04
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 222..355
e-value: 1.5E-22
score: 82.0
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 17..355
NoneNo IPR availablePANTHERPTHR10024:SF344SYNAPTOTAGMIN 7, ISOFORM Acoord: 17..355
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 220..345