insulin receptor-like 1 protein

Overview
Nameinsulin receptor-like 1 protein (AEM45794.1)
Smed IDSMED30018177
Length (bp)4739
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of insulin receptor-like 1 protein (SMED30018177) t-SNE clustered cells

Violin plots show distribution of expression levels for insulin receptor-like 1 protein (SMED30018177) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of insulin receptor-like 1 protein (SMED30018177) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for insulin receptor-like 1 protein (SMED30018177) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018177

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30018177SMESG000042173.1 dd_Smed_v4_9272_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018177SMESG000042173.1 dd_Smed_v4_9272_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018177SMESG000042173.1 dd_Smed_v4_9272_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018177SMESG000042173.1 JN049497.1smed_ncbi_20200123PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30018177SMESG000042173.1 JN049497.1smed_ncbi_20200123PMID:27523733
Lei et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 369.392 bits (947), Expect = 4.315e-105
Identity = 339/1164 (29.12%), Postives = 525/1164 (45.10%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV-------------VIDNLLPAKRYAFYAEAIRS---RVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNK--NQILINIDKDDTIMQFLDEYITKSFIKQN-------EIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +GRCV+ C   +Y +++ RC++ S C +L  +     R+  H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R LR+I+G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P+             ++  L P  +YA + + + +       +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C  K                 +   NQ++ E    +C  SC K  +QIL  +++      F D      F+ +        E P+ + K    G         N TV V  V   FP+T  S+ S P+       F+K+V    N+     + L H+T Y  E+QAC    N  + E +               CS  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +I+  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  +++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   33 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPK-VCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYS----------FYALDNQNLRQLWD----WSKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAE--DSELFELDYCL-KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECC-SCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVG------NVTVAVPTVAA-FPNT--SSTSVPTSPEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDTPEER---------------CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLR---ELGQGSFGMVYEGNARDIIK----------GEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1091          

HSP 2 Score: 197.978 bits (502), Expect = 2.671e-50
Identity = 100/207 (48.31%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    E E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + +  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1100 LVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPD--NCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1304          
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 367.851 bits (943), Expect = 1.129e-104
Identity = 338/1157 (29.21%), Postives = 523/1157 (45.20%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV-------------VIDNLLPAKRYAFYAEAIRS---RVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNK--NQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +GRCV+ C   +Y +++ RC++ S C +L  +     R+  H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R LR+I+G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P+             ++  L P  +YA + + + +       +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C  K                 +   NQ++ E    +C  SC K  +QIL  +++      F D      F     +P+ + K    G         N TV V  V   FP+T  S+ S P+       F+K+V    N+     + L H+T Y  E+QAC    N  + E +               CS  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +I+  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  +++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   33 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPK-VCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYS----------FYALDNQNLRQLWD----WSKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAE--DSELFELDYCL-KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECC-SCPKTDSQILKELEESSFRKTFEDYLHNVVF-----VPRPSRKRRSLGDVG------NVTVAVPTVAA-FPNT--SSTSVPTSPEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDTPEER---------------CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLR---ELGQGSFGMVYEGNARDIIK----------GEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1079          

HSP 2 Score: 197.593 bits (501), Expect = 3.172e-50
Identity = 100/207 (48.31%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    E E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + +  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1088 LVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPD--NCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1292          
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Match: IGF1R (insulin like growth factor 1 receptor [Source:HGNC Symbol;Acc:HGNC:5465])

HSP 1 Score: 349.747 bits (896), Expect = 1.348e-98
Identity = 317/1143 (27.73%), Postives = 519/1143 (45.41%), Query Frame = 3
Query:  213 SNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEYS---FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINM-RNFCLEFCPNNCPRGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYG-EGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEA---EGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVE------GYIGKPVVIDNLLPAKRYAFYAEAIR-SRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLE---IFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGE-CDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            S E     IDIR     +  L NCTVIEG L+I +++   +Y    FP L  IT  L+++ V G ++LG  FPNLT+IRG  L YNYA+VI E TNL  IGL NLR +  G +RI+ N  LCY++T++W+ I+        + N     C + CP         +K          CW  N CQ +C  +C K  + C  N  N CCHPECLG C   + D  CV+C++    G CV  C    Y+++  RC+    C N+ S  S+D    + + I D  C+++C  G  +N      C  C   C K         +I+  + A   +GC   + ++ I+I+ G +  S+ L      + ++   ++I  S ++ SL FL++LR+I G    + N            F V DN+NL +++D     +  N+TI  G + F  N KLC  +I   +     TK + SK D  I   +NG+ A C+ + L       S +   +  H   P       + T  +  KE   KNV++Y+  ++C   +W  V+        +   +++  L P  +YA Y +A+  + VEN       S+++Y+ T    PS P+++ + + SSS++ + WNPP  PNG ++ YI+ W R  +   ++  ++  +D    +  +   I  +      KT      +G  C C K        +      K        + ++  S      +P+   K  D    ++     +   R      N  + D   I+ P  E L   +        N+     +NL  +T Y  +I +C       + E++ L             CS+ + + A T P E  D+I           +S+ + W EP++PNG IL Y I+Y     +         CV+R E+                   +K G   L  L PG Y  +I+  +++  G+WT    F + + + +  + +  I   V +++I+  L +++  + +K+   R      + S NP+Y+    +Y  D WE+ R+ + M   +  LG+GSFGMVY+GV K +            DE +  VA+KT+N  +++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   29 SGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGK--RACTEN--NECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSD---SEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASE-LENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS----------FYVLDNQNLQQLWD----WDHRNLTIKAGKMYFAFNPKLCVSEIYR-MEEVTGTKGRQSKGD--INTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYY--KEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK------VFENFLHNSIF----VPRPERKRRDV--MQVANTTMSSRSR------NTTAADTYNITDP--EELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSC-------NHEAEKLG------------CSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQR------ECVSRQEY-------------------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITM---SRELGQGSFGMVYEGVAKGVVK----------DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG 1067          

HSP 2 Score: 202.986 bits (515), Expect = 8.621e-52
Identity = 105/207 (50.72%), Postives = 131/207 (63.29%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEG---FVSENQSHL--WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    E E        + S +   A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  FR  S+Y
Sbjct: 1076 LVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFY 1280          
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Match: IGF1R (insulin like growth factor 1 receptor [Source:HGNC Symbol;Acc:HGNC:5465])

HSP 1 Score: 345.895 bits (886), Expect = 2.875e-97
Identity = 317/1143 (27.73%), Postives = 518/1143 (45.32%), Query Frame = 3
Query:  213 SNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEYS---FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINM-RNFCLEFCPNNCPRGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYG-EGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEA---EGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVE------GYIGKPVVIDNLLPAKRYAFYAEAIR-SRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLE---IFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGE-CDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            S E     IDIR     +  L NCTVIEG L+I +++   +Y    FP L  IT  L+++ V G ++LG  FPNLT+IRG  L YNYA+VI E TNL  IGL NLR +  G +RI+ N  LCY++T++W+ I+        + N     C + CP         +K          CW  N CQ +C  +C K  + C  N  N CCHPECLG C   + D  CV+C++    G CV  C    Y+++  RC+    C N+ S  S+D    + + I D  C+++C  G  +N      C  C   C K         +I+  + A   +GC   + ++ I+I+ G +  S+ L      + ++   ++I  S ++ SL FL++LR+I G    + N            F V DN+NL +++D     +  N+TI  G + F  N KLC  +I   +     TK + SK D  I   +NG+ A C+ + L       S +   +  H   P       + T  +  KE   KNV++Y+  ++C   +W  V+        +   +++  L P  +YA Y +A+  + VEN       S+++Y+ T    PS P+++ + + SSS++ + WNPP  PNG ++ YI+ W R  +   ++  ++  +D    +  +   I  +      KT      +G  C C K        +      K        + ++  S      +P+   K  D    ++     +   R      N  + D   I+ P  E L   +        N+     +NL  +T Y  +I +C       + E++ L             CS+ + + A T P E  D+I           +S+ + W EP++PNG IL Y I+Y     +         CV+R E+                   +K G   L  L PG Y  +I+  +++  G+WT    F + +   +  + +  I   V +++I+  L +++  + +K+   R      + S NP+Y+    +Y  D WE+ R+ + M   +  LG+GSFGMVY+GV K +            DE +  VA+KT+N  +++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   29 SGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGK--RACTEN--NECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSD---SEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASE-LENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS----------FYVLDNQNLQQLWD----WDHRNLTIKAGKMYFAFNPKLCVSEIYR-MEEVTGTKGRQSKGD--INTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYY--KEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK------VFENFLHNSIF----VPRPERKRRDV--MQVANTTMSSRSR------NTTAADTYNITDP--EELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSC-------NHEAEKLG------------CSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQR------ECVSRQEY-------------------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKR-YENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITM---SRELGQGSFGMVYEGVAKGVVK----------DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG 1066          

HSP 2 Score: 202.986 bits (515), Expect = 8.038e-52
Identity = 105/207 (50.72%), Postives = 131/207 (63.29%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEG---FVSENQSHL--WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    E E        + S +   A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  FR  S+Y
Sbjct: 1075 LVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFY 1279          
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Match: INSRR (insulin receptor related receptor [Source:HGNC Symbol;Acc:HGNC:6093])

HSP 1 Score: 321.627 bits (823), Expect = 1.656e-89
Identity = 307/1147 (26.77%), Postives = 492/1147 (42.89%), Query Frame = 3
Query:  186 ITFTDSFKLSNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIA-MVTLTSE----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLIN-MRNFCLEFCPNNC-PRGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK-YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVE-----GYIGKP-VVIDNLLPAKRYAFYAEAIRSRVE----NWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQ-----FLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKI-SSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            I  +  F L   +VC S+DIR   + +  L NC+V+EG L I  M T T E     SFP L ++T  L+++ V G ++L   FPNL +IRG  L   YA+VI E  +L  + L  L  V+ G VR++ N  LC+++TI+W  +    GA   + N +   C + CP      GE   K          CW  + CQ VC      +   C       CCH ECLGGC   E    CV+C+++   G C+  C    Y+Y++ RC++   C +L S       R   + I   +C+ QC  G  +N  +  C  C   C K+   G   I SI    +  GC  +E   I     G +L   L  +   +  I   L+I  S ++ SL F ++L++I                + +    V DN+NL ++     A     +TI  G + F  N +LC E I   L     T+ + +K +  I   +NGD A C+   L   V N++++   +    +   +  ++     ++  +   +N +++   ++C  Q+W  ++         +P V + +L P  +YA +  AI    E    +    S ++YL T    P+ P ++ + + SSS + + W PP   NG +T Y++ ++ L   G D ++ D C    +  R   S ++ R    +   + + E DC  C       Q+L  ++  +   Q     FL   IT        IP S WK V S +   ++           +     S+D                    +VP        + L H+TEY  +I AC    +                    + CS+ + + A T P    D I         + +SV + W EP  PNG IL Y I+YR+   EA     +  CV+R                   +   K G   L  L PG Y  +++  ++A  G+WT S  F I   +       +  +    V + +L  L  L  +Y KK+   RT + S NP+Y+    +Y  D WE+ R+ + ++     LG+GSFGMVY+G+ + L             E+   VA+KT+N  ++  E  EF+ EA  MK F+ +H+V+L G
Sbjct:   16 IFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLMFTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEMPHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVCPGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCP---CPHGMACTAR--GECCHTECLGGCSQPEDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPG----RASTFGIHQGSCLAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQGYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLI----------RGDAMVDGNYTLYVLDNQNLQQLGSWVAA----GLTIPVGKIYFAFNPRLCLEHIYR-LEEVTGTRGRQNKAE--INPRTNGDRAACQTRTLRF-VSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDG-DLYLNDYCH---RGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHP-PPGQVLPPLEAQEASFQKKFENFLHNAIT--------IPISPWK-VTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQED--------------KVPRERAV--LSGLRHFTEYRIDIHACNHAAH-------------------TVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSR-------------------LRYAKFGGVHLALLPPGNYSARVRATSLAGNGSWTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKR--NRTLYASVNPEYFSASDMYVPDEWEVPREQISIIR---ELGQGSFGMVYEGLARGLEA----------GEESTPVALKTVNELASPRECIEFLKEASVMKAFKCHHVVRLLG 1047          

HSP 2 Score: 194.897 bits (494), Expect = 2.161e-49
Identity = 105/208 (50.48%), Postives = 128/208 (61.54%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLG-IMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    E E      Q  L      A +IADGM YL+  KFVHRDLAARNCM++    +KIGDFGM RDVY   YYRK  KG LPVRWMAPESL  G F+  SD+WS+GV+LWEI+TLA  PY+G+S+  V+++V  GG L          L L  +M  CW  NP  RPSF  I+  ++     +FR  S+Y
Sbjct: 1056 LVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVL---EELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY 1260          
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 191.43 bits (485), Expect = 1.366e-48
Identity = 194/716 (27.09%), Postives = 307/716 (42.88%), Query Frame = 3
Query:  219 EKVCQSIDIRKRS------------------HVSLLTNCTVIEGDLYIAMV-------------TLTSEYS------FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRG-----------------------ENLQKYCWHHNTCQNVCS-ESCAKNNQYCFMNDPN-RCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDA--CVKQCSPGKQQN--------KITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCY--SIEDIYISIKEGG---SSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNI-SDSSFTVKCHSKVPDISLQNSALTALFMLKETTK---NVSQYELFNSCSEQNWRTV-----EGYIGKPV--VIDNLLPAKR------YAFYAEA---IRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEI 2072
            EK C  IDIR R                       + NCTV+EG L I+ V             +L   YS      FP L+EITG+L+++  +G   L   FPNL +I G++L  +YA++I     L IGL  L ++  GGVRI +N  LCY  TI+W  ++      + + N   + +      CPRG                       E +Q  CW + TCQ  C+ +      +     D N   CH +C+GGC    D   C +CKNV   G+C++KCD   Y    RRC++  +C+ L+   S          I+  A  C  +C  G Q N        K  G+CEI    C        + H I+ F +A+     +I D  ++I+  G   S ++  L   F+ +  I   L + +SS   SL+  R+LR I          E  +         V++N NL ++FD        ++T+  G+VS   N+ LC + I   ++   +    L  +D+     +NG+ A C+   + V +  + +DS F       + DI  Q   L      KE  +   N++  E  ++C + +W++V     E   G+P   +  ++ P +R      YA+Y      + +  +N   +S + ++ T    P  P  L    + S  I +TW  PL PNG++T Y I +R  E+
Sbjct:   67 EKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVNCTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS-CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKT-----VPIKATAGLCSDKCPDGYQINPDDHRECRKCVGKCEIV---CE-------INHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRI----------EAKSLFRNLYAITVFENPNLKKLFDSTT-----DLTLDRGTVSIANNKMLCFKYIKQLMS---KLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDID-QRKFLGYELFFKEVPRIDENMTIEEDRSACVD-SWQSVFKQYYETSNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNG--VSKIGFVRTSYYTPDPP-TLALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEV 741          

HSP 2 Score: 186.808 bits (473), Expect = 4.179e-47
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +V+ME+M+ G+L  YLR + E+ E F          +  ++ H WA QI DGM YL  +KF HRDLAARNCMIN    +KIGDFGMARD++Y  YY+   K  +PVRWM+PESL  G F   SD+WS+GV+L+E++TL + PY G+S+ +V+ Y+     ++             +M+ CW Y+P DRP+F  ++  L   A   FR+ S+
Sbjct: 1249 MVVMEMMDLGNLRDYLRSKRED-EVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPEC-CENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSF 1457          
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 191.43 bits (485), Expect = 1.506e-48
Identity = 194/718 (27.02%), Postives = 306/718 (42.62%), Query Frame = 3
Query:  219 EKVCQSIDIRKRS------------------HVSLLTNCTVIEGDLYIAMV-------------TLTSEYS------FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRG-----------------------ENLQKYCWHHNTCQNVCSES----CAKNNQYCFMNDPNRCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDA--CVKQCSPGKQQN--------KITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCY--SIEDIYISIKEGG---SSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNI-SDSSFTVKCHSKVPDISLQNSALTALFMLKETTK---NVSQYELFNSCSEQNWRTV-----EGYIGKPV--VIDNLLPAKR------YAFYAEA---IRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEI 2072
            EK C  IDIR R                       + NCTV+EG L I+ V             +L   YS      FP L+EITG+L+++  +G   L   FPNL +I G++L  +YA++I     L IGL  L ++  GGVRI +N  LCY  TI+W  ++      + + N   + +      CPRG                       E +Q  CW + TCQ  C+        +    C  N     CH +C+GGC    D   C +CKNV   G+C++KCD   Y    RRC++  +C+ L+   S          I+  A  C  +C  G Q N        K  G+CEI    C        + H I+ F +A+     +I D  ++I+  G   S ++  L   F+ +  I   L + +SS   SL+  R+LR I          E  +         V++N NL ++FD        ++T+  G+VS   N+ LC + I   ++   +    L  +D+     +NG+ A C+   + V +  + +DS F       + DI  Q   L      KE  +   N++  E  ++C + +W++V     E   G+P   +  ++ P +R      YA+Y      + +  +N   +S + ++ T    P  P  L    + S  I +TW  PL PNG++T Y I +R  E+
Sbjct:  143 EKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVNCTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS-CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDR--CHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKT-----VPIKATAGLCSDKCPDGYQINPDDHRECRKCVGKCEIV---CE-------INHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRI----------EAKSLFRNLYAITVFENPNLKKLFDSTT-----DLTLDRGTVSIANNKMLCFKYIKQLMS---KLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDID-QRKFLGYELFFKEVPRIDENMTIEEDRSACVD-SWQSVFKQYYETSNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNG--VSKIGFVRTSYYTPDPP-TLALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEV 817          

HSP 2 Score: 186.422 bits (472), Expect = 4.640e-47
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +V+ME+M+ G+L  YLR + E+ E F          +  ++ H WA QI DGM YL  +KF HRDLAARNCMIN    +KIGDFGMARD++Y  YY+   K  +PVRWM+PESL  G F   SD+WS+GV+L+E++TL + PY G+S+ +V+ Y+     ++             +M+ CW Y+P DRP+F  ++  L   A   FR+ S+
Sbjct: 1325 MVVMEMMDLGNLRDYLRSKRED-EVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPEC-CENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSF 1533          
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 191.43 bits (485), Expect = 1.506e-48
Identity = 194/718 (27.02%), Postives = 306/718 (42.62%), Query Frame = 3
Query:  219 EKVCQSIDIRKRS------------------HVSLLTNCTVIEGDLYIAMV-------------TLTSEYS------FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRG-----------------------ENLQKYCWHHNTCQNVCSES----CAKNNQYCFMNDPNRCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDA--CVKQCSPGKQQN--------KITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCY--SIEDIYISIKEGG---SSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNI-SDSSFTVKCHSKVPDISLQNSALTALFMLKETTK---NVSQYELFNSCSEQNWRTV-----EGYIGKPV--VIDNLLPAKR------YAFYAEA---IRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEI 2072
            EK C  IDIR R                       + NCTV+EG L I+ V             +L   YS      FP L+EITG+L+++  +G   L   FPNL +I G++L  +YA++I     L IGL  L ++  GGVRI +N  LCY  TI+W  ++      + + N   + +      CPRG                       E +Q  CW + TCQ  C+        +    C  N     CH +C+GGC    D   C +CKNV   G+C++KCD   Y    RRC++  +C+ L+   S          I+  A  C  +C  G Q N        K  G+CEI    C        + H I+ F +A+     +I D  ++I+  G   S ++  L   F+ +  I   L + +SS   SL+  R+LR I          E  +         V++N NL ++FD        ++T+  G+VS   N+ LC + I   ++   +    L  +D+     +NG+ A C+   + V +  + +DS F       + DI  Q   L      KE  +   N++  E  ++C + +W++V     E   G+P   +  ++ P +R      YA+Y      + +  +N   +S + ++ T    P  P  L    + S  I +TW  PL PNG++T Y I +R  E+
Sbjct:  143 EKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVNCTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS-CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDR--CHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKT-----VPIKATAGLCSDKCPDGYQINPDDHRECRKCVGKCEIV---CE-------INHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRI----------EAKSLFRNLYAITVFENPNLKKLFDSTT-----DLTLDRGTVSIANNKMLCFKYIKQLMS---KLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDID-QRKFLGYELFFKEVPRIDENMTIEEDRSACVD-SWQSVFKQYYETSNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNG--VSKIGFVRTSYYTPDPP-TLALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEV 817          

HSP 2 Score: 186.422 bits (472), Expect = 4.640e-47
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +V+ME+M+ G+L  YLR + E+ E F          +  ++ H WA QI DGM YL  +KF HRDLAARNCMIN    +KIGDFGMARD++Y  YY+   K  +PVRWM+PESL  G F   SD+WS+GV+L+E++TL + PY G+S+ +V+ Y+     ++             +M+ CW Y+P DRP+F  ++  L   A   FR+ S+
Sbjct: 1325 MVVMEMMDLGNLRDYLRSKRED-EVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPEC-CENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSF 1533          
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 191.43 bits (485), Expect = 1.616e-48
Identity = 194/716 (27.09%), Postives = 307/716 (42.88%), Query Frame = 3
Query:  219 EKVCQSIDIRKRS------------------HVSLLTNCTVIEGDLYIAMV-------------TLTSEYS------FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRG-----------------------ENLQKYCWHHNTCQNVCS-ESCAKNNQYCFMNDPN-RCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDA--CVKQCSPGKQQN--------KITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCY--SIEDIYISIKEGG---SSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNI-SDSSFTVKCHSKVPDISLQNSALTALFMLKETTK---NVSQYELFNSCSEQNWRTV-----EGYIGKPV--VIDNLLPAKR------YAFYAEA---IRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEI 2072
            EK C  IDIR R                       + NCTV+EG L I+ V             +L   YS      FP L+EITG+L+++  +G   L   FPNL +I G++L  +YA++I     L IGL  L ++  GGVRI +N  LCY  TI+W  ++      + + N   + +      CPRG                       E +Q  CW + TCQ  C+ +      +     D N   CH +C+GGC    D   C +CKNV   G+C++KCD   Y    RRC++  +C+ L+   S          I+  A  C  +C  G Q N        K  G+CEI    C        + H I+ F +A+     +I D  ++I+  G   S ++  L   F+ +  I   L + +SS   SL+  R+LR I          E  +         V++N NL ++FD        ++T+  G+VS   N+ LC + I   ++   +    L  +D+     +NG+ A C+   + V +  + +DS F       + DI  Q   L      KE  +   N++  E  ++C + +W++V     E   G+P   +  ++ P +R      YA+Y      + +  +N   +S + ++ T    P  P  L    + S  I +TW  PL PNG++T Y I +R  E+
Sbjct:   96 EKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVNCTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS-CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDRCHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKT-----VPIKATAGLCSDKCPDGYQINPDDHRECRKCVGKCEIV---CE-------INHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRI----------EAKSLFRNLYAITVFENPNLKKLFDSTT-----DLTLDRGTVSIANNKMLCFKYIKQLMS---KLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDID-QRKFLGYELFFKEVPRIDENMTIEEDRSACVD-SWQSVFKQYYETSNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNG--VSKIGFVRTSYYTPDPP-TLALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEV 770          

HSP 2 Score: 186.808 bits (473), Expect = 4.350e-47
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +V+ME+M+ G+L  YLR + E+ E F          +  ++ H WA QI DGM YL  +KF HRDLAARNCMIN    +KIGDFGMARD++Y  YY+   K  +PVRWM+PESL  G F   SD+WS+GV+L+E++TL + PY G+S+ +V+ Y+     ++             +M+ CW Y+P DRP+F  ++  L   A   FR+ S+
Sbjct: 1278 MVVMEMMDLGNLRDYLRSKRED-EVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPEC-CENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSF 1486          
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Match: daf-2 (Insulin-like receptor Insulin-like receptor subunit alpha Insulin-like receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q968Y9])

HSP 1 Score: 191.045 bits (484), Expect = 1.821e-48
Identity = 194/718 (27.02%), Postives = 306/718 (42.62%), Query Frame = 3
Query:  219 EKVCQSIDIRKRS------------------HVSLLTNCTVIEGDLYIAMV-------------TLTSEYS------FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRG-----------------------ENLQKYCWHHNTCQNVCSES----CAKNNQYCFMNDPNRCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDA--CVKQCSPGKQQN--------KITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCY--SIEDIYISIKEGG---SSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNI-SDSSFTVKCHSKVPDISLQNSALTALFMLKETTK---NVSQYELFNSCSEQNWRTV-----EGYIGKPV--VIDNLLPAKR------YAFYAEA---IRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEI 2072
            EK C  IDIR R                       + NCTV+EG L I+ V             +L   YS      FP L+EITG+L+++  +G   L   FPNL +I G++L  +YA++I     L IGL  L ++  GGVRI +N  LCY  TI+W  ++      + + N   + +      CPRG                       E +Q  CW + TCQ  C+        +    C  N     CH +C+GGC    D   C +CKNV   G+C++KCD   Y    RRC++  +C+ L+   S          I+  A  C  +C  G Q N        K  G+CEI    C        + H I+ F +A+     +I D  ++I+  G   S ++  L   F+ +  I   L + +SS   SL+  R+LR I          E  +         V++N NL ++FD        ++T+  G+VS   N+ LC + I   ++   +    L  +D+     +NG+ A C+   + V +  + +DS F       + DI  Q   L      KE  +   N++  E  ++C + +W++V     E   G+P   +  ++ P +R      YA+Y      + +  +N   +S + ++ T    P  P  L    + S  I +TW  PL PNG++T Y I +R  E+
Sbjct:  143 EKRCGPIDIRNRPWDIKPQWSKLGDPNEKDLAGQRMVNCTVVEGSLTISFVLKHKTKAQEEMHRSLQPRYSQDEFITFPHLREITGTLLVFETEGLVDLRKIFPNLRVIGGRSLIQHYALIIYRNPDLEIGLDKLSVIRNGGVRIIDNRKLCYTKTIDWKHLITSSINDVVVDNAAEYAVTETGLMCPRGACEEDKGESKCHYLEEKNQEQGVERVQS-CWSNTTCQKSCAYDRLLPTKEIGPGCDANGDR--CHDQCVGGCERVNDATACHACKNVYHKGKCIEKCDAHLYLLLQRRCVTREQCLQLNPVLSNKT-----VPIKATAGLCSDKCPDGYQINPDDHRECRKCVGKCEIV---CE-------INHVIDTFPKAQAIRLCNIIDGNLTIEIRGKQDSGMASELKDIFANIHTITGYLLVRQSSPFISLNMFRNLRRI----------EAKSLFRNLYAITVFENPNLKKLFDSTT-----DLTLDRGTVSIANNKMLCFKYIKQLMS---KLNIPLDPIDQS--EGTNGEKAICEDMAINVSITAVNADSVFFSWPSFNITDID-QRKFLGYELFFKEVPRIDENMTIEEDRSACVD-SWQSVFKQYYETSNGEPTPDIFMDIGPRERIRPNTLYAYYVATQMVLHAGAKNG--VSKIGFVRTSYYTPDPP-TLALAQVDSDAIHITWEAPLQPNGDLTHYTIMWRENEV 817          

HSP 2 Score: 186.422 bits (472), Expect = 4.889e-47
Identity = 91/211 (43.13%), Postives = 130/211 (61.61%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +V+ME+M+ G+L  YLR + E+ E F          +  ++ H WA QI DGM YL  +KF HRDLAARNCMIN    +KIGDFGMARD++Y  YY+   K  +PVRWM+PESL  G F   SD+WS+GV+L+E++TL + PY G+S+ +V+ Y+     ++             +M+ CW Y+P DRP+F  ++  L   A   FR+ S+
Sbjct: 1407 MVVMEMMDLGNLRDYLRSKRED-EVFNETDCNFFDIIPRDKFHEWAAQICDGMAYLESLKFCHRDLAARNCMINRDETVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDVWSFGVVLYEMVTLGAQPYIGLSNDEVLNYIGMARKVIKKPEC-CENYWYKVMKMCWRYSPRDRPTFLQLVHLLAAEASPEFRDLSF 1615          
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290232)

HSP 1 Score: 223.016 bits (567), Expect = 4.097e-58
Identity = 198/660 (30.00%), Postives = 299/660 (45.30%), Query Frame = 3
Query:  216 NEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEY--SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP--------------RGE--------NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGE--GDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEIC-GSECSKKYCGRVLIHSINDFSEAEGCYSI---EDIYISIK-EGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNV-------------SQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAE--AIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII 2051
            N K C+S+DIR   SH + L NCTVIEG L I ++   S    SFP L E+T  ++IY V G  +L   FPNL++IRG  L   YA+V+    +L+ +GL  LR +  GGVRI+ N  LCY  TI+W  I+ ++   + ++       E   + CP               GE        N ++ CW+   CQ  C E C  N   C   D + CC  +CLGGC  +  G+E C+SC+NV  N  C+  C K +Y++ + RC++ +EC+ L+   +        Y   +  C+  C  G Q+++    CE C G +C K+ C   LI S+    E  GC  I   E + ISIK E G+ + D L    + +  I++SL +  +  + SL F +SL  I         +             V DN +L E++      NQ  + I +G V F+ N KLC   I   L           K D  +   SNG+   C    L V + ++  +S  +   +KV +I        A  + K+    +             S     + C ++ W+         +V+ NL+P   Y++Y    AI S + N    SDV    T    PS+   +    +S S+I +TW+    P G +TRY I
Sbjct:  335 NVKPCKSMDIRNMVSHFNQLENCTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNN---CI--DEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQF-DSRCVTANECITLTKFETNSVYSGIPY---NGQCITHCPTGYQKSENKRMCEPCPGGKCDKE-CSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEI---------SGDPPMDADKYALYVLDNRDLDELW----GPNQ-TVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSD--VGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKV-EIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPEKSGVMVLSNLIPYTNYSYYVRTMAISSELTNAE--SDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI 964          

HSP 2 Score: 196.052 bits (497), Expect = 9.093e-50
Identity = 103/220 (46.82%), Postives = 131/220 (59.55%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGE-----------GFVSENQSHLW------AIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELY-ADMNFRNNSYY 4364
            LV+MELM+ GDL  YLR    E             G     Q   +      AI+IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWM PESL  G +S +SD++S+GV+LWE+ TLA+ PY+G+S+  V++YV  GG +      N    L  +M+ CW +    RPSF DII  LE    +  F+  S+Y
Sbjct: 1448 LVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPE--NCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFY 1665          

HSP 3 Score: 101.293 bits (251), Expect = 7.160e-21
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 3
Query: 2496 QVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTIN---TRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSS--NPDYWII-YEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++P N+T+F F  L H+T Y   + AC+     +   S+ L      K++    CS    +   T  K+  D + +  ++        S V++ W+ P  PNG I+ Y + Y+               + +P+ +     +     N      Q +G+  L  L  G Y F+++  +IA  G +T+  H K+     + +   +F +  + +  ++ +LF  VCY  K+K       +++  NP Y  + Y  D WE+ R+++  L    PLG+GSFGMVY+G+LK+      D+            A+KT+N N+T  ER  F++EA  MK+F +YH+V+L G
Sbjct: 1143 ELPPNQTHFVFEKLRHFTRYAIFVVACR-----EEIPSEKLRDTSFKKSL----CSDYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYK---------------LQKPDQVEEKKCIPAADFN------QTAGY--LIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKV--FFWLLGIGLAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLA---PLGQGSFGMVYEGILKSFPPNGVDRE----------CAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLG 1439          
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290230)

HSP 1 Score: 223.016 bits (567), Expect = 4.097e-58
Identity = 198/660 (30.00%), Postives = 299/660 (45.30%), Query Frame = 3
Query:  216 NEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEY--SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP--------------RGE--------NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGE--GDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEIC-GSECSKKYCGRVLIHSINDFSEAEGCYSI---EDIYISIK-EGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNV-------------SQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAE--AIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII 2051
            N K C+S+DIR   SH + L NCTVIEG L I ++   S    SFP L E+T  ++IY V G  +L   FPNL++IRG  L   YA+V+    +L+ +GL  LR +  GGVRI+ N  LCY  TI+W  I+ ++   + ++       E   + CP               GE        N ++ CW+   CQ  C E C  N   C   D + CC  +CLGGC  +  G+E C+SC+NV  N  C+  C K +Y++ + RC++ +EC+ L+   +        Y   +  C+  C  G Q+++    CE C G +C K+ C   LI S+    E  GC  I   E + ISIK E G+ + D L    + +  I++SL +  +  + SL F +SL  I         +             V DN +L E++      NQ  + I +G V F+ N KLC   I   L           K D  +   SNG+   C    L V + ++  +S  +   +KV +I        A  + K+    +             S     + C ++ W+         +V+ NL+P   Y++Y    AI S + N    SDV    T    PS+   +    +S S+I +TW+    P G +TRY I
Sbjct:  335 NVKPCKSMDIRNMVSHFNQLENCTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNN---CI--DEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQF-DSRCVTANECITLTKFETNSVYSGIPY---NGQCITHCPTGYQKSENKRMCEPCPGGKCDKE-CSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEI---------SGDPPMDADKYALYVLDNRDLDELW----GPNQ-TVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSD--VGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKV-EIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPEKSGVMVLSNLIPYTNYSYYVRTMAISSELTNAE--SDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI 964          

HSP 2 Score: 196.052 bits (497), Expect = 9.093e-50
Identity = 103/220 (46.82%), Postives = 131/220 (59.55%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGE-----------GFVSENQSHLW------AIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELY-ADMNFRNNSYY 4364
            LV+MELM+ GDL  YLR    E             G     Q   +      AI+IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWM PESL  G +S +SD++S+GV+LWE+ TLA+ PY+G+S+  V++YV  GG +      N    L  +M+ CW +    RPSF DII  LE    +  F+  S+Y
Sbjct: 1448 LVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPE--NCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFY 1665          

HSP 3 Score: 101.293 bits (251), Expect = 7.160e-21
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 3
Query: 2496 QVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTIN---TRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSS--NPDYWII-YEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++P N+T+F F  L H+T Y   + AC+     +   S+ L      K++    CS    +   T  K+  D + +  ++        S V++ W+ P  PNG I+ Y + Y+               + +P+ +     +     N      Q +G+  L  L  G Y F+++  +IA  G +T+  H K+     + +   +F +  + +  ++ +LF  VCY  K+K       +++  NP Y  + Y  D WE+ R+++  L    PLG+GSFGMVY+G+LK+      D+            A+KT+N N+T  ER  F++EA  MK+F +YH+V+L G
Sbjct: 1143 ELPPNQTHFVFEKLRHFTRYAIFVVACR-----EEIPSEKLRDTSFKKSL----CSDYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYK---------------LQKPDQVEEKKCIPAADFN------QTAGY--LIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKV--FFWLLGIGLAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLA---PLGQGSFGMVYEGILKSFPPNGVDRE----------CAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLG 1439          
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0084121)

HSP 1 Score: 223.016 bits (567), Expect = 4.097e-58
Identity = 198/660 (30.00%), Postives = 299/660 (45.30%), Query Frame = 3
Query:  216 NEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEY--SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP--------------RGE--------NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGE--GDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEIC-GSECSKKYCGRVLIHSINDFSEAEGCYSI---EDIYISIK-EGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNV-------------SQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAE--AIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII 2051
            N K C+S+DIR   SH + L NCTVIEG L I ++   S    SFP L E+T  ++IY V G  +L   FPNL++IRG  L   YA+V+    +L+ +GL  LR +  GGVRI+ N  LCY  TI+W  I+ ++   + ++       E   + CP               GE        N ++ CW+   CQ  C E C  N   C   D + CC  +CLGGC  +  G+E C+SC+NV  N  C+  C K +Y++ + RC++ +EC+ L+   +        Y   +  C+  C  G Q+++    CE C G +C K+ C   LI S+    E  GC  I   E + ISIK E G+ + D L    + +  I++SL +  +  + SL F +SL  I         +             V DN +L E++      NQ  + I +G V F+ N KLC   I   L           K D  +   SNG+   C    L V + ++  +S  +   +KV +I        A  + K+    +             S     + C ++ W+         +V+ NL+P   Y++Y    AI S + N    SDV    T    PS+   +    +S S+I +TW+    P G +TRY I
Sbjct:  335 NVKPCKSMDIRNMVSHFNQLENCTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNN---CI--DEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQF-DSRCVTANECITLTKFETNSVYSGIPY---NGQCITHCPTGYQKSENKRMCEPCPGGKCDKE-CSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEI---------SGDPPMDADKYALYVLDNRDLDELW----GPNQ-TVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSD--VGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKV-EIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPEKSGVMVLSNLIPYTNYSYYVRTMAISSELTNAE--SDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI 964          

HSP 2 Score: 196.052 bits (497), Expect = 9.093e-50
Identity = 103/220 (46.82%), Postives = 131/220 (59.55%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGE-----------GFVSENQSHLW------AIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELY-ADMNFRNNSYY 4364
            LV+MELM+ GDL  YLR    E             G     Q   +      AI+IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWM PESL  G +S +SD++S+GV+LWE+ TLA+ PY+G+S+  V++YV  GG +      N    L  +M+ CW +    RPSF DII  LE    +  F+  S+Y
Sbjct: 1448 LVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPE--NCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFY 1665          

HSP 3 Score: 101.293 bits (251), Expect = 7.160e-21
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 3
Query: 2496 QVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTIN---TRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSS--NPDYWII-YEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++P N+T+F F  L H+T Y   + AC+     +   S+ L      K++    CS    +   T  K+  D + +  ++        S V++ W+ P  PNG I+ Y + Y+               + +P+ +     +     N      Q +G+  L  L  G Y F+++  +IA  G +T+  H K+     + +   +F +  + +  ++ +LF  VCY  K+K       +++  NP Y  + Y  D WE+ R+++  L    PLG+GSFGMVY+G+LK+      D+            A+KT+N N+T  ER  F++EA  MK+F +YH+V+L G
Sbjct: 1143 ELPPNQTHFVFEKLRHFTRYAIFVVACR-----EEIPSEKLRDTSFKKSL----CSDYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYK---------------LQKPDQVEEKKCIPAADFN------QTAGY--LIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKV--FFWLLGIGLAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLA---PLGQGSFGMVYEGILKSFPPNGVDRE----------CAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLG 1439          
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Match: InR (gene:FBgn0283499 transcript:FBtr0290231)

HSP 1 Score: 223.016 bits (567), Expect = 4.097e-58
Identity = 198/660 (30.00%), Postives = 299/660 (45.30%), Query Frame = 3
Query:  216 NEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEY--SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP--------------RGE--------NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGE--GDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEIC-GSECSKKYCGRVLIHSINDFSEAEGCYSI---EDIYISIK-EGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNV-------------SQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAE--AIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII 2051
            N K C+S+DIR   SH + L NCTVIEG L I ++   S    SFP L E+T  ++IY V G  +L   FPNL++IRG  L   YA+V+    +L+ +GL  LR +  GGVRI+ N  LCY  TI+W  I+ ++   + ++       E   + CP               GE        N ++ CW+   CQ  C E C  N   C   D + CC  +CLGGC  +  G+E C+SC+NV  N  C+  C K +Y++ + RC++ +EC+ L+   +        Y   +  C+  C  G Q+++    CE C G +C K+ C   LI S+    E  GC  I   E + ISIK E G+ + D L    + +  I++SL +  +  + SL F +SL  I         +             V DN +L E++      NQ  + I +G V F+ N KLC   I   L           K D  +   SNG+   C    L V + ++  +S  +   +KV +I        A  + K+    +             S     + C ++ W+         +V+ NL+P   Y++Y    AI S + N    SDV    T    PS+   +    +S S+I +TW+    P G +TRY I
Sbjct:  335 NVKPCKSMDIRNMVSHFNQLENCTVIEGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYALVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGKEKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNN---CI--DEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQF-DSRCVTANECITLTKFETNSVYSGIPY---NGQCITHCPTGYQKSENKRMCEPCPGGKCDKE-CSSGLIDSLERAREFHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSLTEI---------SGDPPMDADKYALYVLDNRDLDELW----GPNQ-TVFIRKGGVFFHFNPKLCVSTINQLLPMLASKPKFFEKSD--VGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKV-EIGEPQKPSNATIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDR-WKVSSPEKSGVMVLSNLIPYTNYSYYVRTMAISSELTNAE--SDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLTRYFI 964          

HSP 2 Score: 196.052 bits (497), Expect = 9.093e-50
Identity = 103/220 (46.82%), Postives = 131/220 (59.55%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGE-----------GFVSENQSHLW------AIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELY-ADMNFRNNSYY 4364
            LV+MELM+ GDL  YLR    E             G     Q   +      AI+IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWM PESL  G +S +SD++S+GV+LWE+ TLA+ PY+G+S+  V++YV  GG +      N    L  +M+ CW +    RPSF DII  LE    +  F+  S+Y
Sbjct: 1448 LVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPE--NCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFY 1665          

HSP 3 Score: 101.293 bits (251), Expect = 7.160e-21
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 3
Query: 2496 QVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTIN---TRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSS--NPDYWII-YEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++P N+T+F F  L H+T Y   + AC+     +   S+ L      K++    CS    +   T  K+  D + +  ++        S V++ W+ P  PNG I+ Y + Y+               + +P+ +     +     N      Q +G+  L  L  G Y F+++  +IA  G +T+  H K+     + +   +F +  + +  ++ +LF  VCY  K+K       +++  NP Y  + Y  D WE+ R+++  L    PLG+GSFGMVY+G+LK+      D+            A+KT+N N+T  ER  F++EA  MK+F +YH+V+L G
Sbjct: 1143 ELPPNQTHFVFEKLRHFTRYAIFVVACR-----EEIPSEKLRDTSFKKSL----CSDYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYK---------------LQKPDQVEEKKCIPAADFN------QTAGY--LIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKV--FFWLLGIGLAFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLA---PLGQGSFGMVYEGILKSFPPNGVDRE----------CAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLG 1439          
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Match: Sdr (gene:FBgn0038279 transcript:FBtr0083004)

HSP 1 Score: 171.014 bits (432), Expect = 8.199e-43
Identity = 186/677 (27.47%), Postives = 299/677 (44.17%), Query Frame = 3
Query:  141 LKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLT---SEYSFPTLK----EITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYN-YAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIV----RQHGAPIKLINMRNFC---------LEFCPNNCPRGENLQKYCWHHNTCQ--------NVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEI-CGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLN--ISD-SSFTVKCHSKVPDISLQNSALTALFMLKET-TKNVSQYELFNSCSEQNW-RTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEI---SDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII 2051
            + IS+   +I L+   +        ++  C S++I K + +  L NCT + G + +A V LT     YS  +L     EI+  L++Y   G  +L   FP L IIRGQ L ++ Y++V+ E  NL  +GLV L  +  G +R+++NP LC+V T++W  ++    RQH + +K    ++ C          EF  N+  R       CW+ NT Q          C  +C  N      +   +CC   C+ GCY +    C  C N      CV +C    Y+   RRCI   EC  L               I    CVK+C PG Q+  +  +  I C  EC+    G   + S  D    + C +I   + I +      + D L  A + +  I   L+++ S+ + SL FL++L  I+G+   +N               V +N +L  I+      N L + I  G++ F+LN +LC EKI   L  ++++   +S  D  +   SNG+   C      V+ LN  + D +S  V+      D     + +   +  KE   +NV+ Y+  + C   NW   V     +  VI  L P  +YA++ + + +R E  ++I   S + Y  T    PS  + +   +  SS+I L W PP  PNG +  Y +
Sbjct:   13 IPISIAVPLILLFLGASSPVLASSDDQTACGSLEINKIADLRKLQNCTHVVGHVRLAYVDLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFS-LKHNRPQSQCPLCGSLSADFEFIRNSSER-------CWNVNTTQLRPQPPRLKDCPIACGLNG----CDSAGKCCDHNCVTGCYSQN---CSLCANYQGRMGCVNQCVA-SYELNKRRCIGHRECRELGRIP----------LIRGYQCVKKC-PGNQKEILVAKGIIHCQVECN----GDFHVKSAADLEVLQDCVTINGSLTIELTNIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKY----------ALYVVNNYHLEHIWPP----NHL-VIIQRGTLFFHLNPRLCYEKIHQ-LQGSLKSGENISVAD--VSPNSNGERVICGDA---VRSLNPKVEDLNSTAVRIILDYMDWEGMETLIGYSYHYKEAPVQNVTMYDGRHGCGHDNWLMDVVPNQSRRHVISGLKPYTQYAYFVKTL-TRTEYHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFV 636          
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Match: insra (insulin receptor a [Source:ZFIN;Acc:ZDB-GENE-020503-3])

HSP 1 Score: 370.548 bits (950), Expect = 7.215e-106
Identity = 333/1150 (28.96%), Postives = 531/1150 (46.17%), Query Frame = 3
Query:  213 SNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPNN------CPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPG-KQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLE------ISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDT-IMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTV-----RVDEVVTNFPST--DISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYY-CKKKYLERTR---WVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +N ++C S DIR   +++ +L NCTVIEG L I ++  T        S+P L  +T  L+++ V G ++L   FPNLT++RG  L +NYA+V+ E   L  IGL +L  +  G VR++ NP LCY++T++W+ I+        + N  +  C + CP        CP      +  + CW+   CQ +C  SC   ++ C  +  ++CCH +CLGGC        CV+C+N + N  CV+KC   FY +K  RC+S S C  L ++          Y I + AC+ +C  G    N  T  C  C   C K   G   + S+       GC  I    +    GG++++  L     +L  I   L +  S ++ SL FLR LRII G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK + +K D  I++ +NGD A C+ + L    ++       +K  +   PD       L  + + KE   KNV++++  ++C   +W         R  EG   +P  +  + P K +  YA  +++++    E       S++IY+ T    PS P++  + + SSS+I L W PP  PNG +T Y+++ +  +    + +  D C    K   R  +Q +N   +  N  + QG  D   C  +C K +  +  + ++T   +  + Y+       NE+            FE++     +++     R    +   PS+  + S    P  E   N    +VQ  A E+    +NL H+T Y  EI AC    N  S  ++               CS  + +SA T P+E  D+I    I   V   SV I W EPK+PNG I+ Y + Y++     EL      CV+R  ++                     G   LR + PG Y  +I+  ++A  G+WT+  HF +    +  +  N   I    +I     L + V +Y  KKK  E      + S NP+Y+    +YE D WE+ R+ + +L     LG+GSFGMVY+G  K++             E Q  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   22 TNGEICSSKDIRNNVTNLRVLENCTVIEGHLKILLMFTTKPEDFRGLSYPKLTVVTDYLLLFRVYGLESLSDLFPNLTVVRGNNLFFNYALVLFEMLQLKEIGLHSLMNITRGAVRVEKNPDLCYLSTLDWSMILDSVEDNYIVANKNDRECGDICPGTVLGKTTCPLTTINGDFSERCWNQKYCQRMCPSSC--KHRACTKD--SQCCHDQCLGGCLEPHSSNKCVACRNFMHNNMCVEKCPHGFYTFKGWRCVSFSFCQELHNKCKQGKGDCHEYVIHNGACIPECPSGYTTVNSTTLNCTPCAGLCPKVCMGLKTVDSVTAAQALRGCTVINGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRHSYALVSLSFLRKLRIIHGETQEVGNYS----------FYALDNQNLRQLWD----WSKHNLTIQQGRMFFHHNSKLCMSEIRR-MEEVTGTKNRQTKND--IVSKTNGDQASCESKVLKFTRISTLSDKIIIKWEAFWPPDF---RDLLGFMVLYKEAPYKNVTEFDGQDACGSNSWVIADVDPPPRATEGKEHEPGYL--IFPLKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQ-QPEASELYKFDYCQKGMKLPTRAPTQVDNEEEQKWNQTEEQGP-DSRCC--ACPKTEKQLKKEAEETEYRKTFENYL------HNEV------------FELRPSRQRRSLVGIANRTSSRLFTTPSSLPNGSATRSPEEEAEANKISLIVQ--AKESTV-ISNLRHFTSYQIEIHAC----NHGSDPTR---------------CSMAAYVSARTMPEEKADDI-VGKITCEVFEYSVHIRWIEPKAPNGMIILYEVHYKRLGDTEELHH----CVSRKNYI-------------------ADGGCKLRVVHPGNYTVRIRATSLAGNGSWTEPTHFYVQ--DLRVDPSNVLKIVIGPVICFFLLLLLCVGFYIVKKKQTEGPTGRLYTSPNPEYFSPDEVYEPDEWEVPREKITLLR---ELGQGSFGMVYEGNGKDIVK----------GESQTRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1062          

HSP 2 Score: 199.904 bits (507), Expect = 3.979e-51
Identity = 101/207 (48.79%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  +LR    + E         L      A +IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWE+ TLA  PY+G+S+  V+++V +GG L      N +  L  +M+ CW YNP  RP+F +II+ L      +F+  S++
Sbjct: 1071 LVVMELMTHGDLKSFLRSLRPDSENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEVSTLAEQPYQGLSNEQVLKFVMEGGYLDRPD--NCADRLHNLMQMCWHYNPKMRPTFQEIIEMLREDLHPSFQEVSFF 1275          
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Match: insrb (insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-020503-4])

HSP 1 Score: 360.918 bits (925), Expect = 1.491e-102
Identity = 329/1149 (28.63%), Postives = 525/1149 (45.69%), Query Frame = 3
Query:  222 KVCQSIDIRK-RSHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPG-KQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSN-GDMAFCKHEKL-IVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKP-VVIDNLLPAKRYAFYAEAIRSRVENWL---EISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIW--YRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQ---NQGECDCDKCMESCNKNQILINIDKDDT-IMQFLDEYITKSFIKQNEI--PKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSS--VKIFWSEPKSPNGFILNYFIRYRKYP--YEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRW---VSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++C S DIR   +++ +L NCTVIEG L I ++  T++      SFP L  +T  L+I+ V G ++LG  FPNLT+IRG  L +NYA+V+ E   +  IGL +L  +  G VRI+ NP+LCY++T++W+ I+        + N  +  C   CP       +C +     N  + CW+ N CQ +C   C     +        CCH +CLGGC   G+   CV+C+N L    CV +C   +Y +K+ RC+S   C +L +Q          Y I + AC+ +C  G    N  +  C  C   C K   G   + S+       GC  +    I    GG+S++  L  +  +L  I   L I ++ ++ SL FLR L +I+G + +  N            F   DN+NL +++D     N+ N+TIL+G + F  N KLC  +IL    +   T TK      R+ ++SN  D ++C+   L   Q+  +SD    ++  S  P  S     L  + + KE   +NV++Y+  ++C   +W         R  EG   +P  +I  L P  +YA   +A  +  E+       +++IY+ T    PS P++  + + SSS+I L W PP  PNG +T YII+   +S +I    F   D C    K      +  +    +  N  +    +G C C     +C K ++ +  + ++T   +  + Y+       NE+  P+ + +    G        +  T     ++ NFP+T I    K          +KMV   +++     +NL H+T Y  EI AC D  +                      CS  + + A T P+   D I E   +         V I W EPK+PNG I+ Y ++Y +    YE ++      CV+R                   I+ +K+  Y LR   PG Y  +++  ++A  G+WT   +F +       E     +I   + I +L  L  +  +  KKK  E        SSNP+Y     +Y  D WE+ R+ + ++     LG+GSFGMVY+G+ K++             E    VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   26 EICPSTDIRNIATNLRVLENCTVIEGHLKILLMFKTTQEDFRGLSFPKLVMVTDYLLIFRVYGLESLGSLFPNLTVIRGSNLFFNYALVMFEMIQMKEIGLHSLTNITRGAVRIEKNPNLCYLSTLDWSKILDSVEDNYIVANKDDLECGNICPGTIAGTISCKQTTINGNFGERCWNQNHCQRICPSECV----HGACTSHKECCHEQCLGGCSVPGNSTKCVACRNFLYGEACVDRCPPGYYTFKSWRCVSLQFCQDLHNQCKDKSGDCHAYVIHNGACIPECPSGYTTVNSTSLTCMPCTGRCPKVCTGVQTVDSVTAAQALRGCTVLNGSLIIKISGGNSIAAELESSLGQLEEITGYLTIRRAYALVSLSFLRKLHLIRGETLDGGNYS----------FHAMDNQNLRQLWD----WNKHNLTILKGRMKFIQNGKLCKSEILRMEQA---TGTK-----NRMNDISNEKDQSYCESHILKFTQIRTMSD-KILIRWESFWP--SDFRDLLGFMVLYKEAPHRNVTEYDGQDACGSNSWAIADVEPPQRPSEGKEVEPGYLIMPLKPWTQYAVMVKAQLAASEDHQVRGAKTEIIYVRTNATRPSVPLDPHSWSNSSSQIILKWKPPSDPNGNITHYIIYCQKQSEDITHYKF---DYCQQGMKVPSHTPTHHDVEEDQKLNQTEVPDQKGHC-C-----ACPKTEMQLKKEAEETEFRKTFENYL------HNEVFEPRPHRRRRSVGVANATLPNFGTT---PTIIPNFPTTSIPEEEKS---------RKMVFKASSKEAMVISNLLHFTSYQIEIHACNDPTDPGR-------------------CSMPTYVKARTLPELKADVIAEPVTHEFFPDEPDVVYIRWKEPKTPNGMIILYEVKYLRMSDNYEDQI------CVSR-------------------ISYEKNHGYRLRVGHPGNYSVRVRATSLAGNGSWTDPAYFYVQD----REMSMKIVIILAICIFLLVILASVGYFVLKKKQTEGPTGPLIASSNPEYISANDVYIPDEWEVPREKITVMR---ELGQGSFGMVYEGIAKDIIK----------GEPDTRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1057          

HSP 2 Score: 196.438 bits (498), Expect = 4.969e-50
Identity = 99/207 (47.83%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    + E         L      + +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V  GG L      N  + +  +M+ CW YNP  RP+F +II+ ++      F+  S++
Sbjct: 1066 LVVMELMTHGDLKSYLRSLRPDAENNPGSPPPTLKEMIQMSAEIADGMAYLNAKKFVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYL--DRPENCPERMHNLMQMCWQYNPKMRPTFHEIIEMIKEDLHPTFQEVSFF 1270          
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Match: igf1rb (insulin-like growth factor 1b receptor [Source:ZFIN;Acc:ZDB-GENE-020503-2])

HSP 1 Score: 338.961 bits (868), Expect = 4.133e-95
Identity = 309/1132 (27.30%), Postives = 504/1132 (44.52%), Query Frame = 3
Query:  270 LTNCTVIEGDLYIAMV--------TLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP--RGENLQ-KYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-----RCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTV------EGYIGKPVVIDNLLPAKRYAFYAEAI------RSRVENWLEI---SDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDD--FFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYR--KYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR----------WVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            L NCTVIEG L I ++         +    SFP L  IT  L+++ V G ++L   FPNL +IRG+ L YNYA+VI E T+L  IGL NLR +  G +RI+ NP LCY+++++W+ I+    A +      N   + C N CP    +N Q   CW  N CQ VC   C +  + C   D  +CCHP+CLG C   + D  C +C+N    GRCV+ C    YK++  RCI+   C   S     DY   D + I    C+  C PG  +++  G      C  C   C  K C   +I S++     +GC  I+ +++I+I+  G++++  L      +  +   ++I  S ++TSL FL+SLR I                + +  F   DN++L  ++D     +Q N+TI EG + F LN KLC  +I     +    K    + D R    +NGD A C  + L     N   +   +   S  P  S     +  +   KE   +N+++++  +SC   +W  V      E  +   VV+  L P  +YA + +A+      R R ++ L +   S+V+Y+ T+   PS P++++  + SSS++ + W PPL PNG  T Y++ ++     G+D   +  + C  + K   R+ +        T   N   G  D   C       + L  I+ D    +  + ++  +        +          F +  V    T+       N    + S    P  E         ++    E + + T L  +T Y  ++ AC   + V+                    CS+ + + + T   E  D+I   ++       SV + W EP  PNG I+ Y I+YR    P + E       CV+R  +                   +K     L +L PG Y  +++  ++A  G+WT+   F +       E  +Y  +  + I+  L  +  LV +     ++ + R          + S NP+Y+   E+   D WE++R+ + M      LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   45 LENCTVIEGYLQILLIGDKNSNNQEVFRTLSFPKLTMITDYLLLFRVSGLESLSTLFPNLAVIRGRNLFYNYALVIFELTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLIL---DAELNNFIDGNKQSKECGNVCPGIMEDNSQCTRCWTSNHCQKVC--RCGQ--RAC--TDSGQCCHPQCLGSCSVPDSDRACAACQNYNHEGRCVEDCPPGTYKFEGWRCITRDFC---SKVHLPDY---DRFVIHAGECMSDCPPGFTRDESHGVSVSMLCTACDGPCD-KICDEKVIDSVDAAQSLKGCTVIKGNLHINIRR-GTNIASELENFLGLIKTVTGYIKIRSSHTLTSLSFLKSLRYI----------HGEELWDNTYAFAALDNQHLQLLWD----WSQHNLTISEGKLYFRLNPKLCMSEIRKMW-AKTGIKDNFVERDFR----NNGDRASCGTKILKFTSNNTRSNQIKLMWESYRPSDS--RDLVNFIVYYKEAPFQNITEFDGQDSCGSDSWNMVDVDLPDEKILNPGVVLSALKPWTQYAIFVKAVTLIVEDRDRDKDRLHLGPQSEVVYIRTKPSAPSMPVDIRAYSNSSSKLVVRWAPPLAPNGNNTYYLLRWKQQ---GEDRELYQHNYCSKELKIPVRVSATGLTDTEDTKPTNHETGGRDKTPCCPCPKTEEDLKRIEDDIYYRKAFENFLHNAIFTPRPPDRRR-----RDLFGVANVTSIHTLLAGH--WNLTEGNFSDDEPPRRE------FSFLERKVKERHIEITGLQPFTVYRIDLHACN--EEVRH-------------------CSAAAFVFSRTKAAEKADDI-PGSVTWEGQEDSVFLKWPEPDKPNGLIMLYEIQYRLGTEPEKHE-------CVSRQHY-------------------RKHKGVKLSNLGPGNYSVRVRATSLAGNGSWTEPIAFSVHQ----LEQSSYDPVMFIAILPALLLIAGLVVF--GYTWMNKNRNNDRLGNGVLYASVNPEYFSAAEMYVPDEWEVEREKITMCR---ELGQGSFGMVYEGIAKGVVK----------DEPETRVAIKTVNESASLHERIEFLNEASVMKEFNCHHVVRLLG 1055          

HSP 2 Score: 202.601 bits (514), Expect = 7.042e-52
Identity = 106/212 (50.00%), Postives = 131/212 (61.79%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL----------WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR           EN S L           A +IADGM YL+  KFVHRDLAARNCM+    I+KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  F+  S++
Sbjct: 1064 LVIMELMTRGDLKSYLRSLRS------VENTSSLPLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFIVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEDLEAGFKETSFF 1267          
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Match: igf1ra (insulin-like growth factor 1a receptor [Source:ZFIN;Acc:ZDB-GENE-020503-1])

HSP 1 Score: 338.961 bits (868), Expect = 5.526e-95
Identity = 316/1152 (27.43%), Postives = 512/1152 (44.44%), Query Frame = 3
Query:  237 IDIRKR-SHVSLLTNCTVIEGDLYIAMV-----TLTSEY----SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIV-RQHGAPIKLINMRNFCLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKC---HSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTV------EGYIGKPVVIDNLLPAKRYAFYAEAIRSRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXX------XXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSS--VKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEW--LNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNY------XXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            IDIR   +    L NCTV+EG L I ++      L  E+    SFP L  +T  ++++ V G  +L + FPNL +IRG+ L YNYA+VI E T+L  IGL NLR +  G +RI+ NP LCY+++++W+ ++  +    I        C + CP       +C R    +N    CW  N CQ VC + C K  + C   D  +CCHP+CLG C   + D+ C +C++     RCV+ C    YK++  RCI+   C  +   S  D      + I +  C+  C PG  +N+     C  C   C  K C    I S++     +GC  I+ ++ I+I+ G +  S+ L      +  +   +RI  + ++ SL FL+SLR I                + +  F   DN NL  ++D      Q N+TI  G + F  N KLC  +I          + K+++ D R    SNG+ A C  E  I++  +    S  +K      + PD       ++ +   KE   +N+++++  + C   +W  V      E  I   V++  L P  +YA + +A+   VE+       S+V+Y+ T    PS P++ +    SSS + + W+PP+ PNG  T Y + W +  E    + +  + C  +        +      +   + +K++     +G C C K  E            +D +  +  + ++  S            +P D    ++  V  N T+ V  V  N  S   S I++P +      F    +   +  + +  NL  +T Y  +I AC                     N     CS+ + + + T P +  D+I  S    R       V + W EP  PNG IL Y I+YR    EAE       CV+R ++  L G                       L +L  G Y  +++  ++A  G+WT+   F +         RNY       II  V+++++L  + V V    KK+  +R      + S NP+Y+  +E+   D WE+ R+ + M      LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   37 IDIRNDITEFKKLENCTVVEGYLQILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNYIAGNKQSKECGDVCPGINEDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEK--RAC--TDAGQCCHPQCLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVD------FVIHNGECMPDCPPGFTRNETQSMFCSACDGLCD-KVCESKTIDSVDAAQSLQGCTVIKGNLQINIRRGNNIASE-LESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYI----------VGEELVDNTYAFHAVDNHNLQYLWD----WTQHNLTIKTGKLYFRFNPKLCMSEIRKMW-EKTSVREKMAEDDVR----SNGERASC--ESYILKFRSNHTQSTRIKLTWERYRPPDY---RDLISFIVYYKEAPFQNITEFDGQDGCGSNSWNMVDVDLPQEKSIDPGVLLSPLKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYIRTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYFLRWQQQAE--DGELYQHNYCSKELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEA------EDRSYRKVFENFLHNSIFTP--------RPPDRKRRDLMGVA-NSTL-VSGVSRNI-SVLESNITQPELPEKEYPFS---EGKVHTEFMEIHNLRPFTVYRIDIHAC---------------------NYEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKGEGIVLLRWPEPLHPNGLILMYEIKYR-LGTEAE----KHECVSRQQYKVLRGAQ---------------------LSNLASGNYSARVRATSLAGNGSWTEPVSFYVPPPK-----RNYDNAFYVAIIIPVIVLLLLLFVIVAVIIVTKKRNSDRIGNGVLYASVNPEYFSPFEMYVPDEWEVAREKITMCR---ELGQGSFGMVYEGIAKGVVK----------DEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLG 1065          

HSP 2 Score: 206.068 bits (523), Expect = 6.371e-53
Identity = 104/207 (50.24%), Postives = 134/207 (64.73%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    + +G  S++   L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ +SD+WS+GV+LWEI TLA  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  FR  S++
Sbjct: 1074 LVIMELMTRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIINSIKEELEPPFREVSFF 1278          
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Match: igf1ra (insulin-like growth factor 1a receptor [Source:ZFIN;Acc:ZDB-GENE-020503-1])

HSP 1 Score: 338.961 bits (868), Expect = 6.109e-95
Identity = 318/1158 (27.46%), Postives = 515/1158 (44.47%), Query Frame = 3
Query:  222 KVC-QSIDIRKR-SHVSLLTNCTVIEGDLYIAMV-----TLTSEY----SFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIV-RQHGAPIKLINMRNFCLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKC---HSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTV------EGYIGKPVVIDNLLPAKRYAFYAEAIRSRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXX------XXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSS--VKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEW--LNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNY------XXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC   IDIR   +    L NCTV+EG L I ++      L  E+    SFP L  +T  ++++ V G  +L + FPNL +IRG+ L YNYA+VI E T+L  IGL NLR +  G +RI+ NP LCY+++++W+ ++  +    I        C + CP       +C R    +N    CW  N CQ VC + C K  + C   D  +CCHP+CLG C   + D+ C +C++     RCV+ C    YK++  RCI+   C  +   S  D      + I +  C+  C PG  +N+     C  C   C  K C    I S++     +GC  I+ ++ I+I+ G +  S+ L      +  +   +RI  + ++ SL FL+SLR I                + +  F   DN NL  ++D      Q N+TI  G + F  N KLC  +I          + K+++ D R    SNG+ A C  E  I++  +    S  +K      + PD       ++ +   KE   +N+++++  + C   +W  V      E  I   V++  L P  +YA + +A+   VE+       S+V+Y+ T    PS P++ +    SSS + + W+PP+ PNG  T Y + W +  E    + +  + C  +        +      +   + +K++     +G C C K  E            +D +  +  + ++  S            +P D    ++  V  N T+ V  V  N  S   S I++P +      F    +   +  + +  NL  +T Y  +I AC                     N     CS+ + + + T P +  D+I  S    R       V + W EP  PNG IL Y I+YR    EAE       CV+R ++  L G                       L +L  G Y  +++  ++A  G+WT+   F +         RNY       II  V+++++L  + V V    KK+  +R      + S NP+Y+  +E+   D WE+ R+ + M      LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   59 EVCGPHIDIRNDITEFKKLENCTVVEGYLQILLIGDKNNNLNQEHFRTLSFPKLTMVTDYILLFRVSGLDSLSVLFPNLNVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSVDWSLLMDAEFNNYIAGNKQSKECGDVCPGINEDRPHCIRTSFNDNYSYRCWTSNHCQKVCPKECEK--RAC--TDAGQCCHPQCLGSCTEADNDKACAACQHYFHEDRCVEACPPDTYKFEGWRCITMEMCARVHLPSEVD------FVIHNGECMPDCPPGFTRNETQSMFCSACDGLCD-KVCESKTIDSVDAAQSLQGCTVIKGNLQINIRRGNNIASE-LESFMGLIQTVTGYVRIKHTHTLGSLSFLKSLRYI----------VGEELVDNTYAFHAVDNHNLQYLWD----WTQHNLTIKTGKLYFRFNPKLCMSEIRKMW-EKTSVREKMAEDDVR----SNGERASC--ESYILKFRSNHTQSTRIKLTWERYRPPDY---RDLISFIVYYKEAPFQNITEFDGQDGCGSNSWNMVDVDLPQEKSIDPGVLLSPLKPWTQYAIFVKAVTLVVEDKHVGGAKSEVVYIRTNASAPSMPLDARAYANSSSSLMVKWSPPIAPNGNKTFYFLRWQQQAE--DGELYQHNYCSKELKIPIRISATSLSDMEGETKPTKSDVAGGEKGCCPCPKTKEDLKAEA------EDRSYRKVFENFLHNSIFTP--------RPPDRKRRDLMGVA-NSTL-VSGVSRNI-SVLESNITQPELPEKEYPFS---EGKVHTEFMEIHNLRPFTVYRIDIHAC---------------------NYEVHRCSAAAFVFSRTKPADKADDIPGSVTQERDEKGEGIVLLRWPEPLHPNGLILMYEIKYR-LGTEAE----KHECVSRQQYKVLRGAQ---------------------LSNLASGNYSARVRATSLAGNGSWTEPVSFYVPPPK-----RNYDNAFYVAIIIPVIVLLLLLFVIVAVIIVTKKRNSDRIGNGVLYASVNPEYFSPFEMYVPDEWEVAREKITMCR---ELGQGSFGMVYEGIAKGVVK----------DEPETRVAIKTVNESASVRERIEFLNEASVMKEFNCHHVVRLLG 1093          

HSP 2 Score: 206.068 bits (523), Expect = 5.435e-53
Identity = 104/207 (50.24%), Postives = 134/207 (64.73%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    + +G  S++   L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ +SD+WS+GV+LWEI TLA  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  FR  S++
Sbjct: 1102 LVIMELMTRGDLKSHLRSLRSKEQGSSSQSLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIINSIKEELEPPFREVSFF 1306          
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Match: INSRR (insulin receptor related receptor [Source:NCBI gene;Acc:100490498])

HSP 1 Score: 460.299 bits (1183), Expect = 5.425e-137
Identity = 405/1434 (28.24%), Postives = 655/1434 (45.68%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLK-----EITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF--CLEFCPNNCPRGE---------NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGD-EMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK-YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQ--------NSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYIG------KPVVIDNLLPAKRYAFYAEAIRSRVEN----WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQ-----FLDE--YITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYT---LRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRR-KFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +C S+DIR   S    L NCTVI+G+L I ++  T    F  L+      IT  L+++ V G ++L   FPNL+IIRG  L ++Y++VI E  +L  IGL +L  ++ G VRI+ N  LC+++TI+W S++ +      ++  +    C + CP     GE         N++  CW   +CQ VC     K +  C  ++   CCHPECLGGC   GD   CV+C+N   + +C+  C    ++Y+  RCI E+ C NL  +S         + I ++ C+ +C  G  +N  +  C  C   C K    G  +I S+    E  GC +IE   I     G +L+  L ++   +  I   L+I  S ++ SL F ++L++I+G++    N              + DN+NL++++  +      +++I  G + F  N KLC  +I   +     T+ + +K D  I   +NGD A C       +  NI    F V   ++   I+L+        +  L+ +   KE+  +N+++Y   ++C   +W  V+  +         V + NL P  +YA Y  AI    E     +   SDV+Y+ T    P+ P ++   + SSS + + W PP   NG +T Y++ ++ + +   + ++ + C   +K  +   S ++ R    +NGNQ+  +   DKC   C K+  L + + D+   Q     FL    +I K+  ++ ++P  N  P   G+  + +   + T+       N    D    SKP          +MV           +NL H+TEY  +I AC     +                   + CS+ + + A T      DNI  +        +++ + W EPK+PNG IL Y I+Y++                        N+V +       +++Q+   Y    L  L+PG Y  +I+  ++A  G+WT+   F I             ++ ++                     L  +R+  ++     +Y  D WE  R+++ +++    LG+GSFGMVY+GV K++            +E    VA+KT+N  +T  ER EF+NEA  MK F  +H+V+L G+VS+   + +  +   R   K +  S+    + P++                  +I    ID +     G+  A +      +P              YL             NQ  L      A +IADGM YL+  KFVHRDLAARNCM++  L +KIGDFGM RD+Y   YYRK  K  LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+GM++  V+ +V   G L      N    L  +M  CW  NP  RPSF  I++ ++     +F+  S+
Sbjct:   31 ICGSMDIRNDVSQFRKLENCTVIQGNLQILLMFSTKPEDFRGLRFERLTMITEYLLLFRVYGLESLRDLFPNLSIIRGTDLFFHYSLVIFEMPHLRDIGLYSLTNILNGAVRIERNQELCHISTIDW-SLLSESVENNYIVGNKPVEECADVCPGIRDSGESCIKTPINGNMESRCWTSTSCQKVCP---CKEDIAC--SNTGECCHPECLGGCNKAGDPRACVACRNFYIDDQCLPSCPPGTFEYEGWRCIEEAYCGNLLKESENS--ESTKFVIFENRCLSECPSGYTRNDSSIFCHKCEGLCPKTCKAGNKVIDSLEAAKELTGCTNIEGNLILNIRRGHNLASELQQSLGLIETITGFLKIKHSFALVSLSFFKNLKLIRGDTMVDGNY----------TLYILDNQNLLQLWTPE------SLSIPVGKLYFAFNPKLCLSEIY-HMEEITGTRGRQNKAD--INPRTNGDQASC-------ESCNIRPLRF-VSNWTEADRINLKWERYQPPGHDLLSFVVHYKESPFQNITEYLGQDACGANSWNVVDVELPLNNEQEPSVTLTNLKPWVQYAIYVRAITLTAEENGRKFGAQSDVVYIRTRPAAPTVPQDVMIMSNSSSHLIVRWKPPTQRNGNLTYYLVLWQQM-VEDKELYLNNYC---TKGLKLPTSSADTRFDNDDNGNQDPNQDTEDKCC-PCQKDGGL-HPEMDEGSFQKKFENFLRNTIFIPKAPKRRRDVPGMN--PEVLGNASLPEGTVSHTI-------NHTGVD----SKPYSYKDKVFLNRMV----------ISNLRHFTEYRIDIHACNHAAEI-------------------VGCSAATFVFARTMQDPLADNIVGNITWEVTAKNAILMKWEEPKNPNGLILKYEIKYKR------------------------NMVCEGPPTVVCVSRQQFQRYKGVHLTLLQPGNYSARIRATSLAGNGSWTEPMVFFILGPGKLVTPGTLKVLNSLPHPTS----------------LNLSRYHPTHVLCTTVYVPDEWEFPRENITIIK---ELGQGSFGMVYEGVAKDIVK----------NEPVTRVALKTVNELATTRERIEFLNEASVMKAFLCHHVVRLLGVVSQGQPALVIMELMTRGDLKSYLRSLRPDEEVPIH-----------------GQIVAADIDPLDG--LGNLSARVGAETTAIP------------DRYLNNH--------PGNQPSLKRMIQMAGEIADGMAYLTAKKFVHRDLAARNCMVSEDLTVKIGDFGMTRDIYETDYYRKGGKSLLPVRWMSPESLKDGIFTTYSDVWSFGVVLWEIATLAEQPYQGMANEQVLHFVIDNGIL--EKPENCPDRLHELMRWCWQKNPKHRPSFIQILESIKDELPTSFQQVSF 1287          
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 346.665 bits (888), Expect = 1.491e-97
Identity = 322/1151 (27.98%), Postives = 510/1151 (44.31%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE------YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP---RGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK---YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKP-VVIDNLLPAKRYAFYAEAIRSRVE---NWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDE-------YITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYC---KKKYLE---RTRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            K+C S+DIR   S  S+L +CTVIEG L I ++  TS+        FP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  IGL NL  +  G VRI+ N  LCY++TI+W+ I+         +N  N   E C + CP   +G++  K           CW  + CQ VC   C  +   C  +   +CCH ECLG C    D   C +C++    G C+  C +  Y+++  RCI  + C  + ++          Y I    C+  C  G   N  T  C  C   C K    Y     I S+    E  GC  +    I    GG++++  L      +  I   L+I +S ++ SL F R LR+I+G      N            F   DN +L +++D     ++ N+TI+ G + F+ N +LC  +I   +     TK +  K D  I   +NGD A C+   L    +  S     +K     P        L  +   KE   +NV++++  ++C   +W         R+ +G    P  ++ NL P  +YA + + + S  +    +   S +IY+ T    PS P++  + + S+S+I L W PP  PNG VT Y+++++  +    + +  D C   +K  +              NGN NQ +    KC   C K    I  ++D++  +   E       +I +   K+ E+            F +        V    +  N  ST     ++P I +    FK+ + V         T L H+T Y  EI AC                     + L++ CS  + +SA T P+   DN+        +  + + + W EPK PNG I+ Y + Y +     E+      CV++ ++   T+  AK                 LR L PG Y  +I+  ++A  G+WT+  +F++       ++ +  I+  V   +I   L + V  YC   KKK  E      + SSNP+Y    E+   D WE+ R  + +L     LG+GSFGMVY+G+ K++             E ++ VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   43 KICPSMDIRNNISQFSMLEDCTVIEGHLQI-LLMFTSKPENFRGLRFPKLTMITDYLLLFRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILDSVEDNYIELNRDN--KEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSECKGSG--CLPD--GQCCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEVLEAGNYS----------FYALDNPSLRQLWD----WHKHNLTIIHGKLFFHHNPRLCLAEIHQ-MEEVTGTKGRQDKND--ISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWP--PDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPGCLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLVYWQE-QPEDSELYELDYC---NKGLKLPSRTWTPPSDIEENGNINQTDQPSSKCC-PCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRREL------------FGVANGTLPDPVTAPSLF-NASSTRAPDETEPKIYSQKVWFKESLMV---------TGLKHFTGYRIEIHACN--------------------HELSMGCSVAAYVSARTMPEATADNVVGPITYEYIEPNIIHLKWQEPKDPNGLIVLYEVHYSRVGGTEEV----ISCVSQKQY--STDKGAK-----------------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQVP------DHPHSSIVKIVTGPVIAVILLLFVLVYCVIQKKKDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIIK----------GEPEVRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1078          

HSP 2 Score: 200.675 bits (509), Expect = 3.229e-51
Identity = 102/207 (49.28%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E         L      A +I+DGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GGSL      N    L  +M+ CW YNP  RP+F +II  L+    ++F+  S+Y
Sbjct: 1087 LVIMELMTHGDLKSYLRSLRPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGSL--DQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLSFQEVSFY 1291          
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 345.895 bits (886), Expect = 1.800e-97
Identity = 324/1152 (28.12%), Postives = 510/1152 (44.27%), Query Frame = 3
Query:  219 EKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE------YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP---RGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK---YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKP-VVIDNLLPAKRYAFYAEAIRSRVE---NWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDE-------YITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYC---KKKYLERT---RWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            E  C S+DIR   S  S+L +CTVIEG L I ++  TS+        FP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  IGL NL  +  G VRI+ N  LCY++TI+W+ I+         +N  N   E C + CP   +G++  K           CW  + CQ VC   C  +   C  +   +CCH ECLG C    D   C +C++    G C+  C +  Y+++  RCI  + C  + ++          Y I    C+  C  G   N  T  C  C   C K    Y     I S+    E  GC  +    I    GG++++  L      +  I   L+I +S ++ SL F R LR+I+G      N            F   DN +L +++D     ++ N+TI+ G + F+ N +LC  +I   +     TK +  K D  I   +NGD A C+   L    +  S     +K     P        L  +   KE   +NV++++  ++C   +W         R+ +G    P  ++ NL P  +YA + + + S  +    +   S +IY+ T    PS P++  + + S+S+I L W PP  PNG VT Y+++++  +    + +  D C   +K  +              NGN NQ +    KC   C K    I  ++D++  +   E       +I +   K+ E+            F +        V    +  N  ST     ++P I +    FK+ + V         T L H+T Y  EI AC                     + L++ CS  + +SA T P+   DN+        +  + + + W EPK PNG I+ Y + Y +     E+      CV++ ++   T+  AK                 LR L PG Y  +I+  ++A  G+WT+  +F++       ++RN  I+  V   +I   L + V  YC   KKK  E      + SSNP+Y    E+   D WE+ R  + +L     LG+GSFGMVY+G+ K++             E ++ VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:    5 ELFCPSMDIRNNISQFSMLEDCTVIEGHLQI-LLMFTSKPENFRGLRFPKLTMITDYLLLFRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILDSVEDNYIELNRDN--KEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSECKGSG--CLPD--GQCCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEVLEAGNYS----------FYALDNPSLRQLWD----WHKHNLTIIHGKLFFHHNPRLCLAEIHQ-MEEVTGTKGRQDKND--ISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWP--PDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPGCLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLVYWQE-QPEDSELYELDYC---NKGLKLPSRTWTPPSDIEENGNINQTDQPSSKCC-PCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRREL------------FGVANGTLPDPVTAPSLF-NASSTRAPDETEPKIYSQKVWFKESLMV---------TGLKHFTGYRIEIHACN--------------------HELSMGCSVAAYVSARTMPEATADNVVGPITYEYIEPNIIHLKWQEPKDPNGLIVLYEVHYSRVGGTEEV----ISCVSQKQY--STDKGAK-----------------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQVP------DHRN-SIVKIVTGPVIAVILLLFVLVYCVIQKKKDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIIK----------GEPEVRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1040          

HSP 2 Score: 201.06 bits (510), Expect = 2.520e-51
Identity = 102/207 (49.28%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E         L      A +I+DGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GGSL      N    L  +M+ CW YNP  RP+F +II  L+    ++F+  S+Y
Sbjct: 1049 LVIMELMTHGDLKSYLRSLRPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGSL--DQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLSFQEVSFY 1253          
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 342.428 bits (877), Expect = 1.974e-96
Identity = 314/1149 (27.33%), Postives = 498/1149 (43.34%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE------YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP---RGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK---YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKP-VVIDNLLPAKRYAFYAEAIRSRVE---NWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDE-------YITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS-----DSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +C S+DIR   S  S+L +CTVIEG L I ++  TS+        FP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  IGL NL  +  G VRI+ N  LCY++TI+W+ I+         +N  N   E C + CP   +G++  K           CW  + CQ VC   C  +   C  +   +CCH ECLG C    D   C +C++    G C+  C +  Y+++  RCI  + C  + ++          Y I    C+  C  G   N  T  C  C   C K    Y     I S+    E  GC  +    I    GG++++  L      +  I   L+I +S ++ SL F R LR+I+G      N            F   DN +L +++D     ++ N+TI+ G + F+ N +LC  +I   +     TK +  K D  I   +NGD A C+   L    +  S     +K     P        L  +   KE   +NV++++  ++C   +W         R+ +G    P  ++ NL P  +YA + + + S  +    +   S +IY+ T    PS P++  + + S+S+I L W PP  PNG VT Y+++++  +    + +  D C   +K  +              NGN NQ +    KC   C K    I  ++D++  +   E       +I +   K+ E+            F +        V    +  N  ST     ++P I +    FK+ + V         T L H+T Y  EI AC                     + L++ CS  + +SA T P+   DN+        +  + + + W EPK PNG I+ Y + Y +     E+      CV++ ++   T+  AK                 LR L PG Y  +I+  ++A  G+WT+  +F++        SI   Y                       +Y   +      + SSNP+Y    E+   D WE+ R  + +L     LG+GSFGMVY+G+ K++             E ++ VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   20 ICPSMDIRNNISQFSMLEDCTVIEGHLQI-LLMFTSKPENFRGLRFPKLTMITDYLLLFRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILDSVEDNYIELNRDN--KEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSECKGSG--CLPD--GQCCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEVLEAGNYS----------FYALDNPSLRQLWD----WHKHNLTIIHGKLFFHHNPRLCLAEIHQ-MEEVTGTKGRQDKND--ISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWP--PDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPGCLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLVYWQE-QPEDSELYELDYC---NKGLKLPSRTWTPPSDIEENGNINQTDQPSSKCC-PCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRREL------------FGVANGTLPDPVTAPSLF-NASSTRAPDETEPKIYSQKVWFKESLMV---------TGLKHFTGYRIEIHACN--------------------HELSMGCSVAAYVSARTMPEATADNVVGPITYEYIEPNIIHLKWQEPKDPNGLIVLYEVHYSRVGGTEEV----ISCVSQKQY--STDKGAK-----------------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQVPDHLNTYPSIMCMY----------------------FFYRDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIIK----------GEPEVRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1037          

HSP 2 Score: 201.06 bits (510), Expect = 2.595e-51
Identity = 102/207 (49.28%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E         L      A +I+DGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GGSL      N    L  +M+ CW YNP  RP+F +II  L+    ++F+  S+Y
Sbjct: 1046 LVIMELMTHGDLKSYLRSLRPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGSL--DQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLSFQEVSFY 1250          
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Match: INSR (insulin receptor [Source:NCBI gene;Acc:100492718])

HSP 1 Score: 341.658 bits (875), Expect = 4.172e-96
Identity = 314/1148 (27.35%), Postives = 497/1148 (43.29%), Query Frame = 3
Query:  228 CQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE------YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP---RGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK---YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKP-VVIDNLLPAKRYAFYAEAIRSRVE---NWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDE-------YITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS-----DSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            C S+DIR   S  S+L +CTVIEG L I ++  TS+        FP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  IGL NL  +  G VRI+ N  LCY++TI+W+ I+         +N  N   E C + CP   +G++  K           CW  + CQ VC   C  +   C  +   +CCH ECLG C    D   C +C++    G C+  C +  Y+++  RCI  + C  + ++          Y I    C+  C  G   N  T  C  C   C K    Y     I S+    E  GC  +    I    GG++++  L      +  I   L+I +S ++ SL F R LR+I+G      N            F   DN +L +++D     ++ N+TI+ G + F+ N +LC  +I   +     TK +  K D  I   +NGD A C+   L    +  S     +K     P        L  +   KE   +NV++++  ++C   +W         R+ +G    P  ++ NL P  +YA + + + S  +    +   S +IY+ T    PS P++  + + S+S+I L W PP  PNG VT Y+++++  +    + +  D C   +K  +              NGN NQ +    KC   C K    I  ++D++  +   E       +I +   K+ E+            F +        V    +  N  ST     ++P I +    FK+ + V         T L H+T Y  EI AC                     + L++ CS  + +SA T P+   DN+        +  + + + W EPK PNG I+ Y + Y +     E+      CV++ ++   T+  AK                 LR L PG Y  +I+  ++A  G+WT+  +F++        SI   Y                       +Y   +      + SSNP+Y    E+   D WE+ R  + +L     LG+GSFGMVY+G+ K++             E ++ VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   28 CPSMDIRNNISQFSMLEDCTVIEGHLQI-LLMFTSKPENFRGLRFPKLTMITDYLLLFRVYGLESLKDLFPNLTVIRGTHLFFNYALVIFEMVHLKEIGLYNLMNITRGSVRIEKNNELCYLSTIDWSIILDSVEDNYIELNRDN--KEECGDVCPGAGKGKSKCKQIVVNGAFIERCWTQDHCQTVCPSECKGSG--CLPD--GQCCHSECLGSCRKPNDPTECTACRHYQYQGVCISACPEGSYRFQGWRCIDFNTCQEMHNRCPNKENSCPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIYQSVKTIDSVTSAQELRGCTVVNGSLIINIRGGNNIATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGEVLEAGNYS----------FYALDNPSLRQLWD----WHKHNLTIIHGKLFFHHNPRLCLAEIHQ-MEEVTGTKGRQDKND--ISTKTNGDQASCEDNLLNFNFIRTSHDMVLLKWDPYWP--PDYRDLLGFMVHYKEAPYQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTLSPGCLLRNLKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKWKPPSEPNGNVTHYLVYWQE-QPEDSELYELDYC---NKGLKLPSRTWTPPSDIEENGNINQTDQPSSKCC-PCPKTDFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRREL------------FGVANGTLPDPVTAPSLF-NASSTRAPDETEPKIYSQKVWFKESLMV---------TGLKHFTGYRIEIHACN--------------------HELSMGCSVAAYVSARTMPEATADNVVGPITYEYIEPNIIHLKWQEPKDPNGLIVLYEVHYSRVGGTEEV----ISCVSQKQY--STDKGAK-----------------LRVLTPGNYSVKIRATSLAGNGSWTEPAYFQVPDHLNTYPSIMCMY----------------------FFYRDAEGPVGPLYASSNPEYLSASEVYIPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIIK----------GEPEVRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1044          

HSP 2 Score: 201.06 bits (510), Expect = 2.717e-51
Identity = 102/207 (49.28%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E         L      A +I+DGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GGSL      N    L  +M+ CW YNP  RP+F +II  L+    ++F+  S+Y
Sbjct: 1053 LVIMELMTHGDLKSYLRSLRPDAENNPGRPAPTLKEMIQMAAEISDGMAYLNAKKFVHRDLAARNCMVAEDYTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTFSDVWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGSL--DQPENCPPRLHSLMQMCWQYNPKMRPTFLEIIDMLKDDLHLSFQEVSFY 1257          
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Match: Insr (insulin receptor [Source:MGI Symbol;Acc:MGI:96575])

HSP 1 Score: 353.984 bits (907), Expect = 3.622e-100
Identity = 327/1161 (28.17%), Postives = 519/1161 (44.70%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV---------------VIDNLLPAKRYAFYAEAIRS---RVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCN----KNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +G+CV+ C   +Y +++ RC++ S C +L  +     +   H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R L +I+G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P                ++  L P  +YA + + + +       +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C    K  +      +      ++   NQ E D D   E C+     +QIL  +++      F D      F+ +   P    + ++         E          + +FP  ++S+   P+ +     F+K+V    N+     + L H+T Y  E+QAC    N  S + +               CS  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +++  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   33 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPK-VCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYS----------FYALDNQNLRQLWD----WSKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAE--DSELFELDYCL---KGLKLPSRTWSPPFESDDSQKHNQSEYD-DSASECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPR---PSRKRRSLE---------EVGNVTATTLTLPDFP--NVSSTIVPTSQEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDSPDER---------------CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLR---ELGQGSFGMVYEGNAKDIIK----------GEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1081          

HSP 2 Score: 193.356 bits (490), Expect = 4.574e-49
Identity = 97/207 (46.86%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAI-----QIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  +LR    + E         L  +     +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + L  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1090 LVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPD--NCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1294          
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Match: Insrr (insulin receptor-related receptor [Source:MGI Symbol;Acc:MGI:1346037])

HSP 1 Score: 325.094 bits (832), Expect = 7.493e-91
Identity = 300/1152 (26.04%), Postives = 492/1152 (42.71%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIA-MVTLTSE----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP-----RGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK-YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVE-----GYIGKP-VVIDNLLPAKRYAFYAEAI----RSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQ-----FLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKK--MVQVPANETYFK------------FTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS-DSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC S+DIR   + +  L NC+V+EG L I  M   T E     SFP L ++T  L+++ V G ++L   FPNLT+IRG  L   YA++I E  +L  +GL +L  V+ G VR++ N  LC+++TI+W  +     AP     + N   E C + CP      GE   +          CW  + CQ VC   C +        D   CCH ECLGGC   E    CV+C+++   G C++ C    Y+Y++ RC++   C +L             + I + +C+ QC PG  +N  +  C  C   C K+   G   I S+    +  GC  +E   I     G +L   L +    +  I   L+I  S ++ +L F ++L++I             +  + +    V DN+NL ++     A     +TI  G + F  N +LC E I   L     T+ + SK +  I   +NGD A C+   L   V N+++    +    +   +  ++     ++  +   +N +++   ++C  Q+W  ++         +P V +  L P  +YA +  AI         +    S ++YL T    P+ P ++ + + SSS + + W PP+  NG +T Y++ ++ L   G D ++ D C    +          +R          QG C C    +     Q L  ++  +   Q     FL   IT        IPK+ WK                               +++I+K    +   H ++  ++++  N + F+             + L H+TEY  +I AC    +                    + CS+ + + A T P    D I           SSV + W EP  PNG IL Y I+YR+   EA     +  CV+R                   +   K G   L  L PG Y  +++  ++A  G+WT    F I+  +   T     F+    V  ++L  L  L  +Y +K+    T + S NP+Y+    +Y  D WE+ R+ + ++     LG+GSFGMVY+G+ + L             E+   VA+KT+N  ++  ER EF+ EA  MK F+ +H+V+L G
Sbjct:   28 EVCPSLDIRSEVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLL---QPAPGTNHIVGNKLGEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVC--PCPRGMACTAGGD---CCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGL----ATTFGIYEGSCLAQCPPGFTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLI----------RGDSMVDGNYTLYVLDNQNLQQLGSWVTA----GLTIPVGKIYFAFNPRLCLEHIYQ-LEEVTGTRGRQSKAE--INPRTNGDRAACQTRTLRF-VFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDG-DLYINDYCHRGLRLPTSSHDTRFDREDPALEAEPEQGCCPC----QHSPPGQALPALEAQEVTFQKKFENFLHHAIT--------IPKAPWK-------------------------------VTSINKNPQRDSERHRREAGLLRLGKNNSDFEIQEDKVPRERAILSGLRHFTEYRIDIHACNHAAH-------------------TVGCSAATFVFARTMPHREADGIPGKVAWKAAGKSSVTLHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSR-------------------LRYAKVGGVHLALLPPGNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGGMRIFLTVTPVGFMLLVTLAALGFFYSRKR--NSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIR---ELGQGSFGMVYEGLARGLEA----------GEESTPVALKTVNELASARERVEFLKEASVMKAFKCHHVVRLLG 1047          

HSP 2 Score: 196.438 bits (498), Expect = 5.567e-50
Identity = 103/207 (49.76%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    E E      Q  L      A +IADGM YL+  KFVHRDLAARNCM++    +KIGDFGM RDVY   YYRK  KG LPVRWMAPESL  G F+  SD+WS+GV+LWEI+TLA  PY+G+S+  V+++V  GG L      N    L  +M  CW ++P  RP+F  I+ +++     +FR  S+Y
Sbjct: 1056 LVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELE--NCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPSFRLCSFY 1260          
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Match: Insrr (insulin receptor-related receptor [Source:MGI Symbol;Acc:MGI:1346037])

HSP 1 Score: 325.094 bits (832), Expect = 7.493e-91
Identity = 300/1152 (26.04%), Postives = 492/1152 (42.71%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIA-MVTLTSE----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCP-----RGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKK-YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVE-----GYIGKP-VVIDNLLPAKRYAFYAEAI----RSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQ-----FLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKK--MVQVPANETYFK------------FTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS-DSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC S+DIR   + +  L NC+V+EG L I  M   T E     SFP L ++T  L+++ V G ++L   FPNLT+IRG  L   YA++I E  +L  +GL +L  V+ G VR++ N  LC+++TI+W  +     AP     + N   E C + CP      GE   +          CW  + CQ VC   C +        D   CCH ECLGGC   E    CV+C+++   G C++ C    Y+Y++ RC++   C +L             + I + +C+ QC PG  +N  +  C  C   C K+   G   I S+    +  GC  +E   I     G +L   L +    +  I   L+I  S ++ +L F ++L++I             +  + +    V DN+NL ++     A     +TI  G + F  N +LC E I   L     T+ + SK +  I   +NGD A C+   L   V N+++    +    +   +  ++     ++  +   +N +++   ++C  Q+W  ++         +P V +  L P  +YA +  AI         +    S ++YL T    P+ P ++ + + SSS + + W PP+  NG +T Y++ ++ L   G D ++ D C    +          +R          QG C C    +     Q L  ++  +   Q     FL   IT        IPK+ WK                               +++I+K    +   H ++  ++++  N + F+             + L H+TEY  +I AC    +                    + CS+ + + A T P    D I           SSV + W EP  PNG IL Y I+YR+   EA     +  CV+R                   +   K G   L  L PG Y  +++  ++A  G+WT    F I+  +   T     F+    V  ++L  L  L  +Y +K+    T + S NP+Y+    +Y  D WE+ R+ + ++     LG+GSFGMVY+G+ + L             E+   VA+KT+N  ++  ER EF+ EA  MK F+ +H+V+L G
Sbjct:   28 EVCPSLDIRSEVTELRRLENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLTVIRGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLL---QPAPGTNHIVGNKLGEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVC--PCPRGMACTAGGD---CCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCAHLREVPGL----ATTFGIYEGSCLAQCPPGFTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQATQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNLKLI----------RGDSMVDGNYTLYVLDNQNLQQLGSWVTA----GLTIPVGKIYFAFNPRLCLEHIYQ-LEEVTGTRGRQSKAE--INPRTNGDRAACQTRTLRF-VFNLTEEDRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNITYYLVLWQRLAEDG-DLYINDYCHRGLRLPTSSHDTRFDREDPALEAEPEQGCCPC----QHSPPGQALPALEAQEVTFQKKFENFLHHAIT--------IPKAPWK-------------------------------VTSINKNPQRDSERHRREAGLLRLGKNNSDFEIQEDKVPRERAILSGLRHFTEYRIDIHACNHAAH-------------------TVGCSAATFVFARTMPHREADGIPGKVAWKAAGKSSVTLHWLEPPDPNGLILKYEIKYRRLGEEA-----TVLCVSR-------------------LRYAKVGGVHLALLPPGNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGGMRIFLTVTPVGFMLLVTLAALGFFYSRKR--NSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIR---ELGQGSFGMVYEGLARGLEA----------GEESTPVALKTVNELASARERVEFLKEASVMKAFKCHHVVRLLG 1047          

HSP 2 Score: 196.438 bits (498), Expect = 5.567e-50
Identity = 103/207 (49.76%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    E E      Q  L      A +IADGM YL+  KFVHRDLAARNCM++    +KIGDFGM RDVY   YYRK  KG LPVRWMAPESL  G F+  SD+WS+GV+LWEI+TLA  PY+G+S+  V+++V  GG L      N    L  +M  CW ++P  RP+F  I+ +++     +FR  S+Y
Sbjct: 1056 LVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLAAKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELE--NCPIQLQELMRLCWQHSPRLRPTFVHILDRIQDELRPSFRLCSFY 1260          
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Match: Igf1r (insulin-like growth factor I receptor [Source:MGI Symbol;Acc:MGI:96433])

HSP 1 Score: 271.937 bits (694), Expect = 1.889e-73
Identity = 210/670 (31.34%), Postives = 329/670 (49.10%), Query Frame = 3
Query:  156 IFNIINLYQAITFTDSFKLSNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEYS---FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINM-RNFCLEFCPNNCPRGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCG-----RVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYI-----GKP-VVIDNLLPAKRYAFYAEAIR-SRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYR 2060
            ++ ++ L  A++    +  S E     IDIR     +  L NCTVIEG L+I +++   +Y    FP L  IT  L+++ V G ++LG  FPNLT+IRG  L YNYA+VI E TNL  IGL NLR +  G +RI+ N  LCY++TI+W+ I+        + N     C + CP         +K          CW  N CQ +C   C K  + C  N  N CCHPECLG C+   D   CV+C++    G CV  C    Y+++  RC+    C N+ +  S+D    D + I DD C+++C  G  +N      C  C   C  K CG        I S+      +GC  ++ ++ I+I+ G +  S+ L      + ++   ++I  S ++ SL FL++LR+I G    + N            F V DN+NL +++D     N  N+T+  G + F  N KLC  +I   +     TK + SK D  I   +NG+ A C+ + L         +   +  H   P       + T  +  KE   KNV++Y+  ++C   +W  V+  +     G+P +++  L P  +YA Y +A+  + VEN       S+++Y+ T    PS P+++ + + SSS++ + WNPP  PNG ++ YI+ W R
Sbjct:   13 LWGLVFLSAALSL---WPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGDLCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGK--RACTEN--NECCHPECLGSCHTPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSD---SDGFVIHDDECMQECPSGFIRNSTQSMYCIPCEGPCP-KVCGDEEKKTKTIDSVTSAQMLQGCTILKGNLLINIRRGNNIASE-LENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS----------FYVLDNQNLQQLWD----WNHRNLTVRSGKMYFAFNPKLCVSEIYR-MEEVTGTKGRQSKGD--INTRNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYY--KEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQR 651          

HSP 2 Score: 201.06 bits (510), Expect = 2.142e-51
Identity = 104/208 (50.00%), Postives = 133/208 (63.94%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEG----FVSENQSHL--WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    E E      +  + S +   A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   + +F+  S+Y
Sbjct: 1077 LVIMELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIIGSIKDEMEPSFQEVSFY 1282          

HSP 3 Score: 118.627 bits (296), Expect = 3.672e-26
Identity = 95/335 (28.36%), Postives = 158/335 (47.16%), Query Frame = 3
Query: 2526 FTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
             +NL  +T Y  +I +C       + E++ L             CS+ + + A T P E  D+I           +S+ + W EP++PNG IL Y I+Y     +         CV+R E+                   +K G   L  L PG Y  +I+  +++  G+WT    F + + + +  + +  I   V I++I+  L +++  + +K+   R      + S NP+Y+    +Y  D WE+ R+ + M   N  LG+GSFGMVY+GV K +            DE +  VA+KT+N  +++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:  791 ISNLRPFTLYRIDIHSC-------NHEAEKLG------------CSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQR------ECVSRQEY-------------------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITM---NRELGQGSFGMVYEGVAKGVVK----------DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG 1068          
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Match: Ros1 (Ros1 proto-oncogene [Source:MGI Symbol;Acc:MGI:97999])

HSP 1 Score: 184.111 bits (466), Expect = 5.064e-46
Identity = 93/209 (44.50%), Postives = 131/209 (62.68%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL----WAIQIADGMLYLSEMKFVHRDLAARNCMIN-----SLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSY 4361
            +I+ELME GDL  YLRK    G  F   + + L      + I+ G +YL +M F+HRDLAARNC+++     S  ++KIGDFG+AR++Y + YYRK  +G LPVRWMAPE+L+ G F+  SD+WS+G+++WEILTL   PY   S+ DV+ YV  GG L      N    L  +M  CW   PD RP+F +I  +L+L+ ++   N S+
Sbjct: 1996 IILELMEGGDLLSYLRKA--RGTTFHGPSLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKIGDFGLAREIYKNDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEILTLGHQPYPAHSNLDVLNYVQAGGRL--EPPRNCPDDLWNLMSQCWAQEPDQRPTFHNIQNQLQLFRNVFLNNVSH 2200          
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Match: sp|Q25410|MIPR_LYMST (Putative molluscan insulin-related peptide(s) receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.835e-109
Identity = 332/1128 (29.43%), Postives = 516/1128 (45.74%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRRE-DHYAIEDDACVKQCSPG-----KQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNS---CSEQNWRTVEGYIGKPVVID------NLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFI--KQNEIPKSNWKPVDSGHF-EIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVN---GSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKI--SSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYW---IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            VC S+DIR    +  LL NCTVIEG L I++  L +      SFP L+EIT  L++Y V G +TL   FPNL IIRG+ L  +YA+V+ E  +L  +GLVNLR +  GGVR+  N  LCY+ TINWT I        + IN +    E CPN+C + E   K CW ++ CQ   +  C K N YC  N    CCH  CLGGC      + C SCK V  N  C  +C    YK+ NRRC+++ EC+ L++    +  +  D    E   C+  C         + NK   +C  C   C K+ C  + I++I D  + + C  I          GS+++  L K+   +  +  ++ I +S ++ +L F ++L+II     +    E  +         + DN NL E+F E+       + IL G +  + N +LCP  I  FL     +   LS+    I ++SNG    C+   L V V  I+ ++  +  +    D   +   LT +   KE     +   +F     CS   W T E    +    D      +L P   YA Y +A          +++++  TT   +PS+P +L   +    E+R++W PP +PNG +T Y I Y  LE+    +   + C      Q++ +        K  N + N   C C K  E  +         +   I  + ++Y+ K     + +++P       D  +  ++ ++ YN +   D +   FP+  I   S   + NLT   K++V     E      NL H++EY  E+ ACQD                 ++ VL+  CS +++    T      D INE+T++T +      +V I W  P SPNG IL Y + Y+K   E  +    T C+TR E+L                   K+  Y L  L+PG + F+I   ++A   ++T    F +    D   +       I      ++  +L V   YY +K   +    +S N +Y    I+Y  D WE+DR  + +++    LG+GSFGMVY+GV K          +R    +++ VAVKT+N  ++  +RREF+ EA  MK+F  +H+VKL G
Sbjct:   64 VCGSVDIRSSMDNFKLLENCTVIEGSLRISLFELKALDFRHLSFPDLREITDYLLMYRVYGLETLSKLFPNLAIIRGRELFNSYAIVMYEMRDLQDLGLVNLRTISRGGVRLTKNFKLCYIETINWTQIGVSDPEARRFINNK----EQCPNSC-KDECQSKRCWTYSDCQKGLNCQC-KENTYCMEN--GSCCHDYCLGGCKVPMNPDECFSCKEVQFNNTCRPQCPPGTYKFLNRRCLTDKECLALTNDPDGNTPKLLDGEKGEPSLCLYTCPQNYSVGDSKDNKNLSQCVKCRQLCPKE-CHGLEINNIQDAHKLKECSKISGPLKIQIMSGSNVAQELEKSLGNIREVTETIHIKRSYALVTLHFFKNLQIIGSKVPSSETQEGQS-----FSLFLMDNTNLQELFPEE---QMKKMKILNGGIYVHDNGQLCPHTIKEFL-----SHLNLSEAQSSISSISNGHQRPCEKHDLNVTVEKIAHNAAILAWNKYKAD---ERQLLTYILNYKEIKDESNDINIFQGRDLCSHDLWMTREYAPKEGPEADQIGMLYDLKPFTTYAVYIQAYTVSTATHAAMTNILTFTTYPFHPSEPTDLVAISEDPHELRVSWKPPKYPNGNITHYKIVYHKLELNEKSYEQRNYCRDPLVHQKKKEKVKIEEEGKKINNSANSNCCKCPKSKEEMDTES------RKREIEMYFEDYLHKHIYCKRYDKLPDEVDLNFDGMNLPQLVEMNYNSSETSDRIEV-FPNYVIENTS--DLANLTEIVKEVVVYGTTEV--TLPNLEHFSEYSIEVLACQDY----------------NEKVLSKLCSIRAITFERTKDSYAADMINETTVDTEIETNFTGNVFIKWESPTSPNGLILKYLLWYKKANQENLVP--QTICITRQEYL-------------------KNLGYKLTRLEPGNWTFKISAISLAENSSFTLERFFIVPRPPDPESSNTLLIVAIVLAFFGVLTVSLIVACVYYKQKIRSDDMTVISRNMNYVPSEILYISDEWEVDRDKIKLIK---ELGQGSFGMVYEGVAKG---------IRDDPNEEIPVAVKTVNDRASFSDRREFLKEATTMKEFHCHHVVKLLG 1106          

HSP 2 Score: 197.208 bits (500), Expect = 2.757e-49
Identity = 100/209 (47.85%), Postives = 135/209 (64.59%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLR--KQGEEGEGFVSENQSHLWAI-----QIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR  +  E+  G +     HL  I     +IADGM YL++ KFVHRDLAARNCM++    +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD+WSYGV++WE++TLA+ PY+G+S+ +V++++S G   +     N    +  +M++CW   P+ RP+F  II+ L      +F   SY+
Sbjct: 1115 LVIMELMALGDLKNYLRGHRPDEDHPGVMP---PHLLDILQMAGEIADGMAYLADKKFVHRDLAARNCMVSEERTVKIGDFGMTRDIYETDYYRKGGKGMLPVRWMAPESLKDGVFTSLSDVWSYGVVMWEMVTLAAQPYQGLSNEEVVKFISDG--YIMELPENCPNEMAYLMQHCWAKKPNQRPTFKAIIEYLLPKLKPSFEKVSYF 1318          
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Match: sp|P06213|INSR_HUMAN (Insulin receptor OS=Homo sapiens OX=9606 GN=INSR PE=1 SV=4)

HSP 1 Score: 369.392 bits (947), Expect = 2.072e-104
Identity = 339/1164 (29.12%), Postives = 525/1164 (45.10%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV-------------VIDNLLPAKRYAFYAEAIRS---RVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNK--NQILINIDKDDTIMQFLDEYITKSFIKQN-------EIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +GRCV+ C   +Y +++ RC++ S C +L  +     R+  H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R LR+I+G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P+             ++  L P  +YA + + + +       +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C  K                 +   NQ++ E    +C  SC K  +QIL  +++      F D      F+ +        E P+ + K    G         N TV V  V   FP+T  S+ S P+       F+K+V    N+     + L H+T Y  E+QAC    N  + E +               CS  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +I+  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  +++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   33 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPK-VCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYS----------FYALDNQNLRQLWD----WSKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAE--DSELFELDYCL-KGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECC-SCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVG------NVTVAVPTVAA-FPNT--SSTSVPTSPEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDTPEER---------------CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLR---ELGQGSFGMVYEGNARDIIK----------GEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1091          

HSP 2 Score: 197.978 bits (502), Expect = 1.283e-49
Identity = 100/207 (48.31%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    E E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + +  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1100 LVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPD--NCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1304          
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Match: sp|P24062|IGF1R_RAT (Insulin-like growth factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Igf1r PE=2 SV=2)

HSP 1 Score: 359.762 bits (922), Expect = 2.897e-101
Identity = 324/1166 (27.79%), Postives = 532/1166 (45.63%), Query Frame = 3
Query:  156 IFNIINLYQAITFTDSFKLSNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSEYS---FPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINM-RNFCLEFCPNNCPRGENLQK---------YCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDE-MCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCG-----RVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYI-----GKP-VVIDNLLPAKRYAFYAEAIR-SRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLE---IFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGE-CDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISK--PSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++ ++ L  A++    +  S E     IDIR     +  L NCTVIEG L+I +++   +Y    FP L  IT  L+++ V G ++LG  FPNLT+IRG  L YNYA+VI E TNL  IGL NLR +  G +RI+ N  LCY++TI+W+ I+        + N     C + CP         +K          CW  N CQ +C   C K  + C  N  N CCHPECLG C+   D   CV+C++    G CV  C    Y+++  RC+    C N+ +  S+D    D + I D  C+++C  G  +N      C  C   C  K CG        I S+      +GC  ++ ++ I+I+ G +  S+ L      + ++   ++I  S ++ SL FL++LR+I G    + N            F V DN+NL +++D     N  N+T+  G + F  N KLC  +I   +     TK + SK D  I   +NG+ A C+ + L         +   +  H   P       + T  +  KE   KNV++Y+  ++C   +W  V+  +     G+P +++  L P  +YA Y +A+  + VEN       S+++Y+ T    PS P+++ + + SSS++ + WNPP  PNG ++ YI+ W R  +   +F  ++  +D    +  +   I  +      KT     ++G  C C K        +      K        + ++  S      +P+   +  D    ++     +   R   V   +  TD        P  E+  ++ ++ V           +NL  +T Y  +I +C       + E++ L             CS+ + + A T P E  D+I           +S+ + W EP++PNG IL Y I+Y     +         CV+R E+                   +K G   L  L PG Y  +I+  +++  G+WT    F + + + +  + +  I   V I++I+  L +++  + +K+   R      + S NP+Y+    +Y  D WE+ R+ + M   N  LG+GSFGMVY+GV K +            DE +  VA+KT+N  +++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   13 LWGLVFLSAALSL---WPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGDLCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGK--RACTEN--NECCHPECLGSCHTPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSD---SDGFVIHDGECMQECPSGFIRNSTQSMYCIPCEGPCP-KVCGDEEKKTKTIDSVTSAQMLQGCTILKGNLLINIRRGNNIASE-LENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS----------FYVLDNQNLQQLWD----WNHRNLTVRSGKMYFAFNPKLCVSEIYR-MEEVTGTKGRQSKGD--INTRNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYY--KEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLFRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYRK------VFENFLHNSIF----VPRPERRRRDV--LQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFESRVDNKERTV----------ISNLRPFTLYRIDIHSC-------NHEAEKLG------------CSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQR------ECVSRQEY-------------------RKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITM---NRELGQGSFGMVYEGVAKGVVK----------DEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLG 1068          

HSP 2 Score: 201.83 bits (512), Expect = 9.216e-51
Identity = 104/207 (50.24%), Postives = 133/207 (64.25%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEG---FVSENQSHL--WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    E E     +  + S +   A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   + +F+  S+Y
Sbjct: 1077 LVIMELMTRGDLKSYLRSLRPEVENNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIIGSIKDEMEPSFQEVSFY 1281          
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Match: sp|P15127|INSR_RAT (Insulin receptor OS=Rattus norvegicus OX=10116 GN=Insr PE=1 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 1.185e-99
Identity = 329/1174 (28.02%), Postives = 518/1174 (44.12%), Query Frame = 3
Query:  183 AITFTDSFKLSNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV---------------VIDNLLPAKRYAFYAEAI---RSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCN----KNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            A+    +  L   +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +G+CV+ C   +Y +++ RC++ S C +L  +     +   H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R L +I+G +    N            F   DN+NL +++D     N+ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P                ++  L P  +YA + + +         +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C    K  +      +      ++   NQ E D D   E C+     +QIL  +++      F D      F+ +     +  +            E          + +FP  +IS+   P+       F+K+V    N+     + L H+T Y  E+QAC    N  S E ++                  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +++  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   19 AVAGGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDYVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHYKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPK-VCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYS----------FYALDNQNLRQLWD----WNKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAE--DSELFELDYCL---KGLKLPSRTWSPPFESDDSQKHNQSEYD-DSASECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGNGAEDTRPSRKRRSLEEVGNVTATTPTLPDFP--NISSTIAPTSHEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDSPEERS---------------GVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLR---ELGQGSFGMVYEGNAKDIIK----------GEVETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1092          

HSP 2 Score: 193.356 bits (490), Expect = 3.162e-48
Identity = 97/207 (46.86%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAI-----QIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  +LR    + E         L  +     +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + L  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1101 LVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPD--NCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1305          
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Match: sp|P15208|INSR_MOUSE (Insulin receptor OS=Mus musculus OX=10090 GN=Insr PE=1 SV=2)

HSP 1 Score: 353.984 bits (907), Expect = 2.534e-99
Identity = 327/1161 (28.17%), Postives = 519/1161 (44.70%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS-----EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRN--FCLEFCPN------NCP----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYC----GRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPV---------------VIDNLLPAKRYAFYAEAIRS---RVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCN----KNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---------WVSSNPDYW--------IIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC  +DIR   + +  L NC+VIEG L I ++  T      + SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+VI E  +L  +GL NL  +  G VRI+ N  LCY+ TI+W+ I+        ++N  +   C + CP       NCP     G+ +++ CW H+ CQ VC   C  +   C       CCH ECLG C    D   CV+C+N   +G+CV+ C   +Y +++ RC++ S C +L  +     +   H Y I ++ C+ +C  G   N     C  C   C K  C    G   I S+    E  GC  I    I    GG++L+  L      +  I   L+I +S ++ SL F R L +I+G +    N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I   +     TK +  + D  I   +NGD A C++E L    +  S     ++     P    ++     LF  +   +NV++++  ++C   +W  V+  I  P                ++  L P  +YA + + + +       +   SD+IY+ T+  NPS P++  + + SSS+I L W PP  PNG +T Y++ W R  E    + F  D C    K  +      +      ++   NQ E D D   E C+     +QIL  +++      F D      F+ +   P    + ++         E          + +FP  ++S+   P+ +     F+K+V    N+     + L H+T Y  E+QAC    N  S + +               CS  + +SA T P+   D+I     +     + V + W EPK PNG I+ Y + YR+Y  E EL      CV+R  +                          LR L PG Y  +++  ++A  G+WT+  +F +      T+Y +     A +II  L  +F+            R R         + SSNP+Y          +Y  D WE+ R+ + +L     LG+GSFGMVY+G  K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   33 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVER-CWTHSHCQKVCPTICKSHG--CTAE--GLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPK-VCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYS----------FYALDNQNLRQLWD----WSKHNLTITQGKLFFHYNPKLCLSEIHK-MEEVSGTKGRQERND--IALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPP-DFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVD--IDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAE--DSELFELDYCL---KGLKLPSRTWSPPFESDDSQKHNQSEYD-DSASECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPR---PSRKRRSLE---------EVGNVTATTLTLPDFP--NVSSTIVPTSQEEHRPFEKVV----NKESLVISGLRHFTGYRIELQAC----NQDSPDER---------------CSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDE-ELHL----CVSRKHFALERGC-------------------RLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYV------TDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLR---ELGQGSFGMVYEGNAKDIIK----------GEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLG 1081          

HSP 2 Score: 193.356 bits (490), Expect = 3.199e-48
Identity = 97/207 (46.86%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAI-----QIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  +LR    + E         L  +     +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ SSD+WS+GV+LWEI +LA  PY+G+S+  V+++V  GG L      N  + L  +M  CW +NP  RP+F +I+  L+     +F   S++
Sbjct: 1090 LVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPD--NCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFF 1294          
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Match: I1T3F2 (Receptor protein-tyrosine kinase OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2662.49 bits (6900), Expect = 0.000e+0
Identity = 1379/1390 (99.21%), Postives = 1381/1390 (99.35%), Query Frame = 3
Query:  312 MVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLL------YIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYXXXXXXXXXXXXXXLLATRLESENSTKNFIQDS 4463
            MVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLL      YIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTN P+TDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNI+AKNSSNSTNI QQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENST NFIQDS
Sbjct:    1 MVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLVINLFQYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNLPATDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENSTNNFIQDS 1390          
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Match: C7DT90 (Receptor protein-tyrosine kinase (Fragment) OS=Schistosoma japonicum OX=6182 GN=IR-2 PE=2 SV=1)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 518/1561 (33.18%), Postives = 783/1561 (50.16%), Query Frame = 3
Query:  219 EKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEF-----------CPNNC----------PRGENL--QKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESEC-------MNLSSQSSTDY------------RREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEG-GSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFD--------EKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNV-----QTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPD-ISLQNSALTALFMLKETTKNVSQ----YELFNSCS--------------EQNWRTVEGY----------------IGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPK--SNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPS-----IENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALS---------KNGTSKNVLNLP----------CSSKSLISAHTSPKENMDNINESTINTRVNG-SSVKIFWSEPKSPNGFILNYFIRYRKYPY------------EAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQK---------------SGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKIS-----SDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGH--SVMSRVKCPLNWNSLNRINILK-------LFDSKASEIKERQIDD--IAAAQFG------------SFKATISQHFDKM----PLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGS-FNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLE-LYADMNFRNNSYY 4364
            E  C   D+R  S ++ L+ CTVIEGDL+I    +  + S P LKE+TGSL++Y  +G + L +  PNLT++RGQTL + Y+VVIK T+   IGL +LR++  GGVRID+NP LCYV TI+W  I++     +  I +    L              PNN           P  + L    +CW  N CQ++C   C   N  C M  P +CCHPECL GCYG+G   CV+CKNV+ + +C+ KC    +KY NRRC++E +C       M   S   ++Y            R   ++ I + +C+ +C  G +++  TG C  CG +C  K+C   LI+++       GCYS + IY+SI++G   +++++L +AF  L +I +SLRIV+SS + +L+FL+ +  I             N S+  IVFE++ N+NL  ++         E   +N L I +  G +    NR+LCPEKI     SN+          L++ +  +I ++NGD+A+C   +  V V N   SS +V+     P  I   N ++   F     + +V +    Y  + S                + +WR +                   +   + +  L  A RYA Y E ++  ++    +S+++Y TT   NP+ P     E L+ + +RLTW PP+ P+G +  Y+IW R LE    ++  +D C                    T+  N  Q   D +   +  +  QI ++ D  D+ +   +    +       IP    N+ P     +          V VDEVV+    T    + K +     I +    ++K      NE     T    +T    EIQAC    ++   ES+            K+GT+  +  L           CS +S +    +P    D +  ++I+  +NG  S++I WS P  PNG IL+Y +RYR   +            +  L WL T C++   W    +  A  SS+   INQ++                G  +++DL PG YEFQI   ++A  G W+ +  F I      + +I  +   Y  I      ++LC +  ++ Y  ++ Y + T W S+NPDY  IYE+D WEI++ DVD+L W YP+GRGS G VYKGV+K L TPA+  Y   ++   + VA+KT++ +ST+ + R+FINEAC+MKQFQSYHLV+L G+V+K      S      KF    H   +   +   L W S +  +          L  S +S I ++ +DD  +    FG             F  T S  F+K+    PLVIM+LM  GDLA YLR  G++G+G V+ +Q++LWA QIADGM YLS  ++VHRDLAARNC+++S L +KIGDFG+ RDVY   YY K + G+ P+RWMAPESL + YF+  SD+WSYGV+LWEI+T+A LPY GMSH +V++Y+  G +LLS G+  N  +LL  +M +CW ++P  RP+F  +   L   + D  FR  S++
Sbjct:   18 EVACTRADVRHSSSLTKLSRCTVIEGDLFIVFTRIPRDASLPFLKEVTGSLLVYDTEGPEDLSILLPNLTLVRGQTLVFGYSVVIKSTSFKSIGLPSLRVIQQGGVRIDSNPQLCYVETIDWKVILQNQSGDVSSIKIVKNGLICSNICSSSCSVNSPNNTQHSSVELWRSPFSDILPTDGHCWSMNECQSICPVYCTLQNLTCTMKRPYKCCHPECLAGCYGDGPSECVACKNVMHDNQCISKCPSGTFKYLNRRCVTEYQCLVELPNMMYSDSPYISEYYANNSFPYNDMTRMHSNFTIFNGSCLLKCPVGYKKSLKTGHCYACGDQCELKHCREFLIYNLKALDTLTGCYSAKAIYLSIQDGKPETVANLLDRAFKNLKVIHHSLRIVRSSVLENLNFLQHVHSI--------GQIGENVSSHPIVFELFGNDNLRNLWPIAKDANNIEDDPVNSLQI-LSNGLIRITQNRQLCPEKIFQLFESNIIKSSGNNNITLTQAEREMITITNGDLAYCNWREFNVTVSN--RSSHSVRVTWPHPSTIHFTNKSVNTNFSDGSNSSHVDEVVLIYLFYQSAPNDLPDIIKGRRVYDKNSWRMLTTSCDLNPGDSISSFSYLELDCGLTLSELEAATRYAIYVE-MKFPLKQTGAVSNLVYFTTLSVNPTPPQYPWLEPLNQNSLRLTWMPPVKPSGIIDAYLIWIRILEDNPSEYLTQDFC--------------------THRPNWIQSGWDKNSLFK--HSRQINLHNDYCDSCLPCPNLLEIEQLSNTQAIPSLDKNYWPPSVSRWMTDNFGNILPVIVDEVVSLKSDTVGLIVQKNASTFQHISHFQMDYEKKCIHSVNENVKYLTGFPPFTRVLVEIQACLSYDSISYVESETKCHRPPPWSNLKSGTTIYLHQLHHQWSVCEYELCSPRSTVINRVNPHVESDKVPVASIHATLNGPGSIRITWSNPIKPNGLILHYLLRYRPRNHDQSYTDSNHSSSDVSLPWL-TKCISMSHWSADHSEHALTSSSYITINQKEVSRSKRGYNANSSTTDGGISIKDLSPGSYEFQILAVSLAGNGEWSPTVIFNIPFYTDHNGTINRQKLVYISIIIASSFLLLCFILAIIWYKARRYYFKATAWTSNNPDYCTIYEVDNWEINKDDVDVLHWKYPIGRGSLGTVYKGVVKQLKTPAKLLYNNPVN---IPVAIKTISVHSTLFDHRDFINEACFMKQFQSYHLVRLLGLVTKTKIKHKSVTDNCIKFLHHHHFGKLCQFISGILPWTSTSVSSSSPNVKLHPLLSPSISSPIGKQMLDDDEVNCHTFGLSKNFTPVDDASLFNNTKSFGFNKVAPDSPLVIMQLMAKGDLASYLRYLGDKGQGTVNSSQAYLWATQIADGMAYLSAKQYVHRDLAARNCLVDSHLTVKIGDFGLCRDVYGRNYYHKTSHGKPPIRWMAPESLQTAYFTTQSDVWSYGVVLWEIVTMACLPYCGMSHEEVVRYILSGKTLLSNGTPTNCPELLRALMLHCWNFDPLKRPTFLGLCALLSPCFGDAKFRLASFF 1540          
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Match: A0A4Z2D6S7 (Insulin receptor-related protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003964 PE=3 SV=1)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 514/1543 (33.31%), Postives = 778/1543 (50.42%), Query Frame = 3
Query:  165 IINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEF-----------CPNNC----------PRGENL--QKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESEC-------MNLSSQSSTDY------------RREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEG-GSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFD--------EKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNV-----QTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPD-ISLQNSALTALFMLKETTKNVSQ----YELFNSCS--------------EQNWRTVEGY----------------IGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECD-CDKC-----MESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPS-----IENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALS---------KNGTSKNVLNLP----------CSSKSLISAHTSPKENMDNINESTINTRVNG-SSVKIFWSEPKSPNGFILNYFIRYRKYPY------------EAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQK---------------SGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKIS-----SDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGH--SVMSRVKCPLNWNSLNRINILK-------LFDSKASEIKERQIDD--IAAAQFG------------SFKATISQHFDKM----PLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLL 4250
            ++N+      TD    S E  C   D+R  S ++ L+ CTVIEGDL+I    +  + S P LKE+TGSL++Y  +G + L +  PNLT++RGQTL + Y+VVIK T+   IGL +LR++  GGVRID+NP LCYV TI+W  I++     +  I +    L              PNN           P  + L    +CW  N CQ++C   C   N  C M  P +CCHPECL GCYG+G   CV+CKNV+ + +C+ KC    +KY NRRC++E +C       M   S   ++Y            R   ++ I + +C+ +C  G +++  TG C  CG +C  K+C   LI+++       GCYS + IY+SI++G   +++++L +AF  L +I +SLRIV+SS + +L+FL+ +  I             N S+  IVFE++ N+NL  ++         E   +N L I +  G +    NR+LCPEKI     SN+          L++ +  +I ++NGD+A+C   +  V V N   SS +V+     P  I   N ++   F     + +V +    Y  + S                + +WR +                   +   + +  L  A RYA Y E ++  ++    +S+++Y TT   NP+ P     E L+ + +RLTW PP+ P+G +  Y+IW R LE    ++  +D C T   +  +     N+    +   N +   CD C  C     +E  +  Q + ++DK +     +  ++T +F         N  PV               + VDE+V+    T    + K +     I +    ++K      NE     T    +T    EIQAC    ++   ESK            K+GT+ ++  L           CS +S +    +P    D +  ++I+  +NG  S++I WS P  PNG IL+Y +RYR   +            +  L WL T C++   W    +  A  SS+   INQ++                G  +++DL PG YEFQI   ++A  G W+ +  F I      + +I  +   Y  I      ++LC +  ++ Y  ++ Y + T W S+NPDY  IYE+D WEI++ DVD+L W YP+GRGSFG VYKGV+K L TPA+  Y   ++   + VA+KT++ +ST+ + R+FINEAC+MKQFQSYHLV+L G+V+K      S      KF    H   +   +   L W S +  +          L  S +S I ++ +DD  +    FG             F  T S  F+K+    PLVIM+LM  GDLA YLR  G++G+G V+ +Q++LWA QIADGM YLS  ++VHRDLAARNC+++S L +KIGDFG+ RDVY   YY K + G+LP+RWMAPESL + YF+  SD+WSYGV+LWEI+T+A LPY GMSH +V++Y+  G +LLS G+  +   LL
Sbjct:    1 MLNILAQHDSTD-LGFSQEVACTRADVRHSSSLTKLSRCTVIEGDLFIVFTRIPRDASLPFLKEVTGSLLVYDTEGPEDLSILLPNLTLVRGQTLVFGYSVVIKSTSFKSIGLPSLRVIQQGGVRIDSNPQLCYVETIDWKVILQNQSGDVSSIKIVKNGLICSNICSSSCSVNSPNNTQHSSVELWRSPFSDILPTDGHCWSMNECQSICPVYCTLQNLTCTMKRPYKCCHPECLAGCYGDGPSECVACKNVMHDNQCISKCPSGTFKYLNRRCVTEYQCLVELPNMMYSDSPYISEYYANNSFPYNDMTRMHSNFTIFNGSCLLKCPVGYKKSLKTGHCYACGDQCELKHCREFLIYNLKALDTLTGCYSAKAIYLSIQDGKPETVANLLDRAFKNLKVIHHSLRIVRSSVLENLNFLQHVHSI--------GQIGENVSSHPIVFELFGNDNLRNLWPIAKDANNIEDDPVNSLQI-LSNGLIRITQNRQLCPEKIFQLFESNIIKSSGNNNITLTQAEREMITITNGDLAYCNWSEFNVTVSN--RSSHSVRVTWPHPSTIHFTNKSVNTNFSDGSNSSHVDEVVLIYLFYQSAPNDLPDIIKGRRVYDKNSWRMLTTSCDLNPGDSISSFSYLELDCGLTLSELEAATRYAIYVE-MKFPLKQTGAVSNLVYFTTLSVNPTPPQYPWLEPLNQNSLRLTWMPPVKPSGIIDAYLIWIRILEDNPSEYLTQDFC-THRPNWIQSGWDKNSLFKHSRQINLHNDYCDSCLSCPNLLEIEQLSNTQAIPSLDK-NYWPSSVSRWMTDNF--------GNILPV---------------IVVDEIVSLKSDTVGLIVQKNASTFQHISHFQMDYEKKCIHSVNENVKYLTGFPPFTRVLVEIQACLSYDSISYVESKTKCHRPPPWSNLKSGTTISLHQLHHKWSVCEYELCSPRSTVINRVNPHVESDKVPVASIHATLNGPGSIRITWSNPIKPNGLILHYLLRYRPRNHDQSYTDSNHSSSDVSLPWL-TKCISMSHWSADHSEHALTSSSYIAINQKEVSRSKRGYNANSSTTDGGISIKDLSPGSYEFQILAVSLAGNGEWSPTVIFNIPFYTDHNGTINRQKLVYISIIIASSFLLLCFILAIIWYKARRYYFKATAWTSNNPDYCTIYEVDNWEINKDDVDVLHWKYPIGRGSFGTVYKGVVKQLKTPAKLLYNNPVN---IPVAIKTISVHSTLFDHRDFINEACFMKQFQSYHLVRLLGLVTKTKIKHKSVTDNCIKFLHHHHFGKLCQFISGILPWTSTSVSSSSPNVKPHPLLSPSISSPIGKQMLDDDEVNCHTFGLSKNFTPVDDASLFNNTKSFGFNKVAPDSPLVIMQLMAKGDLASYLRYLGDKGQGTVNSSQAYLWATQIADGMAYLSAKQYVHRDLAARNCLVDSHLTVKIGDFGLCRDVYGRNYYHKTSHGKLPIRWMAPESLQTAYFTTQSDVWSYGVVLWEIVTMACLPYCGMSHEEVVRYILSGKTLLSNGTPTNCPELL 1501          
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Match: A0A419Q5J7 (Receptor protein-tyrosine kinase OS=Clonorchis sinensis OX=79923 GN=InR PE=4 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 480/1565 (30.67%), Postives = 750/1565 (47.92%), Query Frame = 3
Query:  156 IFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI--VRQHGAPIKLINMRNF-CLEFCPNNC---PRGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECM---NLSSQSSTDYRRED--------------HYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSS-LSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQL--------NITILEGS-VSFNLNRKLCPEKILSFLNSN----VQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVK--------CHSKVPDISLQNSALTALFMLK----ETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVID--------NLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQG-ECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFK--FTNLHHYTEYFFEIQACQDLQNVQSSESKA-----------------LSKNGTS-KNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVN-GSSVKIFWSEPKSPNGFILNYFIRYRKYPY----------------------------------------EAELDWLSTPCVTRPEWL----NGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS--DSIFTEYRNYXXXXXX----XXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEI-DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKC----------FGHSVMSR--------VKC--PLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLS-TGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKL-ELYADMNFRNNSYY 4364
            + ++++  +++  + ++     KVC+S+DIR+        NCTV+EGDL I+ + L+++ S P ++EITGSL+IY V G  +L    P L +IRGQ L   YA+V+K T L    L +LRL+  G VR+++NP LC+V+T+NW ++   R     I  +NM    C + CP  C   P      K+          CW  + CQ+VCS+ C ++N  C ++D  RCCHPECLGGCYG+G  MCVSC +VL    C+ +C +   +Y NRRC++  +C+    ++ +S + +   +              +YA+ +  CV+ C  G  ++ +TG+CE C   C +K C    IH++ D    + C+S + +Y+SI +  S   ++ L +AF+ L IIE+SLRIV+S++ITSL FL ++  I           +    + +I  EV +NENL  ++     L  +         + +   S V F  N +LCP  +    ++     +     LS+ ++ +I V+NG++ +C      +++  ++ SS  ++          + VP++ L    +T + + +    E   N+  +++     +++ R     +   V  D         L  A  Y+   E     + N L  S+ +  TT   NPS P      +     +RLTW  P  PNG ++ Y+IW R L     +F   D C  K         Q + R+ + +    N      C +C   C               + FL +      +  +++P   W       F + +         +E++  +       +    ++N+   F       A +T +     +L  +     E+ ACQ  Q  +S  + A                 +  N T   N     CS +  +      K + D I+ ++I+ + +  +SV+IFW EP  PN  +L Y IRYR   Y                                         A+  WL T C++   WL    NGT             +Q+  G   LR L  G Y FQI+ F++A  G W+  + F I +  D+   ++  + I+       ++ ++L      +  + +K+YL  T W S NP Y  IY++ D WEIDR ++D+L W +PLG GSFG VY+GV++ LTTPA   Y    D   + VA+KT+N  +T+ +  +FI+EAC+MKQF SYHLV L G+V++   ++     +  +F+           FG + +S         + C  P + +SL         DS    ++ RQI+    A                PLV+MELM  GDL  YLR  G+ G G V   Q++LWA QIADGM YL    +VHRDLAARNC +N+ LI+KIGDFG+ R+VY   YY K+  GRLP+RWMAPESL    F+  SD+WSYGV+LWE+ T+A LPYRGMSH  VI Y   G +L++ T   N   LLL +M  CW Y+P  RP+F  I   L   + D  FR++S+Y
Sbjct:    3 VLHLLSRTKSVGISSAYLTGFVKVCRSLDIRRPDIFKQSINCTVVEGDLIISFIRLSTDASLPYVREITGSLLIYDVHGLDSLAQLLPRLVLIRGQNLIDRYAMVLKSTGLKDAALPSLRLIHRGAVRLEDNPDLCHVHTVNWMALSGYRADAEHILKVNMNGASCADRCPAQCLSAPLTTGPAKFQQRTPYTNAPCWSSSICQSVCSDHCIEHNLACQVHDMERCCHPECLGGCYGDGPHMCVSCSHVLYGDSCISECPEGTLRYLNRRCVTVEQCLWSIPMAVRSDSPFNMSNSTEPAEYNGVPDWHNYAVFNQCCVENCPIGYIRHNVTGQCEPCDERCPRKRCPEFFIHTLKDLVALQDCWSAKAVYMSISDTDSDETAEALARAFATLRIIEHSLRIVRSTAITSLSFLNTVERI---------GSSVTEVDHTITLEVSENENLRTLWSPNGGLPHVINNSNDAAGLKVWSTSPVRFTQNSRLCPASVFRLFDTGALVLMPRGRSLSEAEQNLIRVTNGELVYCNLATFSLELSELTSSSVRIQWPQVTFQSSDTGVPNMPLHADVVTLMLLHQCHVLEDHSNLEDHDI-----DESIRCRMFQVSCAVYTDGKCYYQLSGLEAATSYSIRIEIRYPLLRNRL-YSERVQFTTATANPSAPRYAWLGSNGDDSLRLTWMNPSQPNGVISHYLIWVRLLSPQKVNFTSHDFCIKKPDWILSDLGQISFRVEQQSFSRTNLSISPTCRQCFSYCR-------------YLSFLSDVPNSEDLPSSDVP---WP------FSVSRWTLGDK---EELLPVYVVNSSGELDHSELDNVVGLFVISTNGGARDTEYTQYMRSLRPFRRVVVELSACQT-QTAKSVSNGACRAPAPWLGLHPGEFLDIELNRTHWSNCETQLCSPRVTMVGRMPSKGDADEIHATSISCQSSTPNSVEIFWREPDRPNDLVLYYVIRYRPTAYVLTSERTNSEKVENATTNQVSGSRCNTTIKLEELPDLSTTSAQTAWL-TKCISVGHWLAFQPNGT-------------HQRNVGGTFLRGLPSGSYLFQIQAFSLAGVGPWSPVHIFTIDAYLDTSLDQWSAHQILIVALNCSLVALLLTVGLTAIGCHLRKRYLRSTAWTSINPGYIDIYDVTDAWEIDRANIDVLSWKHPLGHGSFGTVYRGVVRCLTTPASTLY---PDSTNIPVAIKTINNTTTLFDHHDFISEACHMKQFHSYHLVCLLGLVTRTGKNERLPDQHCDRFRGLIRRIRLLAQFGQTSLSNQPFCHPDIIDCTDPTDQSSLGE-------DSNGRPLR-RQINAHRVAP-------------NSPLVVMELMAEGDLVKYLRHLGDTGLGSVEHAQAYLWATQIADGMAYLVAKNYVHRDLAARNCFVNARLIVKIGDFGLCRNVYGQYYYHKKTCGRLPIRWMAPESLRKARFTSQSDVWSYGVVLWEVATMACLPYRGMSHEQVICYTLGGNTLITNTVPTNCPGLLLALMARCWAYDPAKRPTFLRICALLCPRFGDAQFRSSSFY 1488          
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Match: A0A4S2JRR2 (Receptor protein-tyrosine kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_011272 PE=4 SV=1)

HSP 1 Score: 697.582 bits (1799), Expect = 0.000e+0
Identity = 482/1535 (31.40%), Postives = 733/1535 (47.75%), Query Frame = 3
Query:  219 EKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI--VRQHGAPIKLINMRNF-CLEFCPNNC---PRGENLQKY----------CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECM---NLSSQSSTDYRRED--------------HYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGS-SLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQL--------NITILEGS-VSFNLNRKLCPEKILSFLNSN----VQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVK-----CH----SKVPDISLQNSALTALFMLK----ETTKNVSQYELFNSCSEQNWR-TVEGYIGKPVV--IDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECD-CDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIP----KSNWKPVDSGH-FEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKA-------------------LSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSS-VKIFWSEPKSPNGFILNYFIRYRKYPY----------------------------------------EAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISS--DSIFTEY--RNYXXXXXXXXXXXXXXXXXXXXYYC--KKKYLERTRWVSSNPDYWIIYEI-DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKE-------RQIDDIAAAQFG------SFKATISQH--FDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLS-TGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKL-ELYADMNFRNNSYY 4364
            E +C S+DIR+        NCTV+EGDL I+ V L ++ S P ++EITGSL+IY V G  +L    P L +IRGQ L   YA+V+K T L    L +LRL+  G VR++ NP LC+V+T+NW ++   R        +NM    C + CP  C   P      KY          CW  + CQ+VCS+ C +++  C ++D  RCCHPECLGGCYG G  MCVSC +VL    C+ +C +   +Y NRRC++  +C+    ++ QS + +   +              +YA+ +  CV+ C  G  ++ +TG+CE C     +K C    IH++ D    +GC+S + +Y+SI +  S   ++ L +AF+ L +IE+SLRIV+S++ITSL+FL ++  I           +    N++I  EV +NENL  ++        +         + +   S V F  N +LCP  +    ++     +     LS+ ++ +I V+NG++ +C      +++ +++ SS  ++      H    S  P + L    +T   + +    E+  N+  +++  S   + ++ +   Y        +  L  A  Y+   E     + N L  S+ ++ TT   NPS P     ++     +RLTW  P  PNG ++ Y+IW R L     +F   D C  K+        QS++ + + +  + N      C +C   C               + FL +  T   +  +++P     S W   D      +  V  N  +   E+V       IST    S    T + +               +L  +     E+ ACQ +Q  +S  + A                   L++   S     L CS +  +      K++ D I  ++I+ + +  + V+IFW EP  PN  +L Y IRYR   Y                                         A+  WL T C++   WL       +N ++ +N+     G   LR L  G Y FQI+ F++A  G W+  + F I +  D+    +  R   I+     +  L     L    C  +K+YL  T W S NP Y  IY++ D WEIDR ++D+L W +PLG GSFG VY+GV++ LTTPA   Y    D   + VAVKT+N  +T+ +  +FI EAC+MKQF SYHLV L G+V++   ++     +   F+                  + RI +L  F   +S  +           D    +  G        +  I+ H      PLV+MELM  GDL  YLR  G+ G G V   Q++LWA QIADGM YL+   +VHRDLAARNC++++ LI+KIGDFG+ R+VY   YY K+  GRLP+RWMAPESL    F+  SD+WSYGV+LWE+ T+A LPYRGMSH  VI Y   G +L++ T   N   LLL +M  CW Y+P  RP+FF I   L   + D  FR++S+Y
Sbjct:   39 EVICGSLDIRRPDIFKESINCTVVEGDLIISFVRLPTDASLPYVREITGSLLIYDVHGLDSLAKLLPRLVLIRGQNLIDRYAMVLKSTGLKDAALPSLRLIHRGAVRLEENPDLCHVHTVNWMTLSGYRADAEHTLNVNMNGASCADRCPAQCLSAPITTGPAKYQQRTLYTNAPCWSSSICQSVCSDHCIEHDLACQIHDTERCCHPECLGGCYGNGPHMCVSCSHVLYGDSCISECPEGMLRYLNRRCVTLEQCLWSIPMAVQSDSTFIMSNSTRPAEYNGVPDWHNYAVFNQCCVENCPIGYIRHNVTGQCEPCDERSHRKSCPEFFIHTLKDLVALQGCWSAKAVYMSISDADSDQTAEALARAFATLRVIEHSLRIVRSTAITSLNFLGTVERI---------GSSVTEVNRTITLEVSENENLRALWSPNEGFPHVVNNSNYRTGLKVWSTSPVRFTQNSRLCPASVFRLFDTGALVLMPRSRSLSEAEQNLIRVTNGELVYCNLAMFSLELSDLTSSSVRIQWPQVTSHSLDTSGAPIMPLHADIVTLTLLHQCHVLESHPNLEGHDIDESLRCRIFQVSCAKYADAKCYYQLSGLEAATSYSVRIEIRYPLMRNRL-YSERVHFTTATANPSAPRYAWLDSNGDDSLRLTWMNPSQPNGVISHYLIWVRLLSPQKVNFTSHDFCIKKTDWILSGLGQSSSMVGQQSASHTNLSILPTCRQCFSYCR-------------YLDFLSDVPTSEDVPSSDVPWPFSVSRWTMGDKEELLPVYVVNANGELDHSELVNAVGLFVISTNGGASDTEHTQYMR---------------SLRPFGRVVVELSACQ-MQPAKSVSNAACRAPAPWLGLHPGEFLDIELNRTHWSACETQL-CSPRVTVFGRMPSKDDADEIPATSISCQSSTPNFVEIFWCEPDRPNDLVLYYVIRYRPTAYFLTSERTNSGKVESATTNQVSGSRCNTAIKLEELPDLSTTSAQTAWL-TKCISVGHWL----AFRQNGTHQSNV-----GGTFLRGLPSGSYLFQIQAFSLAGVGPWSPMHIFTIDAYLDTSLDGWSARQILIVALNCSLAALLLTVGLTAIGCHLRKRYLRSTAWTSINPGYIDIYDVTDAWEIDRANIDLLSWKHPLGHGSFGTVYRGVVRCLTTPASTLY---PDSTNVSVAVKTINNTTTLFDHHDFIAEACHMKQFHSYHLVCLLGLVTRTGKNERLPDQHCDSFRGL----------------IRRIRLLTQFGRTSSSNQPFCHPDTTVCTDSQGQSSLGEDSNGRPMRRQITAHRVAPNSPLVVMELMTEGDLVKYLRHLGDTGLGSVEPAQAYLWATQIADGMAYLAAKNYVHRDLAARNCLVDARLIVKIGDFGLCRNVYGQYYYHKKTCGRLPIRWMAPESLQKARFTSQSDVWSYGVVLWEVATMACLPYRGMSHDQVICYTLGGNTLITNTVPTNCPGLLLALMARCWAYDPAKRPTFFRICALLCPRFGDAQFRSSSFY 1504          
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Match: insra (insulin receptor [Source:NCBI gene;Acc:103039445])

HSP 1 Score: 351.673 bits (901), Expect = 1.730e-99
Identity = 324/1153 (28.10%), Postives = 527/1153 (45.71%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRRED----HYAIEDDACVKQCSPGKQQ-NKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGK-PVVIDNLLPAKRYAFYAEAIRSRVENWLE------ISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVR-----VDEVVTNF---PSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWL--NGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR---WVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++C S DIR   +++ LL NCTVIEG L I ++  T        +FP L  +T  L+++ V G ++L   FPNLT+IRG  L +NYA+V+ E   L  +GL +L  +  G VR++ NP LCY++T++W+ I+        + N  +  C + CP        CP+     +  + CW    CQ +C  SC   ++ C  +  N+CCH +CLGGC        CV+C+N L  G CV++C   FY +K  RC+  + C  L ++     + +      Y I   AC+ +C  G    N  +  C  C   C K   G   + S+       GC  +    +    GG++++  L     +L  I   L + +S ++ SL FLR LR+I+G      N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I         T TK   +   I   +NGD A C+ + L    +        +K      PD       L  + + K+   KNV++++  ++C   +W         R  +G   + P  +  +L  K +  YA  +++++    E       S++IY+ T    PS P++  + + SSS+I L W PP  PNG +T Y+++ +  +    + +  D C    K   R  +Q ++   +  N  +  G+    +C  +C K +  +  + ++T      EY  K+F  +N +           H E+ ++  ++  R      ++  ++F   PS   +T S PS E      K    V A E+    +NL H+T Y  EI AC    N  +  ++               CS  + +SA T P+++ D+I    I   V   SV I W EPK+PNG I+ Y + Y++     EL      CV+R  ++  NG                       LR + PG Y  +I+  ++A  G+WT+  HF +    +        +I  V+ I +L  + +      KKK  E      + S NP+Y     +YE D WE+ R  + +L     LG+GSFGMVY+G+ K++             E Q  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   25 EICSSKDIRNNVTNLRLLENCTVIEGHLKILLMFTTKPEDFRGLTFPKLTVVTDYLLLFRVYGMESLSSLFPNLTVIRGNNLFFNYALVLFEMLQLKELGLHSLMNITRGAVRVEKNPDLCYLSTLDWSKILDSVEDNYIVANKNDGECGDVCPGMAKGKTTCPQTTINGHFSERCWTQKHCQRMCPSSC--KHRACTKD--NQCCHDQCLGGCMEPSSPRKCVACRNFLHQGECVERCPAGFYTFKGWRCVDFAFCQALHNRCKQGKQGKGGECYEYVIHQGACIPECPSGYTTINSTSLNCTPCAGLCPKVCMGLKTVDSVTAAQGLRGCTVLNGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRRSYALVSLSFLRKLRLIRGEVQEVGNYS----------FYALDNQNLRQLWD----WSKHNLTIQQGRMFFHHNSKLCMAEIRKMEEV---TGTKNRHVKNDIATKTNGDQASCESQVLKFTTIRTLSDKIIIKWEPFWPPDF---RDLLGFMVLYKDAPYKNVTEFDGQDACGSNSWVIADVDPPQRATDGKEQQEPGYL--ILALKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQ-QPEASELYKFDYCQKGMKLPSRAPTQVDSGEEQKWNQTEEHGQ--GGRCC-ACPKTEKQLKKEAEET------EY-RKTF--ENYL-----------HNEVFRIRPSRQRRSLVGVANQTHSDFLTTPSIPPNTSSTPSPEEEAEANKITQLVYAKESTV-ISNLRHFTSYQIEIHAC----NHPTDPAR---------------CSMAAYVSARTMPEDHADDIM-GPITFEVAEYSVHIRWIEPKAPNGMIILYEVNYKRLGDTEELHH----CVSRKSYITENGCK---------------------LRVVHPGNYTVRIRATSLAGNGSWTEPTHFYVQDLRVDPSNMLKIVIAPVICIFLLLLMGLAGFIVFKKKQTEGPTGRLYTSPNPEYLSPDEVYEPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIVK----------GEPQTHVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1068          

HSP 2 Score: 199.904 bits (507), Expect = 3.344e-51
Identity = 103/207 (49.76%), Postives = 129/207 (62.32%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    E E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V  GG L      N +  L  +M+ CW YNP  RP+F +II+ L+     +F+  S++
Sbjct: 1077 LVVMELMTHGDLKSYLRCLRPESENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYLDRPD--NCADRLHNLMQMCWHYNPKMRPTFQEIIEMLKEELHPSFQEMSFF 1281          
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Match: insra (insulin receptor [Source:NCBI gene;Acc:103039445])

HSP 1 Score: 349.747 bits (896), Expect = 3.860e-99
Identity = 318/1149 (27.68%), Postives = 518/1149 (45.08%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRRED----HYAIEDDACVKQCSPGKQQ-NKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGK-PVVIDNLLPAKRYAFYAEAIRSRVENWLE------ISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVR-----VDEVVTNF---PSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWL--NGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +C S DIR   +++ LL NCTVIEG L I ++  T        +FP L  +T  L+++ V G ++L   FPNLT+IRG  L +NYA+V+ E   L  +GL +L  +  G VR++ NP LCY++T++W+ I+        + N  +  C + CP        CP+     +  + CW    CQ +C  SC   ++ C  +  N+CCH +CLGGC        CV+C+N L  G CV++C   FY +K  RC+  + C  L ++     + +      Y I   AC+ +C  G    N  +  C  C   C K   G   + S+       GC  +    +    GG++++  L     +L  I   L + +S ++ SL FLR LR+I+G      N            F   DN+NL +++D     ++ N+TI +G + F+ N KLC  +I         T TK   +   I   +NGD A C+ + L    +        +K      PD       L  + + K+   KNV++++  ++C   +W         R  +G   + P  +  +L  K +  YA  +++++    E       S++IY+ T    PS P++  + + SSS+I L W PP  PNG +T Y+++ +  +    + +  D C    K   R  +Q ++   +  N  +  G+    +C  +C K +  +  + ++T      EY  K+F  +N +           H E+ ++  ++  R      ++  ++F   PS   +T S PS E      K    V A E+    +NL H+T Y  EI AC    N  +  ++               CS  + +SA T P+++ D+I    I   V   SV I W EPK+PNG I+ Y + Y++   + EL      CV+R  ++  NG                       LR + PG Y  +I+  ++A  G+WT+  HF +    I  + +     G +                          + S NP+Y     +YE D WE+ R  + +L     LG+GSFGMVY+G+ K++             E Q  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:    6 ICSSKDIRNNVTNLRLLENCTVIEGHLKILLMFTTKPEDFRGLTFPKLTVVTDYLLLFRVYGMESLSSLFPNLTVIRGNNLFFNYALVLFEMLQLKELGLHSLMNITRGAVRVEKNPDLCYLSTLDWSKILDSVEDNYIVANKNDGECGDVCPGMAKGKTTCPQTTINGHFSERCWTQKHCQRMCPSSC--KHRACTKD--NQCCHDQCLGGCMEPSSPRKCVACRNFLHQGECVERCPAGFYTFKGWRCVDFAFCQALHNRCKQGKQGKGGECYEYVIHQGACIPECPSGYTTINSTSLNCTPCAGLCPKVCMGLKTVDSVTAAQGLRGCTVLNGSLVINIRGGNNIAAELEANLGQLEEITGYLTVRRSYALVSLSFLRKLRLIRGEVQEVGNYS----------FYALDNQNLRQLWD----WSKHNLTIQQGRMFFHHNSKLCMAEIRKMEEV---TGTKNRHVKNDIATKTNGDQASCESQVLKFTTIRTLSDKIIIKWEPFWPPDF---RDLLGFMVLYKDAPYKNVTEFDGQDACGSNSWVIADVDPPQRATDGKEQQEPGYL--ILALKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYVRTNATKPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFCQQ-QPEASELYKFDYCQKGMKLPSRAPTQVDSGEEQKWNQTEEHGQ--GGRCC-ACPKTEKQLKKEAEET------EY-RKTF--ENYL-----------HNEVFRIRPSRQRRSLVGVANQTHSDFLTTPSIPPNTSSTPSPEEEAEANKITQLVYAKESTV-ISNLRHFTSYQIEIHAC----NHPTDPAR---------------CSMAAYVSARTMPEDHADDIM-GPITFEVAEYSVHIRWIEPKAPNGMIILYEVNYKRL-GDTELHH----CVSRKSYITENGCK---------------------LRVVHPGNYTVRIRATSLAGNGSWTEPTHFYVQDLQIILKVQTEGPTGRL--------------------------YTSPNPEYLSPDEVYEPDEWEVPRDKISLLR---ELGQGSFGMVYEGIAKDIVK----------GEPQTHVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 1018          

HSP 2 Score: 200.29 bits (508), Expect = 2.390e-51
Identity = 103/207 (49.76%), Postives = 129/207 (62.32%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    E E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V  GG L      N +  L  +M+ CW YNP  RP+F +II+ L+     +F+  S++
Sbjct: 1027 LVVMELMTHGDLKSYLRCLRPESENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYLDRPD--NCADRLHNLMQMCWHYNPKMRPTFQEIIEMLKEELHPSFQEMSFF 1231          
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Match: insrb (insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-020503-4])

HSP 1 Score: 348.206 bits (892), Expect = 6.834e-99
Identity = 310/1122 (27.63%), Postives = 508/1122 (45.28%), Query Frame = 3
Query:  270 LTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVR--QHGAPIKLINMRNFCLEFCPNN------CPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGD-EMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDH-YAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEG-YIGKPVVIDNLLPAKRYAFYAEAIRSR--VENWLEI----SDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDT-IMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSS--VKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI--IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            L NCTVIEG L I ++  T        SFP L  IT  L+++ V G ++L   FPNLT+IRG  L +NYA+V+ E   L  +GL +L  +  G VR++ NP LCY++T++W+ I+   +    +   N R  C + CP        C +     +  + CW+ + CQ +C  +C   ++ C ++D  RCCH +CLGGC   G+   CV+C+N+L    CV +C    Y +K  RC+S + C +L ++       + H Y I + AC+ +C  G      T  C+ C   C K   G   I S+       GC  +    +    GG++++  L     +L  I   L I ++ ++ SL FLR LR+I+G +    N            F   DN+NL +++D     ++ N+TIL+G + F+ N KLC  +I   +     TK + +K D  I   +NGD A C++ +L    + +S  +  ++      PD       L  + + KE   KNV++++  ++C   +W         R  +G   G P  +  L+P K +  YA  ++++  V +  ++    S++IY+ T +  PS P++  + + SSS+I L W PP  PNG +T Y + Y+  E    + +  D C    K   R  +       +  N  + QGE     C  +C K +  +  + ++T   +  + YI       NE+            FE K     +++     + N   + I  I+ P+  N++        + +++     ++LHH+T Y  EIQAC  L ++                     CS  + +SA T P+   D+I  +  +  +      V I W EPK+PNG I+ Y I YR+     EL      CV+R                   I+ +K+    LR   PG Y  +I+  ++A  G+WT+  +F +                                                 PD +I  +Y  D WE+ R+ + +L     LG+GSFGMVY+G+ K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:    1 LENCTVIEGHLKILLMFKTRAEDFRGLSFPKLVMITDYLLLFRVYGLESLSDLFPNLTVIRGNNLFFNYALVMFEMLQLKEVGLHSLMNITRGAVRMEKNPDLCYLSTLDWSKILDSVEDNYIVANKNERE-CGDICPGTIVGKITCVQTTINGHFGERCWNQDNCQRICPAAC--KHRACTLDD--RCCHDKCLGGCSEPGNASACVACRNLLYGNMCVDRCPPDHYIFKGWRCVSFAFCQDLHNRCKQKKASDCHQYVIHNGACIPECPSGFTIVDATLNCKPCAGLCPKLCTGLQTIDSVTAAQALRGCTVLNGSLVIKIRGGNNIAAELEANLGQLEEITGYLTIRRAYALVSLSFLRKLRLIRGETQEIGNYS----------FYALDNQNLRQLWD----WSKHNLTILQGRMFFHYNAKLCLSEIRK-MEEVTGTKDRHTKND--IALRTNGDQASCENRQLNFTQIRVSSKNIMIRWEPFWPPDF---RDLLGFMVLYKEAPYKNVTEFDGQDACGSNSWVITDVEPPPRATDGNKPGDPGCV--LMPLKPWTQYAIMVKTQLSVSDEHQVHGAKSEIIYVLTNQTRPSVPLDPISSSNSSSQIILKWKPPADPNGNITHYRVAYQKQE-EDSELYKFDYCQKGMKLPSRAPTHYTTEEEQKWNQTEEQGE--TSSCC-ACPKTETELKKEAEETEFRKTFENYI------HNEV------------FEPKPSRRRRSLG----IANSTHSTI-LITPPTFPNVS-----APTIVSSKESIVISHLHHFTSYQIEIQACNHLTDIAF-------------------CSMATYVSARTMPEVKADDIFGAVTHEILPEEPEFVYIHWQEPKAPNGMIVLYEINYRRVSDTEELHH----CVSR-------------------ISYEKTRGCKLRVGHPGNYSVRIRATSLAGNGSWTEPTYFFM-------------------------------------------------PDIFIYFLYVPDDWEVAREKITVLR---ELGQGSFGMVYEGIAKDIVK----------GEPETRVAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLG 959          

HSP 2 Score: 196.823 bits (499), Expect = 3.045e-50
Identity = 101/207 (48.79%), Postives = 130/207 (62.80%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    + E         L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V  GG L    S   ++ +  +M+ CW YNP  RP+F +II+ L+     +F+  S++
Sbjct:  968 LVVMELMTHGDLKSYLRSLRPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDGWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYLDRPES--CAERINNLMQMCWQYNPKMRPTFNEIIEMLKDDLHPSFQEVSFF 1172          
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:103045439])

HSP 1 Score: 335.88 bits (860), Expect = 4.582e-94
Identity = 316/1149 (27.50%), Postives = 515/1149 (44.82%), Query Frame = 3
Query:  213 SNEKVC-QSIDIRKR-SHVSLLTNCTVIEGDLYIAMV--------TLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLY-IGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCP----NNCP-----RGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGC-YGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKC---HSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTV------EGYIGKPVVIDNLLPAKRYAFYAEAIRSRVEN-----WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXK-TNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIK---QNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYC-KKKYLER----TRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +N ++C  +IDI    S    L NCTV+EG L I ++         +    SFP L  IT  L+++ V G  +L   FPNLT+I+G+ L YNYA+VI E N L  IGL +LR +  G VRI+ N  LCY+++++W+ I+      I        C + CP    NN P      GEN +  CW  N CQ VC + C +  + C  +  N CCHP+CLG C   + D  C +C++    GRCV  C    YK++  RCI+   C   S     DY   D + I    C+  C PG  +N+     C  C   C K   G+V I S++     +GC  I+ +++I+I+ G +  S+ L      +  +   +RI  S ++ SL FL+SLR I G     +             F   DN++L  ++D     +Q N+TI  G + F  N KLC  +I       ++T  K   ++E   N  NGD A C  E  I++ +N S  S  +       + PD   ++     ++  +   +N+++++  + C   +W TV      E      V +  L P  +YA + +A+   VE+         S+++Y+ T+   P+ P+ ++  +  S+ + + W+PP+ PNG  T Y++ W +  E    + +  + C  + K   R+ +     IS+ T+  N   G  D   C      ++ L  I+ D    +  + ++  S  K    NE  + +   V +  F    +  N ++       NF  ++      P +E          QV   E      NL  +T Y  ++ +C   + VQ                    CS  + + + T P E  D+I    +       SV + W EP  PNG IL Y I++R  P   + +     CV+R  +     +                    L +L PG Y  +++  ++A  G+WT+   F +        Y N+  +  + I  ++  +  L      KK+  +R      + S NP+Y+   E+   D WE+ R+ + M      LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   28 ANGEICGPAIDIGNDISEFKKLENCTVVEGYLQILLIGNKINNNHEVFRTLSFPKLTMITDYLLLFRVNGLDSLSTLFPNLTVIQGRNLFYNYALVIFEMNSLKDIGLYSLRNITRGAVRIEKNTELCYLDSVDWSLIMNADFNVIDGNKNPKECGDVCPGIVENNTPCIKTKIGENTRDRCWTSNHCQQVCPKECGQ--RACTAS--NECCHPQCLGSCTVPDSDRACAACQHYYHEGRCVPDCPPGTYKFEGWRCITMDLC---SRVHLPDY---DRFVIHGGECMADCPPGFTRNESQSMFCSACDGLCDKICDGKV-IDSVDSAQSLKGCTVIKGNLHINIRRGNNIASE-LENFLGLIKTVSGYVRIRHSHTLGSLSFLKSLRFIYGEDLYDDMY----------AFSAVDNQHLQFLWD----WSQHNLTIGTGKLFFRFNHKLCMSEIRKMW---MKTGIKEKFVEEDFRN--NGDRASC--ESKILKFINNSTGSNIITLTWERYRPPD--YRDLVSFVVYYKEAPFQNITEFDGQDGCGSNSWMTVDVDLPPEKNKNPGVYLSGLKPWTQYAVFVKAVTLVVEDKDRHILGAKSELVYIRTKPSAPTMPVEVRVYSNWSTSLVVRWSPPVSPNGNHTYYLLRWQQQGE--DRELYQHNYCSKELKLPIRMSATGVTDISEDTDPTNPESGGRDITPCCPCPKSDKELKRIEDDTYYRKAFENFLHNSIFKPRPSNERRRRDLFGVANSTFIHALLGMNGSL----AEGNFSHSEHPRREYPFLER---------QV--KERSADIHNLRPFTVYRIDLHSCN--EEVQQ-------------------CSPAAFVFSRTKPAEKADDI-PGPVTWEGLEDSVILKWPEPVRPNGLILLYEIQFRLGPEMEKHE-----CVSRQHYKEHRGV-------------------RLTNLGPGNYSARVRATSLAGNGSWTEPIAFYVPQ---LDRYENFLYLIIIPIAAMILIIVGLALVMVNKKRKNDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMCR---ELGQGSFGMVYEGIAKGVVK----------DEPETRVAIKTVNESASMHERIEFLNEASVMKEFNCHHVVRLLG 1062          

HSP 2 Score: 200.675 bits (509), Expect = 2.376e-51
Identity = 103/206 (50.00%), Postives = 129/206 (62.62%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLR----KQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    K+           +    A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TLA  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   +  FR  S++
Sbjct: 1071 LVIMELMTRGDLKSYLRTLRSKESTSSLPLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEDLEPPFREVSFF 1274          
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:103037538])

HSP 1 Score: 249.21 bits (635), Expect = 1.146e-66
Identity = 196/656 (29.88%), Postives = 314/656 (47.87%), Query Frame = 3
Query:  213 SNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE--------YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPN------NCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKC---HSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTV------EGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEI---SDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLE 2069
            S E     IDIR   S    L NCTV+EG L I ++   +          SFP L+ +T  L+++ V G  +L + FPNLT+IRG+ L YNYA+VI E T+L  IGL NL+ +  G +RI+ NP LCY+++++W+ I+          N ++  C + CP        CPR    +N    CW  N CQ  C+  C  + + C   D   CCHP+CLG C    ++M C +C++    GRCV  C    Y+++  RCI+   C  +   S  D      + I +  C+ +C PG  +N      C  C   C  K C    I S++     +GC  I+ +++I+I+ G +  S+ L      +  +   +RI  S ++ SL FL+SLR I G     N             F   DN++L  ++D     +Q N+TI  G + F  N KLC  +I        +  + + +++E  I  +NG+ A C  E  I++  N    S  +K      + PD       ++ +   KE   +N+++++  + C   +W  V      +      V++  L P  +YA + +AI   VE+   +   S+V+Y+ T+   PS P +++    SSS + + W PP+ PNG  T Y++ W +  E
Sbjct:   24 SGEICGPHIDIRNDISEFKKLENCTVVEGYLQILLIGDKNHNPYQEFRTLSFPKLRMVTDYLLLFRVAGLDSLSMLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLKNITRGAIRIEKNPELCYLDSVDWSLIMDAEFNNYVAGNKQSKECGDVCPGIMEDRPECPRTSFNDNYSYRCWTSNHCQKECAPKC--DRRVC--TDNKECCHPQCLGSCTEPDNDMACAACQHYYHEGRCVPDCPPGTYRFEGWRCITMETCARVHLPSEVD------FVIHNGECMPECPPGFTRNDSQSMFCSACDGLCD-KVCEIKTIDSVDAAQSLQGCTVIKGNLHINIRRGNNIASE-LESFMGLIQTVTGYVRIKHSHTLGSLSFLKSLRYINGEELLDNAY----------AFSALDNQHLQYLWD----WSQHNLTIRAGKLFFRSNPKLCVSEIRKMW----EKTSIIERMEEDDIR-NNGERASC--ESHILKFKNNQTQSNRIKLTWERYRPPDY---RDLISFIVYYKEAPFQNITEFDGQDGCGSSSWTMVDVDLPPDKATDPGVLLYPLKPWTQYAIFVKAITLVVEDKHTLGAKSEVVYIRTKASEPSMPRDVRAYANSSSSLVVKWTPPISPNGNSTFYLVRWQQQSE 643          

HSP 2 Score: 176.792 bits (447), Expect = 3.776e-44
Identity = 87/156 (55.77%), Postives = 108/156 (69.23%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSL 4211
            LVIMELM  GDL  YLR    + +G  S+    L      A +I+DGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ +SD+WS+GV+LWEI TLA  PY+GMS+  V+++V +GG L
Sbjct: 1069 LVIMELMTRGDLKSYLRSLRSKQQGSCSQPLPSLKKMIQMAGEISDGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLL 1224          

HSP 3 Score: 105.916 bits (263), Expect = 2.124e-22
Identity = 97/372 (26.08%), Postives = 166/372 (44.62%), Query Frame = 3
Query: 2439 STISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTI---NTRVNGSSVKIFWSEPKSPNGFILNYFIRYR--KYPYEAELDWLSTPCVTRPEW--LNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKK-----YLERTRWVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
             T+++    N T     M      E  + F+    YTE+        ++ N+Q      +  +  +  V    CS+ + + + T P E  D+I  +     + RV   +V + W EP  P+G IL Y I++R    P + E       CV+R ++  L G  +        TN+     GF        G Y  +++  ++A  G+WT+   F +       E   Y  I   +I+++     +    + +KK           + S NP+Y+   E+   D WE+ R+ + +      LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:  740 GTLARGLGRNATGQEGNMTDPELLEPVYPFSEFTVYTEF-------TEIHNLQPFTVYRIDVHACNHEVER--CSAAAFVFSRTKPAEKADDIPGTVTHEKDERVE-DTVVLRWPEPPRPSGLILMYEIKFRLGTEPEKHE-------CVSRQQYRELRGARL--------TNL-----GF--------GNYSVRVRATSLAGNGSWTEPVSFYVPPPHQAYENMLYLAITIPIIVLLALIALISSIIFIRKKRNNDRLGNGVLYASVNPEYFSAAEMYVPDEWEVSREKITLCR---ELGQGSFGMVYEGIAKGVVK----------DEPETKVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLG 1060          
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009485.1 (pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.119 bits (479), Expect = 1.567e-53
Identity = 100/216 (46.30%), Postives = 128/216 (59.26%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFV--------------SENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E F               S  +    A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI T A  PY+G+S+  V+++V  GG L+   +    + L  ++  CW YNP  RP+F +I+  L      +F   S+Y
Sbjct:   90 LVIMELMTRGDLKSYLRSLRPDAEDFTETIVLEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPA--CPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLHPSFHEFSFY 303          

HSP 2 Score: 70.8626 bits (172), Expect = 3.388e-13
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = 3
Query: 3228 YEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            Y  D WE++R  V M+     LG+G+FGMVY+G+ + +             E +  VA+KT+N  +T+ ER EF+NEA  MK F  +H+V+L G
Sbjct:    1 YIADEWEVERDKVKMMR---ELGQGTFGMVYEGLARGIVK----------GEDETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLG 81          
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009481.1 (pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene:ENSPMAG00000008570.1 transcript:ENSPMAT00000009481.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 4.935e-53
Identity = 100/207 (48.31%), Postives = 128/207 (61.84%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  YLR    + E   +   S L      A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI T A  PY+G+S+  V+++V  GG L+   +    + L  ++  CW YNP  RP+F +I+  L      +F   S+Y
Sbjct:  138 LVIMELMTRGDLKSYLRSLRPDAEKKPTRPPSSLPEMLQMAGEIADGMAYLNAKKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATQAEQPYQGLSNEQVLKFVMDGGLLVLPPA--CPERLQELIRKCWQYNPRMRPTFLEILDGLAPDLHPSFHEFSFY 342          

HSP 2 Score: 77.7962 bits (190), Expect = 9.009e-15
Identity = 41/108 (37.96%), Postives = 63/108 (58.33%), Query Frame = 3
Query: 3195 WVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            + S NP+Y+    +Y  D WE++R  V M+     LG+G+FGMVY+G+ + +             E +  VA+KT+N  +T+ ER EF+NEA  MK F  +H+V+L G
Sbjct:   35 YASVNPEYFSTADVYIADEWEVERDKVKMMRE---LGQGTFGMVYEGLARGIVK----------GEDETRVAIKTVNETATMRERYEFLNEASVMKSFNCHHVVRLLG 129          
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Match: INSR (insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091])

HSP 1 Score: 197.593 bits (501), Expect = 1.144e-52
Identity = 201/815 (24.66%), Postives = 346/815 (42.45%), Query Frame = 3
Query:  723 VCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQN--KITGRCEICGSECSK--KYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW--RTVEGYIG--------KPVVIDNLLPAKRYAFYAEAI-----RSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDC--DKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVP-----ANETYFK-----FTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKI 3062
            VC   C +           +CCH ECLGGC+  G E  C++C++    G CV  C    Y+Y   RC++   C     Q+  DY  ++   +    C+  C  G  +N  + +  C  C   C K  KY G V I+S+    E  GC  ++ ++ I I+ GG++++  L      + ++   ++I +SS++ +L FL++LRII+G+  ++ N            F V DN+NL +++D      + N+T+L G + F  N KLC  +I       V T T   +    +    NGD   C+ + L       S     ++ +   P        L+     KE   KNVS+++  ++C   +W  R +E   G          +++ +L P  +YA +  A         + N    S+V+Y+ T+    S P+++   + SS+++ + W  P +PNG VT YI+ W R  E    +    D C    K  RR  + S+  +     GNQ++ +     +KC  +C K Q  +  + ++   QF+  +  ++F+                H +I         R D    +   TD +T S  S  +L    ++++  P     A E  F       T L H+T Y  +IQAC     +                   + CS+ + +SA T P  + DNI    +   V  + + + W EP  PNG ++ Y ++Y+          +   CV+R  +  G                     + +R L PG Y   I+  +++  G+WT+ +HF+I
Sbjct:    1 VCPPECGRRA----CTKSGQCCHEECLGGCHQAGSEHHCLACRHYWHKGICVLDCPLGTYRYDGWRCVTAEFC-----QAPYDYSTQN--VLHHGDCLPDCPSGYIRNVTRNSMTCTKCDGPCPKVCKY-GNVNINSLTAAQELYGCTELDGNLTIDIR-GGNNIAAELETNLGLIEMVTGYVKIKRSSALVTLAFLKNLRIIRGDMLDEGNYS----------FYVLDNQNLQQLWD----WTKHNLTVLRGKLYFAFNHKLCMSEIYRM---EVVTGTYGRQSRTDLNPKENGDRTSCESKFLRFTGNETSSDKIKLEWYHTWP--KYDRDLLSYTVYYKEAPFKNVSEFDQQDACGSNSWTARDLEFRAGLNPQEMSNPSIILLSLKPWTQYAIFVRAFTLTTTSGDINNQGAKSEVVYIRTKANASSIPLDVIAGSNSSTQLVVKWRAPAYPNGNVTHYIVRWQRQHE--DPELRKHDYCNKVLKVPRREPATSSIDMEPGARGNQSELDTSLAPEKCC-ACPKTQAQLRQEAEEA--QFMKTF--ENFL----------------HNQIFATRLRNMHRPDRKRRDMFGTDNTTDSGNSTSSLIGS-EEVIPTPVVYTFAEEMVFGKERITITGLRHFTAYRIQIQACNHASEL-------------------VGCSAPAYVSARTQPHFDADNIT-GHVKCEVVKNIIYLQWKEPSDPNGLVVLYEVKYQLGGSRFNFSQIQQHCVSRSSYREGKG-------------------FQVRHLLPGDYTAHIRAISLSGNGSWTEPFHFRI 720          
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001705.1 (pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 gene:ENSPMAG00000001543.1 transcript:ENSPMAT00000001705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 1.141e-40
Identity = 77/206 (37.38%), Postives = 109/206 (52.91%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYLRKQGEEGEGFVSENQSH------------------LWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKL-LLGIMENCWLYNPDDRPSFFDIIQKL 4322
            ++ E M  GDL  YLR+   E     S   +                     A Q+A GM YL+E KFVHRDLA RNC++ + L++KI DFG+++ +Y   YY+      +P+RWM PES+    ++  SD+W++GV+LWEI +    PY GMSH +VI +V  G  L      +   L L  +M  CW + P DRPSF  +   L
Sbjct:   38 LLFEFMPHGDLNEYLRRCSSEAGLAASSPPARAPTSSGSEPVSLCCADKLFVATQVAAGMAYLAERKFVHRDLATRNCLVGNRLVVKISDFGLSQSIYAADYYKANENDAIPIRWMPPESIFYNRYTSESDVWAFGVVLWEIFSHGLQPYFGMSHEEVIYFVRDGNVLACP---DGCPLDLYNLMRLCWAHAPADRPSFASVQHVL 240          
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006975.1 (pep scaffold:Pmarinus_7.0:GL482517:17376:26740:1 gene:ENSPMAG00000006274.1 transcript:ENSPMAT00000006975.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 1.112e-39
Identity = 128/500 (25.60%), Postives = 230/500 (46.00%), Query Frame = 3
Query:  723 VCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVL----SNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPG-----KQQNKITGRCEICGSECSKK-YCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKP-----------------VVIDNLLPAKRYAFYAEAI------RSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYR----SLEIFGDDFFMEDVC 2105
            VC   C +       +    CCH ECLGGC    D + CV+C++ +    +  RCV  C    Y++K  RC++ + C  L        R   ++ + D  C  +C  G     + ++  +  C+ C   C K  Y G  +I S+    E  GC  IE   +    GG++++  L      +  +  S++I +S ++ SL F R+L  I G+S +  N+           F V DN+NL +++D     ++ N+TI +G + F+ N KLC  +I +      +T TK  + D  I   +NGD A C+   L    + ++     ++  S ++PD   ++     +F  +   +NV++++  ++C   +W +V+  +  P                 +++  L P  +YA + +A         R  N  + S +IYL T    PS P ++ + + SSS++ + W PP FPNG VT Y++ ++    + E++  D+ +   C
Sbjct:    1 VCDTKCGRRA----CSSAGDCCHDECLGGCSAPDDPLACVACRHYVHVDGAAARCVPDCPAGTYRFKGWRCVTAAFCRVLHEAC---VRECINWVLHDGECRPECPSGYTMENETRSDGSMSCKKCDGLCPKVCYVGTKVIDSVTAAQELHGCTIIEGNLVINIRGGNNIATELEANLGLIEEVTGSVKIKRSYALVSLSFFRNLHTIHGDSQDPGNHS----------FYVLDNQNLQQLWD----WDKHNLTIRKGKMFFHFNPKLCLSEIYTM---EEKTHTKGRQEDSDISLKTNGDQASCESTVLTFTQIQMTFDKILLRWQSYRLPD--YRDLLGFVVFYKEAPYQNVTEFDGQDACGSNSWTSVD--VDPPPLKGNGGGNSWGSSSPGILLRGLQPWTQYAIFVKAFVLTSSDEGRGNNGAK-SKIIYLRTNASTPSTPQDVFSVSNSSSQLLVKWRPPAFPNGNVTSYVVRWQQQAENTELYEFDYCLPGTC 471          
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 67.781 bits (164), Expect = 8.830e-12
Identity = 51/183 (27.87%), Postives = 80/183 (43.72%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYL----RKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPS 4298
            VIME ME G L   L    R    E    ++ENQ      +   G+ +L   K +HRD+ + N ++NS  ++KI DFG   ++      R    G     WMAPE +    + +  D+WS G++L E++     PY        +  ++  GS       + SK     ++ C   N + R S
Sbjct:  450 VIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGT--PYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIE-GEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRAS 629          
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 67.0106 bits (162), Expect = 2.185e-11
Identity = 50/167 (29.94%), Postives = 80/167 (47.90%), Query Frame = 3
Query: 3798 GYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPS 4298
            G LR+        +SEN+S  +  Q   G+ YL     +HRD+ A N ++++   +K+ DFG++  V           G L   WMAPE L +   S  SD+WS G  + E+LT  + PY  ++  + I Y  +  +     SF  S+ L   +  C++ N   RP+
Sbjct:  105 GSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTL---AGTL--NWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDAN-IYYAVENDTYYPPSSF--SEPLKDFLSKCFVKNMYKRPT 262          
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 66.6254 bits (161), Expect = 3.416e-11
Identity = 57/207 (27.54%), Postives = 94/207 (45.41%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLS--GYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLL------GIMENCWLYNPDDRPSFFDIIQKL--ELYADMNFRN 4352
            + +E +  G +   +R  G   E  +     HL   Q+  G+ YL     +HRD+ A N +++   I KI DFG++R    D Y   +   R  V WMAPE + +  GY +K  D+WS G I+ E+        R  S+ +V+  + K G   S        L L        ++ C+  NP+ RP+  +++     E+    NF++
Sbjct: 1255 LFLEYVAGGSVGSLIRMYGRFDEPLIK----HL-TTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK-SKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAK-VDIWSLGCIVLEMFAGK----RPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNETFNFKS 1450          
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 65.4698 bits (158), Expect = 3.482e-11
Identity = 53/198 (26.77%), Postives = 91/198 (45.96%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMA--------RDVYYDCYYRKENKGRLPVRWMAPESL---LSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHD---VIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDII 4313
            ++ME    G  +  L++    G   + E +      ++  G+ YL E + +HRD+ A N ++N   ++K+GDFG++        RD +    Y           WMAPE +   + GY  K +D+WS G+  +E+  L  LP   +S +D   V+  + K       G F  S      +  C +  P DRPS ++++
Sbjct:   91 IVMEYCGGGSCSDLLKRSYVNG---LPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKRDTFVGTPY-----------WMAPEVVCCEVDGYNEK-ADIWSLGITTYEL--LKGLP--PLSKYDPMKVMTNLPKRKPPKLQGPF--SDAAKDFVAGCLVKTPADRPSAYNLL 267          
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Match: PKH1 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh2p; PKH1 has a paralog, PKH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002898])

HSP 1 Score: 64.6994 bits (156), Expect = 1.051e-10
Identity = 48/211 (22.75%), Postives = 99/211 (46.92%), Query Frame = 3
Query: 3765 IMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMAR------------DVYYDCYYRKEN-KGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNS 4358
            ++E    GD  G ++K G      ++E  +  +A QI D +  L  +  +HRD+   N +++  + +K+ DFG A+              Y+D Y + ++  G     +++PE L   Y     D+W++G IL+++L     P++  + +   Q V K     + G     +++  +++   + +P+DR +   I   L  + ++NF + S
Sbjct:  202 LLEYAPHGDFLGLIKKYGS-----LNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGT--AEYVSPELLNDNYTDSRCDIWAFGCILYQMLA-GKPPFKAANEYLTFQKVMKIQYAFTAG---FPQIVKDLVKKLLVRDPNDRLTIKQIKAHL-FFHEVNFEDGS 400          
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Match: EDO47652 (Tyrosine-protein kinase receptor [Source:UniProtKB/TrEMBL;Acc:A7RLS3])

HSP 1 Score: 204.142 bits (518), Expect = 1.395e-58
Identity = 103/207 (49.76%), Postives = 131/207 (63.29%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQG-----EEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM+ GDL  +LR        E  E   +  Q    A +IADGM YL+  KFVHRDLAARNCM+N+ L +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD+WS+GV++WE+ TLAS PY G S+ +V++YV  GG +      +    L  +M  CW ++P  RP+F  II  +E      FR NS+Y
Sbjct:   95 LVVMELMDNGDLKNFLRSHRPEVTMESDEPPPTLQQMLQMAGEIADGMAYLAARKFVHRDLAARNCMVNANLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTSPSDVWSFGVVMWEMATLASQPYPGKSNEEVLKYVVDGGVMPKPD--DCPDRLFDLMTLCWQFSPKARPTFLSIISLIEEDLSQEFRENSFY 299          

HSP 2 Score: 64.3142 bits (155), Expect = 8.861e-11
Identity = 35/95 (36.84%), Postives = 55/95 (57.89%), Query Frame = 3
Query: 3225 IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +Y  D WE+ R+ + ++     LG GSFGMVY+G   ++            ++ +  VAVKT++ N++I +R EF+ EA  MK FQ  H+V+L G
Sbjct:    5 VYIADEWEVPREKIKLIR---ELGNGSFGMVYEGEATDIVP----------NKPKCKVAVKTVSENASIRDRIEFLQEASIMKAFQCNHVVRLLG 86          
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Match: EDO44510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVT8])

HSP 1 Score: 152.525 bits (384), Expect = 1.427e-40
Identity = 73/199 (36.68%), Postives = 116/199 (58.29%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLR-----------KQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKL 4322
            +VI+E   +G+L  +LR           K   + E   +   + + + QI+ GM +L+  K VHRDLAARN ++    ++K+ DFG+ARD+Y D  Y K   G LPV+WMAPESL    +++ +D+WS+G++LWEI+TL   PY G+    ++ Y+S+G  +      N    +  IM +CW+  PD RP F  ++++L
Sbjct:  115 MVIIEFAPYGNLLSFLRARREVFEPTWTKTNPDPEAEYTLVDTSMASYQISKGMEFLARKKCVHRDLAARNVLVGPDYVMKVSDFGLARDIYQDDLYVKTTSGLLPVKWMAPESLFDRVYTEKTDVWSFGILLWEIMTLGGTPYPGLPTEQLLDYLSEGQRMAQPQ--NCPLEIYTIMRDCWMQLPDQRPHFGTLVERL 311          
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Match: EDO34156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ51])

HSP 1 Score: 151.754 bits (382), Expect = 1.482e-40
Identity = 84/204 (41.18%), Postives = 123/204 (60.29%), Query Frame = 3
Query: 3747 DKMPLVIMELMEFGDLAGYLRK-QGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLL-SGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKL 4322
            D  PLVI+E +  GDL GYLRK +GEE + +          +S  Q   +A Q+ADGM YLS  K +HRDLAARN ++    + K+ DFGMA+DV  +  Y +  +GRLPV+W A E+L+  G ++  SD+WS+GV+L+EI T+   PY G++  D+   +  G  +      +++  L  +M +CW   PDDRP+F   +QKL
Sbjct:   87 DGRPLVIIEYVPHGDLLGYLRKSRGEEDDYYSDPEIKPKTSLSSQQLIRFAWQVADGMEYLSSQKIIHRDLAARNILVGEGEVCKVADFGMAKDVSNEDIYIRTTEGRLPVKWTAVEALIGGGEYTTLSDVWSFGVVLYEICTIGGEPYPGIAGKDIPDCLETGYRMPCPTHVDAT--LYQVMASCWATCPDDRPTFAS-LQKL 287          
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Match: EDO38078 (Predicted protein; Ret-like protein [Source:UniProtKB/TrEMBL;Acc:A7SE14])

HSP 1 Score: 152.14 bits (383), Expect = 1.637e-40
Identity = 82/200 (41.00%), Postives = 120/200 (60.00%), Query Frame = 3
Query: 3747 DKMPLVIMELMEFGDLAGYLRK-QGEEGEGF----------VSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLL-SGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDI 4310
            D  PLVI+E +  GDL GYLRK +GEE   +          +S  Q   +A Q+ADGM YLS  K +HRDLAARN ++    + K+ DFGMA+DV  +  Y +  +GRLPV+W A E+L+  G ++  SD+WS+GV+L+EI T+   PY G++  D+ +Y+  G  +      +++  L  IM +CW   PD RP+F  +
Sbjct:   87 DGRPLVIIEYVPHGDLLGYLRKSRGEEDSYYPDPEIKPKTSLSSQQLVRFAWQVADGMQYLSSQKIIHRDLAARNILVGEGEVCKVTDFGMAKDVQNEDIYIRTTEGRLPVKWTAIEALIGGGEYTTQSDVWSFGVVLYEICTIGGEPYPGIAGKDIPEYLEAGYRMSCPTHLDAT--LYEIMASCWATCPDMRPTFTSL 284          
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Match: EDO39761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S933])

HSP 1 Score: 148.673 bits (374), Expect = 2.762e-40
Identity = 78/190 (41.05%), Postives = 116/190 (61.05%), Query Frame = 3
Query: 3762 VIMELMEFGDLAGYLR--KQGEEGEGFVSENQSHLWAI--QIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQK 4319
            +I E M  GDL  YLR  K  E       ++   L  I  Q+A GM Y++ ++FVHRDLA RNC++ + +++KI DFGM+RDVY   YY+   +  LP+RW+APE+ L G F+  SD++SYGV+LWEI T    PY G ++ +V +++ KG  L      +  + +  IM++CW   P++R   F +IQK
Sbjct:   38 MIFEFMGEGDLNHYLRSAKPAESSAYKGPDDAKDLVGIAEQVAAGMEYVASLRFVHRDLATRNCLVGTDMVVKIADFGMSRDVYGSDYYKMSRETMLPIRWLAPEAFLYGKFTVKSDVYSYGVLLWEIFTFGLQPYYGYTNKEVTEFIKKGIHLGRPD--DCPQFVYLIMKDCWSREPEERVD-FGLIQK 224          
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Match: insra (insulin receptor [Source:NCBI gene;Acc:101166254])

HSP 1 Score: 361.688 bits (927), Expect = 4.488e-103
Identity = 316/1145 (27.60%), Postives = 510/1145 (44.54%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPNNCPRGENL----------QKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRRED-----HYAIEDDACVKQCSPG-KQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLE------ISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGE----CDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQT-VRVDEVVTNFPSTDISTISKPSIENLT-NHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +C S DIR   +++  L NCTVIEG L I ++  T        SFP L+ +T  L+++ V G ++L   FPNLT+IRG  L +NYA+V+ E   L  +GL +L  +  G VRI+ NP LCY++T++W+ I+        + N  +  C + CP   PRGE L           + CW    CQ +C   C    ++    D  +CCH +CLGGC        CV+C+ +   GRCV++C K F  YK  RC+S   C  L  +   +  R        Y I + AC+ +C  G    N     C  C   C K   G   + S+       GC  +    +    GG++++  L  +  +L  I   L + +S ++ SL F R LR+I+G      N            F   DN+NL +++D     ++  + IL+G + F+ N KLC  +I         T  K  ++   I   +NGD A C++  L    +        +K     P  S     L  + + KE   +NV++++  ++C   +W         R  EG   +      ++P K +  YA  +++++    E       S++IY+ T    PS P++  + + SSS+I L W PP  PNG +T Y+++Y+  +    + +  D C    K   R+ +Q ++   K  N  + +G+    C C K  +   K +      +D    +  + Y+       NE+            FEIK+    ++ + V      F +T  S    P  +  T    K +V V A E+    +NL H+T Y  EI AC          +KA+             CS  + +SA T P+E  D+I    I + V  ++V I W EP +PNG I+ Y + Y++     +L +    CV+R  +                   +K     L+ + PG Y  +I+  ++A  G+WT+   F +      +E+ +                       C+ +      + SSNP+Y     +YE D WE+ R  + +L     LG+GSFGMVY+G+ K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:    8 LCPSKDIRNNVTNLQTLENCTVIEGHLKILLMFKTKPENFRGISFPKLRVVTDYLLLFRVYGLESLSDLFPNLTVIRGNNLFFNYALVVFEMLQLRELGLHSLMNITRGAVRIEKNPDLCYLSTLDWSKILDTVEDNYIVANKNDRECGDVCPG-VPRGETLCPTTTLNGHFSERCWTQKFCQKMCPVQC----KHGACTDGGQCCHDQCLGGCLKPNSTSDCVACRGLQHEGRCVEQCPKKFVVYKGWRCVSSDFCQELHHRCRREKERSKSAECHEYVIHNGACIPECPSGYTTVNSSALNCSPCAGLCPKVCIGLKTVDSVTAAQALRGCTILNGSLVINLRGGNNIAAELEASLGQLEEITGYLTVRRSYALVSLSFFRKLRVIRGEEQEVGNYS----------FYALDNQNLRQLWD----WSKHKLAILQGRMFFHYNSKLCMSEIRRMEEV---TGLKDRRVKNEIALKTNGDRASCENHVLTFTQIRTMSDKIMIKWKPFWP--SDFRDLLGFMVLYKEAPFQNVTEFDGQDACGSNSWVIADVDPPRRASEGEKDQTEPGHLIMPLKPWTQYAIMVKTQLSASDEHQVNGAKSEIIYVRTNATRPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFYQR-QPEASELYKFDYCQKGMKLPSRVPTQVDSGEEKKWNQTEEEGQGKQCCTCPKTDKELKKEK------EDSEYRKTFENYL------HNEV------------FEIKRPRQRRSAMGVANQTLPFLTTAPSPTGIPDEDEKTFESTKTVVTVHAKESTV-ISNLRHFTSYQIEIHAC----------NKAIPT-----------CSMAAFVSARTMPEEKADDI-LGPIRSEVTENTVHIEWQEPATPNGIIILYEVIYKRLVDSEDLHY----CVSRKMY-------------------KKMHGCKLKVMHPGNYSVKIRATSLAGNGSWTQPSFFYVQD---LSEWES----------------------GCQTQGPSGPIYASSNPEYLSANDVYEEDEWEVPRDKIHILR---ELGQGSFGMVYEGLAKDIVK----------GEGETHVAVKTVNESASLRERIEFLNEASVMKAFTCHHVVRLLG 1019          

HSP 2 Score: 200.29 bits (508), Expect = 2.303e-51
Identity = 103/207 (49.76%), Postives = 129/207 (62.32%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    + E         L      A +IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N    L  +M+ CW YNP  RP+F +II+ L      +F+  S++
Sbjct: 1028 LVVMELMTHGDLKSYLRSLRPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMEGGFL--DRPENCPDRLHNLMQMCWQYNPKMRPAFQEIIEMLRDDLHPSFQEVSFF 1232          
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Match: insra (insulin receptor [Source:NCBI gene;Acc:101166254])

HSP 1 Score: 359.377 bits (921), Expect = 4.983e-102
Identity = 319/1151 (27.72%), Postives = 520/1151 (45.18%), Query Frame = 3
Query:  213 SNEKVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTSE-----YSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKET-NLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNF-CLEFCPNNCPRGENL----------QKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEM-CVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRRED-----HYAIEDDACVKQCSPG-KQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNW---------RTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLE------ISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGE----CDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQT-VRVDEVVTNFPSTDISTISKPSIENLT-NHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKIS--SDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            ++  +C S DIR   +++  L NCTVIEG L I ++  T        SFP L+ +T  L+++ V G ++L   FPNLT+IRG  L +NYA+V+ E   L  +GL +L  +  G VRI+ NP LCY++T++W+ I+        + N  +  C + CP   PRGE L           + CW    CQ +C   C    ++    D  +CCH +CLGGC        CV+C+ +   GRCV++C K F  YK  RC+S   C  L  +   +  R        Y I + AC+ +C  G    N     C  C   C K   G   + S+       GC  +    +    GG++++  L  +  +L  I   L + +S ++ SL F R LR+I+G      N            F   DN+NL +++D     ++  + IL+G + F+ N KLC  +I         T  K  ++   I   +NGD A C++  L    +        +K     P  S     L  + + KE   +NV++++  ++C   +W         R  EG   +      ++P K +  YA  +++++    E       S++IY+ T    PS P++  + + SSS+I L W PP  PNG +T Y+++Y+  +    + +  D C    K   R+ +Q ++   K  N  + +G+    C C K  +   K +      +D    +  + Y+       NE+            FEIK+    ++ + V      F +T  S    P  +  T    K +V V A E+    +NL H+T Y  EI AC          +KA+             CS  + +SA T P+E  D+I    I + V  ++V I W EP +PNG I+ Y + Y++     +L +    CV+R  +                   +K     L+ + PG Y  +I+  ++A  G+WT+   F +   SD ++        I   V+++++     +V    + +      + SSNP+Y     +YE D WE+ R  + +L     LG+GSFGMVY+G+ K++             E +  VAVKT+N ++++ ER EF+NEA  MK F  +H+V+L G
Sbjct:   53 AHADICPSKDIRNNVTNLQTLENCTVIEGHLKILLMFKTKPENFRGISFPKLRVVTDYLLLFRVYGLESLSDLFPNLTVIRGNNLFFNYALVVFEMLQLRELGLHSLMNITRGAVRIEKNPDLCYLSTLDWSKILDTVEDNYIVANKNDRECGDVCPG-VPRGETLCPTTTLNGHFSERCWTQKFCQKMCPVQC----KHGACTDGGQCCHDQCLGGCLKPNSTSDCVACRGLQHEGRCVEQCPKKFVVYKGWRCVSSDFCQELHHRCRREKERSKSAECHEYVIHNGACIPECPSGYTTVNSSALNCSPCAGLCPKVCIGLKTVDSVTAAQALRGCTILNGSLVINLRGGNNIAAELEASLGQLEEITGYLTVRRSYALVSLSFFRKLRVIRGEEQEVGNYS----------FYALDNQNLRQLWD----WSKHKLAILQGRMFFHYNSKLCMSEIRRMEEV---TGLKDRRVKNEIALKTNGDRASCENHVLTFTQIRTMSDKIMIKWKPFWP--SDFRDLLGFMVLYKEAPFQNVTEFDGQDACGSNSWVIADVDPPRRASEGEKDQTEPGHLIMPLKPWTQYAIMVKTQLSASDEHQVNGAKSEIIYVRTNATRPSVPLDPISSSNSSSQIILKWKPPNDPNGNITHYLVFYQR-QPEASELYKFDYCQKGMKLPSRVPTQVDSGEEKKWNQTEEEGQGKQCCTCPKTDKELKKEK------EDSEYRKTFENYL------HNEV------------FEIKRPRQRRSAMGVANQTLPFLTTAPSPTGIPDEDEKTFESTKTVVTVHAKESTV-ISNLRHFTSYQIEIHAC----------NKAIPT-----------CSMAAFVSARTMPEEKADDI-LGPIRSEVTENTVHIEWQEPATPNGIIILYEVIYKRLVDSEDLHY----CVSRKMY-------------------KKMHGCKLKVMHPGNYSVKIRATSLAGNGSWTQPSFFYVQDLSDPLYVVKIIIGPIICFVLLLLVSVAGFVVFKKNQTQGPSGPIYASSNPEYLSANDVYEEDEWEVPRDKIHILR---ELGQGSFGMVYEGLAKDIVK----------GEGETHVAVKTVNESASLRERIEFLNEASVMKAFTCHHVVRLLG 1095          

HSP 2 Score: 200.675 bits (509), Expect = 2.160e-51
Identity = 103/207 (49.76%), Postives = 129/207 (62.32%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LV+MELM  GDL  YLR    + E         L      A +IADGM YL+  KFVHRDLAARNCM+   L +KIGDFGM RD+Y   YYRK  KG LPVRWMAPESL  G F+  SD WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N    L  +M+ CW YNP  RP+F +II+ L      +F+  S++
Sbjct: 1104 LVVMELMTHGDLKSYLRSLRPDAENNPGRPPPTLKEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMEGGFL--DRPENCPDRLHNLMQMCWQYNPKMRPAFQEIIEMLRDDLHPSFQEVSFF 1308          
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101173298])

HSP 1 Score: 346.665 bits (888), Expect = 1.416e-97
Identity = 315/1152 (27.34%), Postives = 516/1152 (44.79%), Query Frame = 3
Query:  222 KVCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS--------EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINW---TSIVRQHGAPI--KLINMRNFCLEFCPNN--CPRGE---NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIED-IYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYIGK------PVVIDNLLPAKRYAFYAEAIRSRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRS----LEIFGDDFFMEDVCFTXXXXXXX-XXXXXXXXXXKTNNGNQNQGE-CDCDKCMESCNKNQILINIDKDDTI-MQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANE-----TYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTR---VNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKK-----YLERTRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +VC+S+DIR   S   +L NCTV+EG L+I +++  +          SFP L  IT  L+++ V G ++L   FPNL++IRG+ L YNYA+VI E T+L  IGL NLR +  G VR+  N  LCY+++++W   T +V  +   +  KL    N C     N+  CPR      L   CW  N CQ VC + C          D  +CCH +CLGGC     D  C  C +   N RCV  C    YK++  RCI+   C      S T      H+ I    C+  C     +NK     C  C   C  K+C   +I S++     +GC  I   + I+I+ G +  S+ L      +  ++  ++I  S ++ SL FLRSLR I G    +N             F   +N++L  ++D     +Q N+TI  G + F  N KLC  +I       +  KT ++   E     +NG+ A C  E  I+++ +   SS+T+K   +   +      +  +   KE+  +N+++++  + C   +W  V+  + +       V + +L P  +YA +  AI  +VE+       SD+IY+ T   +PS P +      SS+++ + W+ P+FPNG +T Y++ ++      E++  ++  +D+      S       +   + +K++     +G  C C K  E  ++       +KDD + ++  + Y+               +P D    ++  V  N         T FP       S    EN T+    +++ P +E      Y +  +L  +T Y  +I AC +   +                     C + + + A T P    D+I    +  R   V G  V + W EP  PNG +L Y ++YR                T PE         K+   S    +Q  G   L  L PG Y  +++  ++A  G+WT+S +F +       +   Y  I   +I+ +  A  + + ++  KK           + S NP+Y     +Y  D WE+ R+ + M   +  LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   35 EVCESMDIRNDISEFKVLENCTVVEGYLHILLISKKTTNNVEALRSLSFPKLTVITDHLLLFRVAGLESLSTLFPNLSVIRGRNLFYNYALVIYEMTSLKDIGLYNLRNITRGAVRVAKNSELCYLDSVDWSLITDVVFNNVFDLNKKLEECDNVCPGIMKNSPLCPRTSYTNKLDYRCWSSNHCQKVCPDQCK-----LACTDDGQCCHSQCLGGCSEPNSDRACSVCLHYFHNERCVPDCPPGTYKFEGWRCITFEMCSQAHLPSDT------HFVIHGGECMPDCPSDFTRNKTNPMLCTACNGPCD-KFCTSPVIDSVDAAQTLKGCTVINGHLDINIRRGDNIASE-LENFMGLIRTVKGYVKIRHSHALGSLSFLRSLRYINGEELIENTYS----------FFAINNQHLQSLWD----WSQHNLTIRAGRLFFRQNPKLCMSEI-----HKMWEKTGITVKPEGGDFRNNGEKASC--ESHILKIKSNVTSSYTIKLTWERYQVPEYGGLINFIVFYKESPFQNITEFDGQDGCGSNSWHMVDVDLSQDEKLDPKVTLQHLNPWTQYAIFVRAITLQVEDKHITGAKSDIIYIRTRPSSPSVPKDAHAYANSSTKLLVKWSRPVFPNGNLTYYLVRWQQQPEDRELYQHNYCSKDLKIPIRVSAGGFSDVEDGAKPTKSDLSGAKKGPCCTCQKTAEEKDR-------EKDDRVFIKMFENYLHNIVFYA--------RPPDRQRRDVVGVANN---------TLFPDGAQGNASLSPAENGTDGVPPVIEYPFSEEKVSTEYLEIPSLQPFTVYRIDIHACNEEVGL---------------------CGAGAFVFARTKPASEADDIPGKVVPERSDKVEGCMV-LHWPEPVVPNGLVLMYEVKYR--------------LGTEPE---------KHGCVSRRQYRQNRG-ARLTHLSPGNYSARVRAISLAGNGSWTESIYFYVPPPKRDDDVTFYLSIIIPIIVTLFIASLITILFFINKKRNSNRLGNGVLYASVNPEYISAAEMYTPDEWEVAREKITM---HKELGQGSFGMVYEGLAKGVVK----------DEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLG 1069          

HSP 2 Score: 199.519 bits (506), Expect = 5.493e-51
Identity = 100/205 (48.78%), Postives = 130/205 (63.41%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRK---QGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    +    +      +    A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TL+  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RP+F +II  ++   D +FR  S++
Sbjct: 1078 LVIMELMTRGDLKSHLRSLRNENSNSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVTEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLSEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPTFLEIINTIKDDLDPSFREVSFF 1280          
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Match: igf1ra (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101173298])

HSP 1 Score: 341.658 bits (875), Expect = 2.774e-96
Identity = 315/1151 (27.37%), Postives = 517/1151 (44.92%), Query Frame = 3
Query:  225 VCQSIDIRKR-SHVSLLTNCTVIEGDLYIAMVTLTS--------EYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINW---TSIVRQHGAPI--KLINMRNFCLEFCPNN--CPRGE---NLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCY-GEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGR-CEICGSECSKKYCGRVLIHSINDFSEAEGCYSIED-IYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYIGK------PVVIDNLLPAKRYAFYAEAIRSRVEN---WLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRS----LEIFGDDFFMEDVCFTXXXXXXX-XXXXXXXXXXKTNNGNQNQGE-CDCDKCMESCNKNQILINIDKDDTI-MQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANE-----TYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTR---VNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSI-FTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLER----TRWVSSNPDYWI---IYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +C+S+DIR   S   +L NCTV+EG L+I +++  +          SFP L  IT  L+++ V G ++L   FPNL++IRG+ L YNYA+VI E T+L  IGL NLR +  G VR+  N  LCY+++++W   T +V  +   +  KL    N C     N+  CPR      L   CW  N CQ VC + C          D  +CCH +CLGGC     D  C  C +   N RCV  C    YK++  RCI+   C      S T      H+ I    C+  C     +NK     C  C   C  K+C   +I S++     +GC  I   + I+I+ G +  S+ L      +  ++  ++I  S ++ SL FLRSLR I G    +N             F   +N++L  ++D     +Q N+TI  G + F  N KLC  +I       +  KT ++   E     +NG+ A C  E  I+++ +   SS+T+K   +   +      +  +   KE+  +N+++++  + C   +W  V+  + +       V + +L P  +YA +  AI  +VE+       SD+IY+ T   +PS P +      SS+++ + W+ P+FPNG +T Y++ ++      E++  ++  +D+      S       +   + +K++     +G  C C K  E  ++       +KDD + ++  + Y+            S  +P D    ++  V  N         T FP       S    EN T+    +++ P +E      Y +  +L  +T Y  +I AC +   +                     C + + + A T P    D+I    +  R   V G  V + W EP  PNG +L Y ++YR       L      CV+R ++                  +Q  G   L  L PG Y  +++  ++A  G+WT+S +F +      FT   N + +  +        L  ++ +  KK+   R      + S NP+Y     +Y  D WE+ R+ + M   +  LG+GSFGMVY+G+ K +            DE +  VA+KT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   22 ICESMDIRNDISEFKVLENCTVVEGYLHILLISKKTTNNVEALRSLSFPKLTVITDHLLLFRVAGLESLSTLFPNLSVIRGRNLFYNYALVIYEMTSLKDIGLYNLRNITRGAVRVAKNSELCYLDSVDWSLITDVVFNNVFDLNKKLEECDNVCPGIMKNSPLCPRTSYTNKLDYRCWSSNHCQKVCPDQCK-----LACTDDGQCCHSQCLGGCSEPNSDRACSVCLHYFHNERCVPDCPPGTYKFEGWRCITFEMCSQAHLPSDT------HFVIHGGECMPDCPSDFTRNKTNPMLCTACNGPCD-KFCTSPVIDSVDAAQTLKGCTVINGHLDINIRRGDNIASE-LENFMGLIRTVKGYVKIRHSHALGSLSFLRSLRYINGEELIENTYS----------FFAINNQHLQSLWD----WSQHNLTIRAGRLFFRQNPKLCMSEI-----HKMWEKTGITVKPEGGDFRNNGEKASC--ESHILKIKSNVTSSYTIKLTWERYQVPEYGGLINFIVFYKESPFQNITEFDGQDGCGSNSWHMVDVDLSQDEKLDPKVTLQHLNPWTQYAIFVRAITLQVEDKHITGAKSDIIYIRTRPSSPSVPKDAHAYANSSTKLLVKWSRPVFPNGNLTYYLVRWQQQPEDRELYQHNYCSKDLKIPIRVSAGGFSDVEDGAKPTKSDLSGAKKGPCCTCQKTAEEKDR-------EKDDRVFIKMFENYLHNICFYV-----SFSRPPDRQRRDVVGVANN---------TLFPDGAQGNASLSPAENGTDGVPPVIEYPFSEEKVSTEYLEIPSLQPFTVYRIDIHACNEEVGL---------------------CGAGAFVFARTKPASEADDIPGKVVPERSDKVEGCMV-LHWPEPVVPNGLVLMYEVKYR-------LGTEKHGCVSRRQY------------------RQNRG-ARLTHLSPGNYSARVRAISLAGNGSWTESIYFYVPPPKPQFT--INVWFLFLIPTGDDDVTLITILFFINKKRNSNRLGNGVLYASVNPEYISAAEMYTPDEWEVAREKITM---HKELGQGSFGMVYEGLAKGVVK----------DEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLG 1054          

HSP 2 Score: 199.519 bits (506), Expect = 4.688e-51
Identity = 100/205 (48.78%), Postives = 130/205 (63.41%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRK---QGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYY 4364
            LVIMELM  GDL  +LR    +    +      +    A +IADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+  SD+WS+GV+LWEI TL+  PY+GMS+  V+++V +GG L      N   +L  +M  CW YNP  RP+F +II  ++   D +FR  S++
Sbjct: 1063 LVIMELMTRGDLKSHLRSLRNENSNSQVLPPLKKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVTEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSFGVVLWEIATLSEQPYQGMSNEQVLRFVMEGGLLDKPD--NCPDMLFELMRMCWQYNPKMRPTFLEIINTIKDDLDPSFREVSFF 1265          
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Match: igf1rb (insulin-like growth factor 1 receptor [Source:NCBI gene;Acc:101163560])

HSP 1 Score: 333.183 bits (853), Expect = 1.702e-93
Identity = 305/1167 (26.14%), Postives = 514/1167 (44.04%), Query Frame = 3
Query:  186 ITFTDSFKLSNEKVC-QSIDIRKR-SHVSLLTNCTVIEGDLYIAMV---------TLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKE-TNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQH-----GAPIKLINMRNFCLEFCPNN--CPRGENLQKY---CWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYG-EGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-RCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE-DIYISIKEGGSSLSDILMKAFSKL-TIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHS-KVPDISLQNSALTALFMLKETT-KNVSQYELFNSCSEQNWRTVEGYIGKP-------VVIDNLLPAKRYAFYAEAIRSRVENWL---EISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYII-WYRSLEIFGDDFFMEDVCF------TXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEY-NQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTR----------WVSSNPDYWIIYEI---DVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            +  +   + +  K+C  SIDI    +   LL NCTV+EG L I ++          +    SFP L  IT  L+++ V G  +L   FPNLT+IRG+ L YNYA+VI E T+L  IGL NLR +  G +RI+ NP LCY+++I+W+SI+            +     + CL    NN  C +      Y   CW+ N CQ  C  SC +  + C      +CCHP+CLG C   + D  C +C +    GRC+  C    Y+++  RCIS   C      S   +   D + I    C+ +C  G  ++      C  C   C K   G+V I S++     +GC  I+ +++I+I+ G + +++  +++F+ L   +   +RI  S ++TSL FLRSLR I          +          F  +DN+ L  ++D K    Q N+TI  G + F  N KLC  +I       + TKT + +  +     +NGD A C+   L  +  +   +   +     + PD       ++ +   KE   +N++++E  + C   +W  V+  + +P       V++  L P  +YA + +A+   VE+       S V+Y+ T    P+ P +++  + SS+++ + W PP+ PNG  T Y+I W +  E    + F  + C        +  ++     +   + +K++    N+G C    C+  C K+  ++  +  D   +     + ++F+  +              F I    Y  +   +     + P       S  +     +   + ++    E   + + L  +T Y  ++ AC    N Q  E                 CS+   + + T P E  D++    +    +   V + W EP  PNG IL Y I+Y K   E+E       CV+R                   + Q + G   L +L PG Y  +++  ++A  G+WT    F ++          Y      ++ + +  + ++ C       L R R          + S NP+Y+   E+   D WE+ R+ + +      LG+GSFGMVY+GV K +            DE +  VAVKT+N ++++ ER EF+NEA  MK+F  +H+V+L G
Sbjct:   18 LALSSCLRPATAKICGPSIDIGNDINEFRLLENCTVVEGYLQILLIGDKNNNANQEVFRSLSFPKLTMITDYLLLFRVSGLDSLSTLFPNLTVIRGRNLFYNYALVIFEMTSLKDIGLYNLRNITRGAIRIEKNPELCYLDSIDWSSIMDAEFNNYIAGNKQSKECSDVCLGVTENNPLCRKAMIRNSYSYHCWNSNQCQKECPPSCGR--RACTAE--GKCCHPQCLGSCTAPDSDAACAACVHYFHQGRCMADCPPGTYRFEGWRCISAKVC------SKVHHPDFDTFVIHGGECMPECPSGYTRSATNSMHCTACDGLCDKVCDGKV-IDSMDAAQSLKGCTVIKGNLHINIRRGHNMVAE--LESFTGLIQRVTGYVRITHSHTLTSLAFLRSLRYI----------DGETLLEDMYAFSAFDNQQLQYLWDWK----QHNLTIKTGKLFFRANPKLCMSEI-----RKMWTKTGIREHFQETDFRNNGDRASCESTILRFKSNSTQSTRIILTWERYRPPDY---RDLISFIVYYKEAPFQNITEFEGQDGCGSNSWNMVDVEL-RPEKDSDPGVLLSGLKPWTQYAIFVKAVTLMVEDKFMPGAKSKVVYIRTSPSPPTMPRDVRAYSNSSTQLVVRWLPPVSPNGNRTYYLIRWQQQAE--DRELFQHNYCSKELKIPVRIAARGVGDQEEETKPTKSDTEGANKGPC----CL--CPKSPEVLEAEAADASYR----KVFENFLHNSIFTPRPADRRRRDVFGIANSTYAGRHKSLSNTSADPPPHTAGNSSGAAEPEPADQEYEFLEQSVTERELQISGLQPFTVYRVDVHAC----NRQVKE-----------------CSAAEFVFSRTKPAEKADDV-PGPVTWEGHKDWVFLRWPEPSHPNGLILLYEIKY-KLAAESE----KHECVSR------------------QLYQTQQGV-RLTNLSPGNYSVRVRATSLAGNGSWTPPLDFYVA--------ERYESALYAMVFVPIIIVILISCMVVMLVALNRKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITLCR---ELGQGSFGMVYEGVAKGVVK----------DEPETKVAVKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLG 1069          

HSP 2 Score: 201.06 bits (510), Expect = 1.402e-51
Identity = 103/202 (50.99%), Postives = 131/202 (64.85%), Query Frame = 3
Query: 3759 LVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL-----WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFR 4349
            LVIMELM  GDL  YLR    + + + S +   L      A QIADGM YL+  KFVHRDLAARNCM+     +KIGDFGM RD+Y   YYRK  KG LPVRWM+PESL  G F+ +SD+WS+GV+LWEI TLA  PY+G+S+  V+++V +GG L      N   +L  +M  CW YNP  RPSF +II  ++   D +F+
Sbjct: 1078 LVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNSNKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLEKPQ--NCPDMLFELMRMCWQYNPKMRPSFVEIIGSVKDELDPSFK 1277          
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 2801.16 bits (7260), Expect = 0.000e+0
Identity = 1446/1451 (99.66%), Postives = 1448/1451 (99.79%), Query Frame = 3
Query:  111 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYXXXXXXXXXXXXXXLLATRLESENSTKNFIQDS 4463
            MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTN P+TDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNI+AKNSSNSTNI QQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENST NFIQDS
Sbjct:    1 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNLPATDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENSTNNFIQDS 1451          
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 2778.05 bits (7200), Expect = 0.000e+0
Identity = 1439/1451 (99.17%), Postives = 1441/1451 (99.31%), Query Frame = 3
Query:  111 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYXXXXXXXXXXXXXXLLATRLESENSTKNFIQDS 4463
            MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTN P+TDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNI+AKNSSNSTNI QQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKG       FGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENST NFIQDS
Sbjct:    1 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNLPATDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKG-------FGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENSTNNFIQDS 1444          
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 2682.52 bits (6952), Expect = 0.000e+0
Identity = 1375/1379 (99.71%), Postives = 1377/1379 (99.85%), Query Frame = 3
Query:  111 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLL 4247
            MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTN P+TDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNI+AKNSSNSTNI QQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLL
Sbjct:    1 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNLPATDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLL 1379          
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Match: SMESG000042173.1 (SMESG000042173.1)

HSP 1 Score: 2576.97 bits (6678), Expect = 0.000e+0
Identity = 1361/1451 (93.80%), Postives = 1370/1451 (94.42%), Query Frame = 3
Query:  111 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGXXXXXXXXXXXXXGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYXXXXXXXXXXXXXXLLATRLESENSTKNFIQDS 4463
            MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTN P+TDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNI+AKNSSNSTNI QQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHR       ++  +L +                        LP R M+   ++  Y SK                                    GGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENST NFIQDS
Sbjct:    1 MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSHVSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGLYFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDKCMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYNQTVRVDEVVTNLPATDISTISKPSIENLTNHFKKMVQVPANETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIMAKNSSNSTNIIQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIGAVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRRKFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQFGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHLWAIQIADGMLYLSEMKFVHRSYGV---ILWEILTL----------------------ASLPYRGMSHHDVIQ-YVSK------------------------------------GGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENSTNNFIQDS 1389          
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Match: SMESG000041357.1 (SMESG000041357.1)

HSP 1 Score: 358.992 bits (920), Expect = 6.044e-102
Identity = 306/1136 (26.94%), Postives = 527/1136 (46.39%), Query Frame = 3
Query:  279 CTVIEGDLYIAMVT--LTSEYSFPTLKEITGSLVIYYVKGTKTLGL-YFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSLCYVNTINWTSI------VRQHGAPIKLINMRNFCLEFCPNNCPR---GENLQKYCWHHNTCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLSNGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDACVKQCSPGKQQNKITG-RCEICGSECSKKY---CGRVLIHSINDFSEAEGCYSIEDIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRIIXXXXXXXXXXXXXXXXXXXIVFEVYDNENLVEIFDEKVALNQLNITILEGSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKHEKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYELFNS-CSEQNWRTVE--------GYIGKPVV-------------IDNLLPAKRYAFYAEAIRSRVENWLEISDVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYRSLEIFGDDFFME--DVCFTXXXXXXXXXXXXXXXXXKTNNGNQNQGECD-CDKCMESCNKNQILINIDKDDTIMQF--LDEYITKSFIKQNEIPKSNWKPVDSGHFEIKKVEYN-QTVRVDEVVTNFP-STDISTISKPS------IENLTNHFKKMVQVPAN----ETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPCSSKSLISAHTSPKENMDNI----NESTINTRVNGSSVKIFWSEPKSPNGFILNYFIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGFYTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYXXXXXXXXXXXXXXXXXXXXYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRKDVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKTLNTNSTILERREFINEACYMKQFQSYHLVKLYG 3509
            CT++EG + I  ++  + +   FP L+E+T  +++ +   +    L  FPNL +IRG  L    A+++      ++   +LR +  G V +  N +LC V  I+W  I        +    + +   +  C   C N CP     +   + CW +NTCQ++C   C+  + YC +N+ + CCH +CLGGCYG+ ++ CV+CK +     CV  C   +Y++K  RC+ + EC           ++        + CVK+C      + I G +  + GS  + KY   CG + + S  D  + + CYS E + IS++ GG  LS  L   F  L I++  ++I++S+ + SL FL  L  I                  ++  ++  N  L +++            IL GSV F  NR LC   I +F+N   +   + S  D+ +I+ +NG +A C   +L + V+ +   S  V+ + K    S     L+ L   +  + N+      +S CS   W  +E        G   KP               I +L PA  Y  Y E  R   ++   IS+ ++ TT  + PS P  +++ + + +EIRL+W PPL PNG +T+YII+Y    +F + F  E  +  F +S++    ++  +N    TN+  Q Q  CD C  C ++C +N       K + +++    D ++    + Q +  K+N   + S         YN +++ +    T  P +  +S + KP+      +EN ++   K +++PA+    + Y   TNL ++TEY  EI AC   Q+  +   + L K   +       CS+++  S  T    ++D I    +++ +N       + + W  P   NG IL Y + YR           +  C+      +  N+ AKNSS  +         + +R+   G YEFQI    +A  G W+    F+    ++  +Y       + V I+ +  + +L+ Y   KK     R++ +  +++ +   D W I+ +DV +L    P+G+G+FG+VY G LK L +PA+  ++       M VAVKT++  +TI +  +F++EAC MKQF  YH+V L G
Sbjct:   10 CTIVEGKVVITHLSKHMCNSLRFPVLREVTDYILLAFSSCSDDTSLNIFPNLMVIRGYELLQGCALIVYYNAWRHLNFTSLRSIASGNVLVALNSNLCNVGNIDWKYINDNRDEASKSTKKLYIKTNKFICSNSCSNMCPERTIDDQKTRVCWSYNTCQSICDSICSSKDLYCHVNNTSICCHKQCLGGCYGKTNKDCVACKKLRYKEECVLSCPVGYYEFKGSRCVHKIECS----------KKNMSITFNPNRCVKECPSDLFASFINGTKYCVNGSTITTKYNKECGLLFLKSFKDLDQVKNCYSAERVIISLQIGGRDLSLKLRDVFKNLRIVKQFIQIMRSNFLESLTFLNPLLEI---------QGQAFIGQTNVTLDITANNILSKLWTPDPKFR-----ILSGSVRFLANRNLCKTFIHNFIN---KIGLQNSLFDKELIDSTNGHIAICTFIQLNLTVVEV--KSQCVRLYWKNKQTS-NYQILSGLTYYRSISTNMKNGGFSDSGCSSVIWSVIEAQCKNNDSGVKLKPTSLWPQDGGEEFICEISSLKPATSYQVYLE-FRFTRQDSAAISNHVFFTTSTEMPSPPQIIESISSAHNEIRLSWKPPLHPNGLITKYIIYYWKNALFENSFNNEYSNKDFCQSETNTGFKTSQSNFEKATNDNFQPQAMCDTCSICKKTCERNP-----QKQEELLEMTRFDTHMHSVILVQRK--KNNPNSLSS---------YNSKSIAIPNNFTTMPLNATVSVVHKPTPKSNIPMENTSSINVKQIEIPASALKTQYYHVITNLDYFTEYLIEIVACHQRQSNFNYSQQILMKFSMND------CSNRASTSTRTERSPDVDVIPPIYDKTYMNITGINKEITVTWKIPPKVNGLILFYQLNYRIKKDNVIFQAWTPNCINSKSITSIKNLHAKNSSYQS---------FIIRNPFSGTYEFQIMIRTLAGNGNWSPLESFEYKETNVDVDYVLKITFSSTVFIMAVALISILIWYLAWKK---NQRYILTRNNHYFLSGQDEWNIEFQDVKLL---LPIGKGNFGVVYSGELKKLESPAKSIFVNA--SLPMKVAVKTVSQAATIEDIVQFLSEACLMKQFLGYHIVHLIG 1075          

HSP 2 Score: 214.542 bits (545), Expect = 7.682e-56
Identity = 106/214 (49.53%), Postives = 140/214 (65.42%), Query Frame = 3
Query: 3711 FGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGE-GFVSENQSHLWAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDCYYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYRGMSHHDVIQYVSKGGSL-LSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDIIQKLELYADMNF 4346
             G +   I ++    PLV+MELME GDL+ YL +  E  + G +   QS LWAIQIADGM YL+  +FVHRDLAARNC++++ L IKIGDFG+ + +  + YYRK  + + PVRWMAPESL S  ++  +D+WSYGV+L+EI TL SLPY GMSH  VI++V  GG L L      SS  LL +M  CW +   DRP+F  I++ L  Y +  F
Sbjct: 1074 IGIYAGNIQKNSSLYPLVVMELMENGDLSNYLHQYAERSDKGMIDGKQSLLWAIQIADGMCYLACKRFVHRDLAARNCLVDADLNIKIGDFGLTKSINENDYYRKRGRAKAPVRWMAPESLRSAVYTTKTDVWSYGVVLYEISTLGSLPYSGMSHESVIEFVRDGGKLDLDDLKIPSS--LLDVMTWCWSFYDTDRPTFMRILEYLVPYVNNEF 1285          
The following BLAST results are available for this feature:
BLAST of insulin receptor-like 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INSR4.315e-10529.12insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
INSR1.129e-10429.21insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
IGF1R1.348e-9827.73insulin like growth factor 1 receptor [Source:HGNC... [more]
IGF1R2.875e-9727.73insulin like growth factor 1 receptor [Source:HGNC... [more]
INSRR1.656e-8926.77insulin receptor related receptor [Source:HGNC Sym... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
daf-21.366e-4827.09Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.506e-4827.02Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.506e-4827.02Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.616e-4827.09Insulin-like receptor Insulin-like receptor subuni... [more]
daf-21.821e-4827.02Insulin-like receptor Insulin-like receptor subuni... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
InR4.097e-5830.00gene:FBgn0283499 transcript:FBtr0290232[more]
InR4.097e-5830.00gene:FBgn0283499 transcript:FBtr0290230[more]
InR4.097e-5830.00gene:FBgn0283499 transcript:FBtr0084121[more]
InR4.097e-5830.00gene:FBgn0283499 transcript:FBtr0290231[more]
Sdr8.199e-4327.47gene:FBgn0038279 transcript:FBtr0083004[more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insra7.215e-10628.96insulin receptor a [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
insrb1.491e-10228.63insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
igf1rb4.133e-9527.30insulin-like growth factor 1b receptor [Source:ZFI... [more]
igf1ra5.526e-9527.43insulin-like growth factor 1a receptor [Source:ZFI... [more]
igf1ra6.109e-9527.46insulin-like growth factor 1a receptor [Source:ZFI... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
INSRR5.425e-13728.24insulin receptor related receptor [Source:NCBI gen... [more]
INSR1.491e-9727.98insulin receptor [Source:NCBI gene;Acc:100492718][more]
INSR1.800e-9728.13insulin receptor [Source:NCBI gene;Acc:100492718][more]
INSR1.974e-9627.33insulin receptor [Source:NCBI gene;Acc:100492718][more]
INSR4.172e-9627.35insulin receptor [Source:NCBI gene;Acc:100492718][more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Insr3.622e-10028.17insulin receptor [Source:MGI Symbol;Acc:MGI:96575][more]
Insrr7.493e-9126.04insulin receptor-related receptor [Source:MGI Symb... [more]
Insrr7.493e-9126.04insulin receptor-related receptor [Source:MGI Symb... [more]
Igf1r1.889e-7331.34insulin-like growth factor I receptor [Source:MGI ... [more]
Ros15.064e-4644.50Ros1 proto-oncogene [Source:MGI Symbol;Acc:MGI:979... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25410|MIPR_LYMST1.835e-10929.43Putative molluscan insulin-related peptide(s) rece... [more]
sp|P06213|INSR_HUMAN2.072e-10429.12Insulin receptor OS=Homo sapiens OX=9606 GN=INSR P... [more]
sp|P24062|IGF1R_RAT2.897e-10127.79Insulin-like growth factor 1 receptor OS=Rattus no... [more]
sp|P15127|INSR_RAT1.185e-9928.02Insulin receptor OS=Rattus norvegicus OX=10116 GN=... [more]
sp|P15208|INSR_MOUSE2.534e-9928.17Insulin receptor OS=Mus musculus OX=10090 GN=Insr ... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1T3F20.000e+099.21Receptor protein-tyrosine kinase OS=Schmidtea medi... [more]
C7DT900.000e+033.18Receptor protein-tyrosine kinase (Fragment) OS=Sch... [more]
A0A4Z2D6S70.000e+033.31Insulin receptor-related protein isoform 1 OS=Schi... [more]
A0A419Q5J70.000e+030.67Receptor protein-tyrosine kinase OS=Clonorchis sin... [more]
A0A4S2JRR20.000e+031.40Receptor protein-tyrosine kinase OS=Opisthorchis f... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insra1.730e-9928.10insulin receptor [Source:NCBI gene;Acc:103039445][more]
insra3.860e-9927.68insulin receptor [Source:NCBI gene;Acc:103039445][more]
insrb6.834e-9927.63insulin receptor b [Source:ZFIN;Acc:ZDB-GENE-02050... [more]
igf1rb4.582e-9427.50insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1ra1.146e-6629.88insulin-like growth factor 1 receptor [Source:NCBI... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009485.11.567e-5346.30pep scaffold:Pmarinus_7.0:GL477866:1219:4704:1 gen... [more]
ENSPMAT00000009481.14.935e-5348.31pep scaffold:Pmarinus_7.0:GL477866:614:5163:1 gene... [more]
INSR1.144e-5224.66insulin receptor [Source:HGNC Symbol;Acc:HGNC:6091... [more]
ENSPMAT00000001705.11.141e-4037.38pep scaffold:Pmarinus_7.0:GL487204:7598:9057:-1 ge... [more]
ENSPMAT00000006975.11.112e-3925.60pep scaffold:Pmarinus_7.0:GL482517:17376:26740:1 g... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SKM18.830e-1227.87Member of the PAK family of serine/threonine prote... [more]
CDC152.185e-1129.94Protein kinase of the Mitotic Exit Network; locali... [more]
BCK13.416e-1127.54MAPKKK acting in the protein kinase C signaling pa... [more]
SPS13.482e-1126.77Putative protein serine/threonine kinase; localize... [more]
PKH11.051e-1022.75Serine/threonine protein kinase; involved in sphin... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476521.395e-5849.76Tyrosine-protein kinase receptor [Source:UniProtK... [more]
EDO445101.427e-4036.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341561.482e-4041.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380781.637e-4041.00Predicted protein; Ret-like protein [Source:UniPr... [more]
EDO397612.762e-4041.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
insra4.488e-10327.60insulin receptor [Source:NCBI gene;Acc:101166254][more]
insra4.983e-10227.72insulin receptor [Source:NCBI gene;Acc:101166254][more]
igf1ra1.416e-9727.34insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1ra2.774e-9627.37insulin-like growth factor 1 receptor [Source:NCBI... [more]
igf1rb1.702e-9326.14insulin-like growth factor 1 receptor [Source:NCBI... [more]
back to top
BLAST of insulin receptor-like 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042173.10.000e+099.66SMESG000042173.1[more]
SMESG000042173.10.000e+099.17SMESG000042173.1[more]
SMESG000042173.10.000e+099.71SMESG000042173.1[more]
SMESG000042173.10.000e+093.80SMESG000042173.1[more]
SMESG000041357.16.044e-10226.94SMESG000041357.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30018177
GenBankAEM45794.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018177 ID=SMED30018177|Name=insulin receptor-like 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4739bp
ATTGGATAAATTGACTCATGTAGTTGAAATGTTGAATGCTTAAAAATGTT
TAAAATATAATTATCAAAATATTTTAATCTGTCAACATTGATTCATTTTT
TTGCTTAATAATGAATTTTAGGAAATCTTTGAAATATTTCTTAAAAATTT
CTCTCATCTTTAACATAATAAATCTATATCAAGCTATTACATTTACGGAC
TCCTTCAAATTATCCAATGAAAAAGTTTGTCAATCAATTGATATTAGAAA
ACGAAGCCATGTCAGTCTATTAACTAATTGTACAGTGATTGAAGGCGATC
TTTATATTGCAATGGTAACCCTGACTTCAGAATATAGTTTTCCAACGTTA
AAGGAAATCACGGGATCTCTAGTTATTTATTACGTGAAAGGAACGAAAAC
TTTAGGATTATATTTTCCAAATTTGACTATAATTCGAGGCCAAACTCTTG
CATACAATTATGCAGTTGTGATAAAAGAAACAAATTTATTGTATATTGGT
TTGGTAAATCTTCGACTTGTTATGTTTGGAGGTGTACGCATCGACAATAA
TCCTTCACTGTGCTACGTTAATACCATCAATTGGACCAGTATCGTTCGTC
AACATGGAGCTCCAATCAAACTTATAAATATGAGAAATTTTTGTCTGGAA
TTTTGTCCAAACAATTGTCCTCGTGGGGAAAATTTGCAGAAATATTGCTG
GCATCACAATACATGTCAAAATGTGTGCTCAGAAAGTTGTGCTAAAAATA
ACCAATATTGTTTCATGAATGATCCCAACAGGTGTTGTCATCCAGAATGT
TTAGGTGGCTGTTACGGTGAAGGAGACGAGATGTGCGTTTCGTGCAAAAA
TGTTTTGTCTAATGGTCGTTGTGTTAAAAAATGTGACAAATTCTTTTACA
AATATAAAAATAGAAGATGTATTAGTGAATCTGAGTGCATGAATTTATCA
TCACAGTCCAGCACGGATTACCGCCGTGAAGACCATTATGCCATTGAAGA
TGATGCTTGTGTCAAACAATGTTCACCCGGAAAACAACAAAATAAAATTA
CAGGTCGATGTGAAATTTGTGGGTCTGAATGCTCAAAAAAATATTGTGGC
CGAGTTCTCATTCACAGTATAAATGATTTCAGTGAAGCAGAAGGGTGCTA
CTCAATCGAGGATATTTATATTAGCATAAAAGAAGGCGGATCGTCCTTGT
CCGATATTTTGATGAAAGCATTCTCTAAGTTAACAATCATTGAGAACTCA
TTAAGAATTGTAAAATCATCTTCGATAACTTCATTGGATTTTCTCAGGTC
ACTTCGAATCATAAAAGGGAATTCAGCAAATAAAAATAACAACGAAACCA
CGAACGGAAGTAATAAGTCTATAGTTTTTGAAGTGTATGACAATGAAAAT
TTGGTGGAAATATTTGACGAAAAAGTGGCATTGAATCAGTTAAACATCAC
GATTTTGGAAGGTTCTGTGTCGTTTAATTTGAATAGGAAATTGTGCCCTG
AAAAAATACTTTCTTTTTTGAATTCTAATGTCCAGACGAAAACTAAACTC
TCTAAATTGGATGAAAGAATTATCAATGTTTCTAATGGTGACATGGCATT
CTGTAAGCATGAAAAATTAATTGTCCAAGTATTAAACATTTCCGATTCTT
CCTTCACAGTCAAGTGCCATTCAAAGGTTCCTGATATATCGCTCCAGAAC
AGTGCGTTGACTGCTTTATTTATGTTGAAAGAGACGACAAAAAATGTTTC
GCAGTATGAATTATTCAACAGTTGTTCTGAGCAAAATTGGCGAACTGTAG
AAGGATACATTGGAAAACCGGTAGTGATAGATAATTTATTGCCAGCCAAG
CGATATGCTTTTTACGCTGAAGCCATCCGTTCCCGAGTAGAAAACTGGCT
TGAAATAAGTGATGTCATTTATCTTACGACTGAGAGAAAAAATCCATCTC
AACCTATAAATTTAAAAACTGAAACTCTTAGTAGCAGTGAAATAAGATTA
ACGTGGAATCCACCCTTATTTCCGAATGGGGAAGTTACTAGATATATTAT
TTGGTATAGAAGCTTAGAAATATTTGGAGATGATTTTTTTATGGAAGACG
TTTGTTTTACAAAATCTAAATCTCAAAGAAGGATTCAATCTCAATCGAAC
AATAGAATTTCTAAAACAAACAATGGAAACCAGAACCAAGGAGAATGTGA
TTGTGACAAGTGCATGGAGTCATGTAACAAGAATCAAATTTTAATAAACA
TTGATAAAGATGATACTATTATGCAGTTCCTTGATGAATACATAACCAAG
TCTTTTATAAAACAAAATGAAATTCCGAAATCAAATTGGAAGCCAGTCGA
TTCCGGCCACTTTGAAATAAAAAAAGTTGAATACAATCAAACAGTTCGCG
TTGATGAAGTTGTTACAAATTTCCCTTCCACAGACATTAGTACAATTAGT
AAGCCTTCAATCGAAAATCTTACAAATCACTTCAAAAAAATGGTTCAAGT
CCCAGCTAATGAAACCTATTTTAAATTTACTAATCTTCATCATTACACTG
AATATTTCTTTGAAATTCAAGCTTGTCAAGATTTACAAAATGTGCAGTCT
TCAGAATCTAAAGCATTATCCAAAAATGGTACTTCGAAAAATGTCTTAAA
TTTGCCATGCAGTTCAAAGTCACTCATCAGTGCACATACATCTCCCAAAG
AAAATATGGATAATATCAATGAGTCTACAATAAATACCCGTGTAAATGGA
AGTTCTGTCAAAATCTTTTGGTCAGAGCCTAAATCTCCAAATGGATTTAT
TCTGAATTACTTCATTAGATATCGAAAATACCCTTATGAAGCTGAATTGG
ACTGGCTAAGTACACCATGTGTCACACGACCAGAGTGGTTAAATGGTACA
AACATAGTGGCCAAGAATTCGTCAAATTCTACCAACATCAATCAACAAAA
ATCCGGATTTTATACATTAAGAGATTTAAAACCTGGTAAATATGAATTTC
AAATTAAACCATTTGCGATAGCTACAGAAGGAGCCTGGACAAAATCATAC
CATTTCAAAATATCTTCCGATTCCATATTCACCGAATATCGAAATTACTT
CATTATCGGGGCGGTTGTTATCATCATTATTCTCTGTGCTTTGTTTGTCC
TTGTATGTTATTATTGCAAAAAGAAATACTTAGAGAGAACGCGTTGGGTT
TCTTCAAATCCGGACTATTGGATTATTTATGAAATTGATGTTTGGGAAAT
TGACAGAAAAGACGTGGATATGCTTGAATGGAATTATCCTCTGGGAAGAG
GAAGTTTTGGAATGGTTTATAAAGGTGTGCTAAAGAATTTAACAACGCCA
GCACGTGATAAATATCTTAGAACCTTGGATGAAAAGCAAATGTTTGTGGC
CGTTAAGACACTTAATACAAATTCAACAATATTGGAGAGGAGAGAGTTCA
TCAATGAAGCTTGTTATATGAAGCAATTTCAAAGTTATCATCTAGTCAAA
TTATATGGAATAGTCAGCAAGGTTAATAATTCTAAAATCAGTAAAAAAGG
TTACAGAAGAAAGTTTAAATGTTTTGGGCATTCTGTTATGTCTAGAGTTA
AATGTCCACTGAATTGGAATTCTCTTAATAGAATTAACATTTTAAAGTTA
TTTGATTCAAAGGCTTCTGAAATAAAAGAACGACAAATTGATGACATTGC
TGCTGCTCAGTTTGGTTCTTTTAAAGCCACAATATCTCAGCATTTCGATA
AAATGCCTCTTGTAATAATGGAGTTGATGGAATTTGGTGATCTAGCGGGA
TATTTGCGAAAACAAGGTGAAGAAGGTGAAGGTTTTGTTTCAGAAAATCA
AAGTCATCTCTGGGCCATACAAATTGCAGATGGAATGTTGTACTTATCAG
AAATGAAATTCGTTCATAGGGATTTGGCGGCGAGAAATTGCATGATTAAC
AGTCTTCTCATTATTAAAATAGGTGATTTTGGAATGGCTAGAGATGTTTA
CTACGATTGCTACTATAGAAAGGAAAATAAAGGTCGGCTGCCAGTTCGAT
GGATGGCACCAGAATCTTTATTATCCGGATACTTCAGTAAAAGTTCTGAT
TTGTGGTCATATGGAGTTATTCTGTGGGAAATTTTAACTTTAGCTTCATT
ACCATATCGTGGTATGTCTCATCATGATGTAATTCAATATGTTTCCAAAG
GAGGGTCACTACTTAGTACTGGATCTTTCAACAGTTCCAAATTGTTATTA
GGTATAATGGAAAATTGTTGGCTGTATAATCCGGATGATCGGCCGTCATT
TTTCGACATTATTCAGAAACTTGAATTATATGCTGACATGAATTTCCGAA
ATAATAGTTATTATTTTCAAAAACAACAAACAGATTTTCAGACTCAAGAA
CAAGATTTATTGGCCACTCGATTGGAAAGCGAAAACTCAACCAAAAATTT
TATCCAAGATTCCTGATAGATTCAGTTTCTTCAACACAGAATCGTTTTTC
TTTATTGATTCAGGGATATTCTCGTTTTCTTCGAATATTTTCAATATTTC
TATCACCATTTTTTTACTCACATGCACAATATAAATTGGAGATTTTTCTG
AAAAAATACAATTTGACCGAAACATTGTAATTTGTGTATATAAAATCAGA
ACTTTTCTATTTTCCATTATTATTTCTTCTATGTGTGATAAAATTGATGA
GATAATATTTGTGATAGGAAAGTCAATGAATAAACCCAG
back to top

protein sequence of SMED30018177-orf-1

>SMED30018177-orf-1 ID=SMED30018177-orf-1|Name=SMED30018177-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
LGLFIDFPITNIISSILSHIEEIIMENRKVLILYTQITMFRSNCIFSEKS
PIYIVHVSKKMVIEILKIFEENENIPESIKKNDSVLKKLNLSGILDKIFG
*
back to top

protein sequence of SMED30018177-orf-2

>SMED30018177-orf-2 ID=SMED30018177-orf-2|Name=SMED30018177-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1452bp
MNFRKSLKYFLKISLIFNIINLYQAITFTDSFKLSNEKVCQSIDIRKRSH
VSLLTNCTVIEGDLYIAMVTLTSEYSFPTLKEITGSLVIYYVKGTKTLGL
YFPNLTIIRGQTLAYNYAVVIKETNLLYIGLVNLRLVMFGGVRIDNNPSL
CYVNTINWTSIVRQHGAPIKLINMRNFCLEFCPNNCPRGENLQKYCWHHN
TCQNVCSESCAKNNQYCFMNDPNRCCHPECLGGCYGEGDEMCVSCKNVLS
NGRCVKKCDKFFYKYKNRRCISESECMNLSSQSSTDYRREDHYAIEDDAC
VKQCSPGKQQNKITGRCEICGSECSKKYCGRVLIHSINDFSEAEGCYSIE
DIYISIKEGGSSLSDILMKAFSKLTIIENSLRIVKSSSITSLDFLRSLRI
IKGNSANKNNNETTNGSNKSIVFEVYDNENLVEIFDEKVALNQLNITILE
GSVSFNLNRKLCPEKILSFLNSNVQTKTKLSKLDERIINVSNGDMAFCKH
EKLIVQVLNISDSSFTVKCHSKVPDISLQNSALTALFMLKETTKNVSQYE
LFNSCSEQNWRTVEGYIGKPVVIDNLLPAKRYAFYAEAIRSRVENWLEIS
DVIYLTTERKNPSQPINLKTETLSSSEIRLTWNPPLFPNGEVTRYIIWYR
SLEIFGDDFFMEDVCFTKSKSQRRIQSQSNNRISKTNNGNQNQGECDCDK
CMESCNKNQILINIDKDDTIMQFLDEYITKSFIKQNEIPKSNWKPVDSGH
FEIKKVEYNQTVRVDEVVTNFPSTDISTISKPSIENLTNHFKKMVQVPAN
ETYFKFTNLHHYTEYFFEIQACQDLQNVQSSESKALSKNGTSKNVLNLPC
SSKSLISAHTSPKENMDNINESTINTRVNGSSVKIFWSEPKSPNGFILNY
FIRYRKYPYEAELDWLSTPCVTRPEWLNGTNIVAKNSSNSTNINQQKSGF
YTLRDLKPGKYEFQIKPFAIATEGAWTKSYHFKISSDSIFTEYRNYFIIG
AVVIIIILCALFVLVCYYCKKKYLERTRWVSSNPDYWIIYEIDVWEIDRK
DVDMLEWNYPLGRGSFGMVYKGVLKNLTTPARDKYLRTLDEKQMFVAVKT
LNTNSTILERREFINEACYMKQFQSYHLVKLYGIVSKVNNSKISKKGYRR
KFKCFGHSVMSRVKCPLNWNSLNRINILKLFDSKASEIKERQIDDIAAAQ
FGSFKATISQHFDKMPLVIMELMEFGDLAGYLRKQGEEGEGFVSENQSHL
WAIQIADGMLYLSEMKFVHRDLAARNCMINSLLIIKIGDFGMARDVYYDC
YYRKENKGRLPVRWMAPESLLSGYFSKSSDLWSYGVILWEILTLASLPYR
GMSHHDVIQYVSKGGSLLSTGSFNSSKLLLGIMENCWLYNPDDRPSFFDI
IQKLELYADMNFRNNSYYFQKQQTDFQTQEQDLLATRLESENSTKNFIQD
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR036116FN3_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR003961FN3_dom
IPR006212Furin_repeat
IPR000494Rcpt_L-dom
IPR013783Ig-like_fold
IPR006211Furin-like_Cys-rich_dom
IPR002011Tyr_kinase_rcpt_2_CS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR032675LRR_dom_sf
IPR011009Kinase-like_dom_sf
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005515protein binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 1220..1233
score: 44.5
coord: 1375..1397
score: 35.66
coord: 1261..1279
score: 59.52
coord: 1329..1351
score: 52.7
coord: 1310..1320
score: 63.14
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 1215..1404
e-value: 8.5E-59
score: 198.9
coord: 1057..1138
e-value: 2.3E-10
score: 40.2
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 612..830
e-value: 6.0E-6
score: 35.8
coord: 867..974
e-value: 0.026
score: 23.7
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 747..844
score: 6.478
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 869..987
score: 6.77
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 614..707
score: 9.444
IPR003961Fibronectin type IIICDDcd00063FN3coord: 612..650
e-value: 3.38486E-8
score: 50.5727
IPR003961Fibronectin type IIICDDcd00063FN3coord: 876..983
e-value: 1.67679E-8
score: 51.3431
IPR006212Furin-like repeatSMARTSM00261furin_3coord: 222..264
e-value: 1.5E-8
score: 44.4
IPR006212Furin-like repeatCDDcd00064FUcoord: 225..270
e-value: 3.86068E-10
score: 54.4472
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 1055..1404
e-value: 1.8E-71
score: 253.4
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 661..1123
e-value: 9.9
score: 1.7
coord: 1248..1450
e-value: 2.6E-45
score: 152.6
coord: 1216..1249
e-value: 76.0
score: -1.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1200..1411
e-value: 3.1E-52
score: 179.2
NoneNo IPR availableGENE3DG3DSA:2.10.220.10coord: 253..324
e-value: 5.9E-12
score: 47.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 1029..1143
e-value: 2.1E-22
score: 81.0
NoneNo IPR availablePANTHERPTHR24416:SF106INSULIN-LIKE GROWTH FACTOR 1 RECEPTORcoord: 1216..1440
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 1216..1440
NoneNo IPR availablePANTHERPTHR24416:SF106INSULIN-LIKE GROWTH FACTOR 1 RECEPTORcoord: 26..713
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 26..713
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 990..1138
NoneNo IPR availablePANTHERPTHR24416:SF106INSULIN-LIKE GROWTH FACTOR 1 RECEPTORcoord: 990..1138
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 326..500
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 36..202
NoneNo IPR availableTMHMMTMhelixcoord: 996..1018
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 349..466
e-value: 1.3E-7
score: 31.7
coord: 56..161
e-value: 9.3E-20
score: 70.8
IPR006211Furin-like cysteine-rich domainPFAMPF00757Furin-likecoord: 179..327
e-value: 2.6E-21
score: 76.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 862..989
e-value: 1.6E-14
score: 55.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 615..715
e-value: 1.9E-10
score: 43.2
coord: 742..860
e-value: 6.2E-6
score: 28.6
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 33..252
e-value: 7.4E-62
score: 210.7
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 325..500
e-value: 1.6E-30
score: 107.7
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 1267..1279
IPR002011Tyrosine-protein kinase, receptor class II, conserved sitePROSITEPS00239RECEPTOR_TYR_KIN_IIcoord: 1295..1303
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1055..1407
score: 32.881
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 225..324
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 551..827
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 876..983
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 1029..1405