Sodium/potassium-transporting ATPase subunit beta-1 isoform 2

Overview
NameSodium/potassium-transporting ATPase subunit beta-1 isoform 2
Smed IDSMED30018173
Length (bp)1078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 (SMED30018173) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 (SMED30018173) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 (SMED30018173) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 (SMED30018173) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018173

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30018173SMESG000064592.1 dd_Smed_v4_6559_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018173SMESG000064592.1 DN290772ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30018173SMESG000064592.1 DN290772ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30018173SMESG000064592.1 dd_Smed_v6_6559_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018173SMESG000064592.1 dd_Smed_v4_6559_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018173SMESG000064592.1 dd_Smed_v4_6559_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30018173SMESG000064592.1 dd_Smed_v4_6559_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30018173SMESG000064592.1 dd_Smed_v4_6559_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Match: ATP1B2 (ATPase Na+/K+ transporting subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:805])

HSP 1 Score: 92.4337 bits (228), Expect = 9.092e-21
Identity = 73/265 (27.55%), Postives = 126/265 (47.55%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR---TPTN-ISNF----CIFNKTMLGPCA----DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N RT    GRTG +W  ++L+++ FY  LTA F   +++ + + +S  TP      +    TPG+   P+      ++  +  ES   + +++  +NK FL+ + D   +     C   R    P N + N+    C FN+T LG C+           +G+ CV+IK+N++  +         +    V C G+   DA NLG  V +P         G I  +YFP+  +K   NY  P VA++F  ++ NV + ++C +
Sbjct:   20 FVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVML-QTVSDHTPKYQDRLA----TPGLMIRPKTENLDVIVNVSDTES---WDQHVQKLNK-FLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFY-----AGANQSMNVTCAGKRDEDAENLGNFVMFP-------ANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRI 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Match: ATP4B (ATPase H+/K+ transporting subunit beta [Source:HGNC Symbol;Acc:HGNC:820])

HSP 1 Score: 90.1225 bits (222), Expect = 6.792e-20
Identity = 77/289 (26.64%), Postives = 124/289 (42.91%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTP-FRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDN--------RTPTNISNFCIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPV---YYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            A   E++    +  +FQ+   + +N  TG + GRT   W  + LY++ FY+V+T  F   +Y+ M + + P TP ++    S     PG+   P +  E GL +  +   N  +      ++ F     P  Q  S  +NC+          R P +    C F   ML  C   ADP    + GK C  IK+N+I  +LP       SN +    D         LG+P+   YYP   T ++        YFP+  +K   +Y +P VA +   + +N  + I C +
Sbjct:    2 AALQEKKTCGQRMEEFQR---YCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLM-QTVDPYTPDYQDQLRS-----PGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDS--INCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLP-------SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLH-------YFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKV 265          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Match: ATP4B (ATPase H+/K+ transporting subunit beta [Source:HGNC Symbol;Acc:HGNC:820])

HSP 1 Score: 90.1225 bits (222), Expect = 6.792e-20
Identity = 77/289 (26.64%), Postives = 124/289 (42.91%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTP-FRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDN--------RTPTNISNFCIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPV---YYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            A   E++    +  +FQ+   + +N  TG + GRT   W  + LY++ FY+V+T  F   +Y+ M + + P TP ++    S     PG+   P +  E GL +  +   N  +      ++ F     P  Q  S  +NC+          R P +    C F   ML  C   ADP    + GK C  IK+N+I  +LP       SN +    D         LG+P+   YYP   T ++        YFP+  +K   +Y +P VA +   + +N  + I C +
Sbjct:    2 AALQEKKTCGQRMEEFQR---YCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLM-QTVDPYTPDYQDQLRS-----PGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDS--INCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLP-------SNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLH-------YFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKV 265          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 72.4034 bits (176), Expect = 1.697e-13
Identity = 72/275 (26.18%), Postives = 117/275 (42.55%), Query Frame = 2
Query:  119 NKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIY-IFMNKIISPKTPFRTGTNSILTFT-----PGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISN------FCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRN 898
             K Q    +L++        RTG +W  ++L +  FY  L A     +Y +F+   ISP  P         TFT     PG+   P       L    +      +  Y+ ++N F L+ + D       ++C   +      N       C F ++ L  C+   DP     +G+ C+ +K+N+I G+ P + DP       V C  Q + D N++    YYPE  + ++ Y   P  Y+      NY SP VA+ F ++ KN A+ +QC L+ 
Sbjct:   84 QKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLT--ISPYIP---------TFTERVKPPGVMIRP---FAHSLNFNFNVSEPDTWQHYVISLNGF-LQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDP-----VKVSCKVQ-RGDENDIRSISYYPESASFDLRY--YP--YYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKG 333          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 66.2402 bits (160), Expect = 1.266e-11
Identity = 67/279 (24.01%), Postives = 110/279 (39.43%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL--NCSD-NRTPTNISNF---------CIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLP-------------MIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTN---QKNYYSPTVAIQFPEMSKNVAIMIQC 886
            F++N       GRTG +W +++L+++ FY  L   F   I + +  I   K  ++          PG+   P+  I+   I    N+        L+ V   FL+ + D       +  +C D    P    +F         C F    LG C+   D     K GK C+ IK+N++ G+ P             M  +PNV     V C G+   D + +G   Y+    +        P  Y+P+     Q  Y  P +A+QF  ++ +  I I+C
Sbjct:   15 FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQD-----RVAPPGLTQIPQ--IQKTEISFRPNDPKSYEAYVLNIVR--FLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLP---VQCTGKRDEDKDKVGNVEYFGLGNSPG-----FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIEC 276          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 110.538 bits (275), Expect = 1.269e-27
Identity = 72/277 (25.99%), Postives = 127/277 (45.85%), Query Frame = 2
Query:  101 KVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF----------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC 886
            + K +P  F +   FLYN+  G + GRTG +WCQ+ +++I FYI L+AFF   + IF+ + + PK P   G  +I+   PG+   P +       L   N + +  +  Y+  ++ +  K     +    G + +++   T+   F C F+  +       A  +   KSGK CV + +N++ GW P+  D     E            ++C+G    D  +LGK  Y PE          I   Y+P+    +Y  P   ++F  + +N  ++++C
Sbjct:    4 EAKAEPETFAQ---FLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFL-RTLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG--------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVEC 268          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 110.538 bits (275), Expect = 1.380e-27
Identity = 72/277 (25.99%), Postives = 127/277 (45.85%), Query Frame = 2
Query:  101 KVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF----------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC 886
            + K +P  F +   FLYN+  G + GRTG +WCQ+ +++I FYI L+AFF   + IF+ + + PK P   G  +I+   PG+   P +       L   N + +  +  Y+  ++ +  K     +    G + +++   T+   F C F+  +       A  +   KSGK CV + +N++ GW P+  D     E            ++C+G    D  +LGK  Y PE          I   Y+P+    +Y  P   ++F  + +N  ++++C
Sbjct:   18 EAKAEPETFAQ---FLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFL-RTLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG--------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVEC 282          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 105.916 bits (263), Expect = 7.387e-26
Identity = 73/291 (25.09%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDL-QNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPCADPEKEL--KSGKLCVYIKVNKIYGWLPM----------IVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL------RNIKNSYKPIKFEIMLLSK 949
             FLYN++ G + GRTG +W Q+I+++I FY  L AF+   + IFM K + PK P   G  +I+   PG+   P +       L   N      +  YL  +  +  K   +  +    G   S++    N     C F+ ++       + +   KSGK CV I +N++ GW P           + D   +    ++C G    D  ++GK  Y P           I   Y+P+   K Y  P   ++F  + +N  ++++C         +I +    + FE+M+  K
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFM-KTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPS--------NGIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVEDK 312          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 105.916 bits (263), Expect = 7.387e-26
Identity = 73/291 (25.09%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDL-QNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPCADPEKEL--KSGKLCVYIKVNKIYGWLPM----------IVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL------RNIKNSYKPIKFEIMLLSK 949
             FLYN++ G + GRTG +W Q+I+++I FY  L AF+   + IFM K + PK P   G  +I+   PG+   P +       L   N      +  YL  +  +  K   +  +    G   S++    N     C F+ ++       + +   KSGK CV I +N++ GW P           + D   +    ++C G    D  ++GK  Y P           I   Y+P+   K Y  P   ++F  + +N  ++++C         +I +    + FE+M+  K
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFM-KTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPS--------NGIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVEDK 312          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 105.916 bits (263), Expect = 7.387e-26
Identity = 73/291 (25.09%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDL-QNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPCADPEKEL--KSGKLCVYIKVNKIYGWLPM----------IVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL------RNIKNSYKPIKFEIMLLSK 949
             FLYN++ G + GRTG +W Q+I+++I FY  L AF+   + IFM K + PK P   G  +I+   PG+   P +       L   N      +  YL  +  +  K   +  +    G   S++    N     C F+ ++       + +   KSGK CV I +N++ GW P           + D   +    ++C G    D  ++GK  Y P           I   Y+P+   K Y  P   ++F  + +N  ++++C         +I +    + FE+M+  K
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFM-KTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPS--------NGIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVEDK 312          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Match: nrv3 (gene:FBgn0032946 transcript:FBtr0081519)

HSP 1 Score: 120.939 bits (302), Expect = 2.575e-31
Identity = 89/311 (28.62%), Postives = 141/311 (45.34%), Query Frame = 2
Query:  110 IKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINAN---PRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPC-ADPEKELKSGKLCVYIKVNKIYGWLPMI------------------------VDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCS--LRNIKNSYKP----IKFEIML 940
            +K  K++    FL+N  T    GRTG +W +++L++I FY  LT FF A+  +F   + + K P     N ++   PG+      P  ++ES L+   S++ +    KY       FLK++ DL+  +  +NCS    P +    C  + +   PC AD        + C+++K+NKIY W+P I                        + PN +N  +V C+G+   D  N+    YYP +          P  YFPF N + Y  P VA+QF  +   V I I+C    RNI +        + FE+M+
Sbjct:   14 VKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEK-PKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNY--KYWVDETSRFLKSYQDLEKQNQ-VNCSFEHPPQD-DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG--------FPRYYFPFKNIQGYIPPIVAVQF-TVETGVLINIECKAWARNINHDRSDRRGSVHFELMV 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Match: nrv3 (gene:FBgn0032946 transcript:FBtr0081518)

HSP 1 Score: 120.939 bits (302), Expect = 2.575e-31
Identity = 89/311 (28.62%), Postives = 141/311 (45.34%), Query Frame = 2
Query:  110 IKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINAN---PRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPC-ADPEKELKSGKLCVYIKVNKIYGWLPMI------------------------VDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCS--LRNIKNSYKP----IKFEIML 940
            +K  K++    FL+N  T    GRTG +W +++L++I FY  LT FF A+  +F   + + K P     N ++   PG+      P  ++ES L+   S++ +    KY       FLK++ DL+  +  +NCS    P +    C  + +   PC AD        + C+++K+NKIY W+P I                        + PN +N  +V C+G+   D  N+    YYP +          P  YFPF N + Y  P VA+QF  +   V I I+C    RNI +        + FE+M+
Sbjct:   14 VKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEK-PKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNY--KYWVDETSRFLKSYQDLEKQNQ-VNCSFEHPPQD-DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG--------FPRYYFPFKNIQGYIPPIVAVQF-TVETGVLINIECKAWARNINHDRSDRRGSVHFELMV 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Match: nrv3 (gene:FBgn0032946 transcript:FBtr0081520)

HSP 1 Score: 120.939 bits (302), Expect = 2.575e-31
Identity = 89/311 (28.62%), Postives = 141/311 (45.34%), Query Frame = 2
Query:  110 IKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINAN---PRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPC-ADPEKELKSGKLCVYIKVNKIYGWLPMI------------------------VDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCS--LRNIKNSYKP----IKFEIML 940
            +K  K++    FL+N  T    GRTG +W +++L++I FY  LT FF A+  +F   + + K P     N ++   PG+      P  ++ES L+   S++ +    KY       FLK++ DL+  +  +NCS    P +    C  + +   PC AD        + C+++K+NKIY W+P I                        + PN +N  +V C+G+   D  N+    YYP +          P  YFPF N + Y  P VA+QF  +   V I I+C    RNI +        + FE+M+
Sbjct:   14 VKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEK-PKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNY--KYWVDETSRFLKSYQDLEKQNQ-VNCSFEHPPQD-DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG--------FPRYYFPFKNIQGYIPPIVAVQF-TVETGVLINIECKAWARNINHDRSDRRGSVHFELMV 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Match: nrv3 (gene:FBgn0032946 transcript:FBtr0333355)

HSP 1 Score: 117.087 bits (292), Expect = 6.373e-30
Identity = 90/313 (28.75%), Postives = 141/313 (45.05%), Query Frame = 2
Query:  110 IKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINAN---PRMSIESGLILATSNESNPIFTKYLSAVNKFFLK--TFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPC-ADPEKELKSGKLCVYIKVNKIYGWLPMI------------------------VDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCS--LRNIKNSYK----PIKFEIML 940
            +K  K++    FL+N  T    GRTG +W +++L++I FY  LT FF A+  +F   + + K P     N ++   PG+      P  ++ES L+   S++ +    KY       FLK  T+ DL+  +  +NCS    P +    C  + +   PC AD        + C+++K+NKIY W+P I                        + PN +N  +V C+G+   D  N+    YYP +          P  YFPF N + Y  P VA+QF  +   V I I+C    RNI +        + FE+M+
Sbjct:   14 VKMGKWEGFKKFLWNSETSQCLGRTGSSWAKILLFYIIFYAALTGFFAAIFTVFYQTLDNEK-PKWMLDNGLIGSNPGLGFRPMPPEANVESTLVWYESSKKDNY--KYWVDETSRFLKYHTYQDLEKQNQ-VNCSFEHPPQD-DKVCGIDFSSFSPCTADNNFGYHVARPCIFLKLNKIYNWIPEIYNDSKTLPDHMPEELKQHIKEKQSLRPNETNVVWVSCEGENPADVENIKARDYYPRMG--------FPRYYFPFKNIQGYIPPIVAVQF-TVETGVLINIECKAWARNINHDRSDRRGSVHFELMV 312          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0332370)

HSP 1 Score: 105.531 bits (262), Expect = 1.175e-25
Identity = 87/312 (27.88%), Postives = 139/312 (44.55%), Query Frame = 2
Query:  113 KPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANP-RMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLN---CSDNRT--PTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPN----------VSNET--------FVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC-----------SLRNIKNSYKPIKFEIML 940
            +P K Q     +YN + G   GRTG +W QL+L++  FYIVL A F   +   ++  IS   P     +S++   PG+   P     E G ++A   +  P  + Y   +   FL+ +    N + G +   C   +   PT++   C+ N  + G C+       K+ + C+++K+NKI+GW+P + D            V NET        +V C+G    D  N     Y+P            P+ Y+PF NQ  Y SP VA+QF    K   + ++C           S+R+ K S   + F+I+L
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKK-PAESDYWIELIDDFLRDY----NHTEGRDMKHCGFGQVLEPTDV---CVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG--------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGS---VTFQILL 308          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 91.2781 bits (225), Expect = 1.468e-20
Identity = 69/273 (25.27%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR-----TPTNISNF----CIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQ----GK----PDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F +N RT   CGRT  +W  ++L+++ FYI L   F   +Y+ +  +   +  ++   +     TPG+   P+      L +A + E    + +Y+ A+N  FL  + D   +     C  ++         + NF    C F +++L  C+   D       GK C+ IK+N++ G LP           +V C  +    GK     D++ LG+  YYP   T N+       +Y+P+  +K   NY  P VA++F  +++N  + ++C +
Sbjct:   12 FFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDRLS-----TPGMMIRPK---GEQLEIAYTTEYTETWERYVQALNN-FLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLPA----KDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGTFNL-------MYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECKI 264          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 91.2781 bits (225), Expect = 1.468e-20
Identity = 69/273 (25.27%), Postives = 124/273 (45.42%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR-----TPTNISNF----CIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQ----GK----PDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F +N RT   CGRT  +W  ++L+++ FYI L   F   +Y+ +  +   +  ++   +     TPG+   P+      L +A + E    + +Y+ A+N  FL  + D   +     C  ++         + NF    C F +++L  C+   D       GK C+ IK+N++ G LP           +V C  +    GK     D++ LG+  YYP   T N+       +Y+P+  +K   NY  P VA++F  +++N  + ++C +
Sbjct:   12 FFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTLDDHRPTYQDRLS-----TPGMMIRPK---GEQLEIAYTTEYTETWERYVQALNN-FLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLPA----KDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGTFNL-------MYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECKI 264          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 85.8853 bits (211), Expect = 1.205e-18
Identity = 74/283 (26.15%), Postives = 129/283 (45.58%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR-----TPTNISN----FCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            AKEDE+++            +F +N RT  + GRT  +W  ++L+++ FY  L   F   +Y+ +  +   +  ++         TPG+   P+      L +  S E+   +  Y+ A++  FLK + + Q +    +C+ ++        N+ N     C FN+T L  C+   D       GK C+ IK+N++ G  P           +V C G  K DA ++G+  Y+P   T N+ Y   P  Y+    Q NY  P VA++F  +S N  + ++C +
Sbjct:    2 AKEDEKKESG-------SWKDFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGVFCLTMYVMLLTLDDYQPTWQD-----RLATPGMMIRPK---GEALEIVYSRENTESWELYVQALDS-FLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKP----GKDGQSPYVTC-GAKKEDAESIGEIAYFPPNGTFNLMY--YP--YYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKI 259          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Match: atp1b1b (ATPase Na+/K+ transporting subunit beta 1b [Source:ZFIN;Acc:ZDB-GENE-001127-4])

HSP 1 Score: 85.8853 bits (211), Expect = 1.825e-18
Identity = 73/281 (25.98%), Postives = 119/281 (42.35%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFL-----KTFPDLQNSSAG------LNCSDNRTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF--------------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQ---KNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N       GRTG +W ++ L+++ FY  L   F   I I +  +   K  ++          PG+   PR S +S + +   +E +  F  Y+  + +F       K   ++Q  + G       N  D  +   +   C F++  LGPC+   DP    K GK C+  K+N+I  + P    P VSNE+               +HC  + + DA  LG+  YY          G  P  Y+P+  +     Y  P VAIQF  ++ N  + I+C +
Sbjct:   29 FVWNSEKKEFLGRTGGSWAKIFLFYLIFYGCLAGIFIGTIQILLLTLSDYKPTWQDRVAP-----PGLTHFPR-SDKSEIAINLDDEVS--FLNYVKVMREFLTSYDQEKQLDNMQFENCGESPLDYKNRGDLESDVGVRRACQFSREWLGPCSGLDDPYFGFKEGKPCLIAKLNRIVNFRPK---PPVSNESIPEEVQHKVQPYLIPIHCTNKKEEDAGKLGEVRYYG-------FGGGFPLQYYPYYGKLLHPQYLQPLVAIQFLNITPNTDMRIECKV 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Match: atp1b4 (ATPase Na+/K+ transporting subunit beta 4 [Source:ZFIN;Acc:ZDB-GENE-070412-1])

HSP 1 Score: 82.4185 bits (202), Expect = 3.965e-17
Identity = 68/260 (26.15%), Postives = 108/260 (41.54%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR-------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            +L+N  T    GR+G +W  ++L++   YI L A F   +   M   ISP  P    T +     PG+   P +    G  +A +      + +Y   +    LK + D   S   + C  N          +     C FN++ LG C+   D +     G+ C+ +K+N+I G+LP    P       V C G  K     LG+  ++P     N  + +    Y+      NY SP VA+QF  +  +  + IQC L
Sbjct:   79 YLWNAETKEFMGRSGKSWSLILLFYAALYIFLAAMFAGCMCCLMWS-ISPYAP----TYNDRVMPPGMTMFPHVDTAHGFDIAFNASDRSSWRRYAKTLEA-HLKPYDDGLQSRRNIACKGNAYFMQEDLEESAERKACQFNRSSLGACSGLQDKDFGYSKGRPCILVKMNRILGYLPGQGTP-----VNVTC-GLKKGSTEVLGEVKFFP-----NPNFDLRYYPYYGKLRHVNYSSPLVAVQFLNVQHDTPLHIQCKL 321          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 89.7373 bits (221), Expect = 1.069e-19
Identity = 78/279 (27.96%), Postives = 128/279 (45.88%), Query Frame = 2
Query:  119 NKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKI--ISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNC-----SDNRTPTNISNF----CIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF-VHCDGQGKPDANNLGKPVYYPEIKTENIT-----YGVIPNLYFPFTN---QKNYYSPTVAIQFPEMSKNVAIMIQC 886
            N+F++   F++N RT    GRT  +W  ++ +++ FY  LT  F   +Y+ +  I   +PK   R      LT +PG+   P+      L +  S   N  +  Y+S +N   L  + D      G  C     +      ++ N+    C F ++ LG C+   DP     +G  C+ IK+NKI  + P ++ P++SN +  ++C G        LG   YYP     N T      G +  +YFP+     QKNY  P VA++F  ++ N  + +QC
Sbjct:   15 NEFKE---FMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALSMYVMLQTIDEYTPKYWDR------LT-SPGLMIRPKTDT---LEIVYSISGNSSWAPYVSQLNS-MLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVI-PSLSNTSITINCTGTTANMDQMLGSRTYYPSSNPSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQC 278          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Match: tmem141 (transmembrane protein 141 [Source:Xenbase;Acc:XB-GENE-996967])

HSP 1 Score: 85.1149 bits (209), Expect = 3.874e-18
Identity = 78/281 (27.76%), Postives = 123/281 (43.77%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDN-----RTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNET--FVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQF--PEMSKNVAIMIQCSLRNI--KNSYKPIKFEI 934
            FL+N  T    GRT   W  + LY+  FY+++   F   IY  M  +     PF       L  +PG+   P    +  + L  +   N  +   ++++   FL  +          NCSDN       P   S  C F   MLG C+   D     KSG  C++IK+N+I  ++P        N+T   V+C  +      +LG   YYP     N TYG I   YFP+  +K   NY +P VA++   P ++K ++++ + S   I   N + P + ++
Sbjct:   20 FLWNPDTSEFMGRTFAKWVYISLYYAAFYVIMIGIFALSIYSLMKTM----NPFVPDYQDELK-SPGVTMRPDPYGDEVIELFYNKAENSTYLPLVTSLCD-FLSVYNKTVQEKMNANCSDNTRMSCANPKENSKSCQFTTDMLGNCSWEHDHTFGYKSGTPCLFIKMNRIINFVP-------GNKTVPLVNCSAE----HGDLGDVHYYP----GNDTYGTIGFQYFPYCGKKMQPNYTNPLVAVKLLNPPLNKELSVVCKVSGHGITSDNPHDPYEGKV 279          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 79.7221 bits (195), Expect = 3.392e-16
Identity = 70/294 (23.81%), Postives = 127/294 (43.20%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL--RNIKNSYKPIKF 928
             + ++EE+ K      Q   +F++N     + GR   +W  ++L++   Y  L   F   +Y  +   ISP  P    T     F PG+   P+    + L  A ++     ++ Y  ++N  FL+ + D       L C+  +              C F++++L  C+   DP      GK C+ IK+N+I G+      P      +V C+   K D + LG   +YP  K + + Y      Y+      NY SP +A+QF  + +N  + +QC +  ++I + ++  +F
Sbjct:   29 GETNQEEQKKTWGEWIQDMKHFIWNPEKKEVLGRDKRSWALILLFYSVLYCFLAGMFALCMYGLL-ATISPYVP----TYRERVFPPGLTIRPQA---NALYFAFNSSERSTWSSYAESLNT-FLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGYQAGSGIP-----IYVTCEVL-KADMSYLGPISFYPSDKFDLMYYP-----YYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRF 302          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 79.7221 bits (195), Expect = 3.569e-16
Identity = 70/294 (23.81%), Postives = 127/294 (43.20%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL--RNIKNSYKPIKF 928
             + ++EE+ K      Q   +F++N     + GR   +W  ++L++   Y  L   F   +Y  +   ISP  P    T     F PG+   P+    + L  A ++     ++ Y  ++N  FL+ + D       L C+  +              C F++++L  C+   DP      GK C+ IK+N+I G+      P      +V C+   K D + LG   +YP  K + + Y      Y+      NY SP +A+QF  + +N  + +QC +  ++I + ++  +F
Sbjct:   32 GETNQEEQKKTWGEWIQDMKHFIWNPEKKEVLGRDKRSWALILLFYSVLYCFLAGMFALCMYGLL-ATISPYVP----TYRERVFPPGLTIRPQA---NALYFAFNSSERSTWSSYAESLNT-FLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGYQAGSGIP-----IYVTCEVL-KADMSYLGPISFYPSDKFDLMYYP-----YYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRF 305          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 79.7221 bits (195), Expect = 3.676e-16
Identity = 70/294 (23.81%), Postives = 127/294 (43.20%), Query Frame = 2
Query:   80 AKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL--RNIKNSYKPIKF 928
             + ++EE+ K      Q   +F++N     + GR   +W  ++L++   Y  L   F   +Y  +   ISP  P    T     F PG+   P+    + L  A ++     ++ Y  ++N  FL+ + D       L C+  +              C F++++L  C+   DP      GK C+ IK+N+I G+      P      +V C+   K D + LG   +YP  K + + Y      Y+      NY SP +A+QF  + +N  + +QC +  ++I + ++  +F
Sbjct:   33 GETNQEEQKKTWGEWIQDMKHFIWNPEKKEVLGRDKRSWALILLFYSVLYCFLAGMFALCMYGLL-ATISPYVP----TYRERVFPPGLTIRPQA---NALYFAFNSSERSTWSSYAESLNT-FLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGYQAGSGIP-----IYVTCEVL-KADMSYLGPISFYPSDKFDLMYYP-----YYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRF 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Match: Atp1b2 (ATPase, Na+/K+ transporting, beta 2 polypeptide [Source:MGI Symbol;Acc:MGI:88109])

HSP 1 Score: 93.9745 bits (232), Expect = 1.956e-21
Identity = 75/265 (28.30%), Postives = 128/265 (48.30%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR---TPTN-ISNF----CIFNKTMLGPCA---DPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N RT    GRTG +W  ++L+++ FY  LTA F   +++ + + +S  TP      +    TPG+   P+      ++  +  ES   + +++  +NK FL+ + D   +     C   R    P N + N+    C FN+T LG C+   DP      +G+ CV+IK+N++  +         +    V C G+   DA NLG  V +P         G I  +YFP+  +K   NY  P VA++F  ++ NV + ++C +
Sbjct:   20 FVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMWVML-QTVSDHTPKYQDRLA----TPGLMIRPKTENLDVIVNISDTES---WGQHVQKLNK-FLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINFY-----AGANQSMNVTCVGKRDEDAENLGHFVMFP-------ANGSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRI 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Match: Atp4b (ATPase, H+/K+ exchanging, beta polypeptide [Source:MGI Symbol;Acc:MGI:88114])

HSP 1 Score: 84.7297 bits (208), Expect = 3.516e-18
Identity = 75/268 (27.99%), Postives = 114/268 (42.54%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTP-FRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR--------TPTNISNFCIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF--VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            ++ +N  TG + GRT   W  + LY+  FY+V+T  F   IY+ M + I P TP ++    S     PG+   P +  E GL ++ +   N  +      ++ F     P  Q  S  +NC+  +         P +    C F   ML  C   ADP    + GK C  IK+N+I  +LP       SN T   V C  Q  P            E    N T+ +    YFP+  +K   +Y +P VA +   + KN+ + I C +
Sbjct:   19 HYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLM-QTIDPYTPDYQDQLKS-----PGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDS--INCTSEKYFFQESFAAPNHTKFSCKFTADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKFLP-------SNNTAPRVDCTFQDDPQKPRKDTEPLQVEYYPPNGTFSL---HYFPYYGKKAQPHYSNPLVAAKLLNVPKNMQVSIVCKI 268          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 68.5514 bits (166), Expect = 2.280e-12
Identity = 71/273 (26.01%), Postives = 113/273 (41.39%), Query Frame = 2
Query:  122 KFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFT-----PGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRN 898
            K Q    +L++        RTG +   +++ +  FY  L A     IY+     ISP  P         TFT     PG+   P       L    +      + +Y+ ++N F L+ + D       ++C   R              C F ++ L  C+   DP     +G+ C+ +K+N+I G+ P   DP       V C  Q K D N++    YYPE  + ++ Y   P  Y+      NY SP VA+ F ++ KN A+ +QC L+ 
Sbjct:   84 KLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLAAVITLFIYMLF-LAISPYMP---------TFTEQVKPPGVMIRP---FAHSLNFNFNVSEPETWQRYVISLNGF-LQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDP-----VKVSCKVQ-KGDENDIRSINYYPESASFDLRY--YP--YYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKG 332          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 68.1662 bits (165), Expect = 2.861e-12
Identity = 75/273 (27.47%), Postives = 114/273 (41.76%), Query Frame = 2
Query:  122 KFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFT-----PGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRN 898
            K Q    +L++        RTGL    L++YF  FY  L A     IY+     ISP  P         TFT     PG+   P       L    +      + +Y+ ++N F L+ + D       ++C   R              C F ++ L  C+   DP     +G+ C+ +K+N+I G+ P   DP       V C  Q K D N++    YYPE  + ++ Y   P  Y+      NY SP VA+ F ++ KN A+ +QC L+ 
Sbjct:   84 KLQIVNEYLWDPEKRMSLARTGL---ILVIYFF-FYASLAAVITLFIYMLF-LAISPYMP---------TFTEQVKPPGVMIRP---FAHSLNFNFNVSEPETWQRYVISLNGF-LQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDP-----VKVSCKVQ-KGDENDIRSINYYPESASFDLRY--YP--YYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKG 328          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 62.7734 bits (151), Expect = 1.169e-10
Identity = 65/280 (23.21%), Postives = 114/280 (40.71%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL--NC----SDNRTPTNISN------FCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLP--------------MIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTN---QKNYYSPTVAIQFPEMSKNVAIMIQC 886
            F++N       GRTG +W +++L+++ FY  L   F   I + +  I   K  ++          PG+   P+  I+   I    N+        L+ +   FL+ + D       +  +C    S+ +   +I++       C F    LG C+   D     + GK C+ IK+N++ G+ P              M  +PNV     V C G+   D + +G   Y+         YG  P  Y+P+     Q  Y  P +A+QF  ++ +  I ++C
Sbjct:   15 FIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQD-----RVAPPGLTQIPQ--IQKTEISFRPNDPKSYEAYVLNIIR--FLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLP---VQCTGKRDEDKDKVGNIEYF----GMGGYYG-FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVEC 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Match: sp|A8X4W9|AT1B3_CAEBR (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis briggsae OX=6238 GN=nkb-3 PE=3 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 1.032e-27
Identity = 80/280 (28.57%), Postives = 130/280 (46.43%), Query Frame = 2
Query:  101 KVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANP--RMSIESGLI---LATSNESNPIFTK---YLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNV----------SNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC 886
            + K +P  F++   FLYN++ G + GRTG +WCQ+ +++I FYI L+AFF   + IF+ K + PK P   G  +I+   PG+   P  + + +S LI   L  S    P   +   Y S  N          ++S+  L    +  P    +  +F K   G  A  +   KSGK CV + +N++ GW P+  D N           S    ++C+G    D  +LGK  Y PE          I   Y+P+    +Y  P   ++F  + +N  ++++C
Sbjct:   27 EAKAEPETFRQ---FLYNKQKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLAIFL-KTLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDGYFSRYNNTNDTRECGAEDSNEALQTDPDSLPCRF-DLGLFEKANCG--AKDQYGFKSGKPCVVVSLNRLIGWRPVDYDGNSVPEEIKSRYKSGSITINCEGATPFDKEHLGKVKYIPEAG--------IDGRYYPYVFLPSYQQPIAMVKFDTIPRNKLVIVEC 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.755e-26
Identity = 72/277 (25.99%), Postives = 127/277 (45.85%), Query Frame = 2
Query:  101 KVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF----------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC 886
            + K +P  F +   FLYN+  G + GRTG +WCQ+ +++I FYI L+AFF   + IF+ + + PK P   G  +I+   PG+   P +       L   N + +  +  Y+  ++ +  K     +    G + +++   T+   F C F+  +       A  +   KSGK CV + +N++ GW P+  D     E            ++C+G    D  +LGK  Y PE          I   Y+P+    +Y  P   ++F  + +N  ++++C
Sbjct:   18 EAKAEPETFAQ---FLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFL-RTLDPKVPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG--------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVEC 282          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 9.397e-25
Identity = 73/291 (25.09%), Postives = 124/291 (42.61%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDL-QNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPCADPEKEL--KSGKLCVYIKVNKIYGWLPM----------IVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSL------RNIKNSYKPIKFEIMLLSK 949
             FLYN++ G + GRTG +W Q+I+++I FY  L AF+   + IFM K + PK P   G  +I+   PG+   P +       L   N      +  YL  +  +  K   +  +    G   S++    N     C F+ ++       + +   KSGK CV I +N++ GW P           + D   +    ++C G    D  ++GK  Y P           I   Y+P+   K Y  P   ++F  + +N  ++++C         +I +    + FE+M+  K
Sbjct:   31 EFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFM-KTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDSTLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPS--------NGIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVEDK 312          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Match: sp|Q24046|ATPB1_DROME (Sodium/potassium-transporting ATPase subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=nrv1 PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.178e-24
Identity = 87/312 (27.88%), Postives = 139/312 (44.55%), Query Frame = 2
Query:  113 KPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANP-RMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLN---CSDNRT--PTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPN----------VSNET--------FVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQC-----------SLRNIKNSYKPIKFEIML 940
            +P K Q     +YN + G   GRTG +W QL+L++  FYIVL A F   +   ++  IS   P     +S++   PG+   P     E G ++A   +  P  + Y   +   FL+ +    N + G +   C   +   PT++   C+ N  + G C+       K+ + C+++K+NKI+GW+P + D            V NET        +V C+G    D  N     Y+P            P+ Y+PF NQ  Y SP VA+QF    K   + ++C           S+R+ K S   + F+I+L
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKK-PAESDYWIELIDDFLRDY----NHTEGRDMKHCGFGQVLEPTDV---CVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG--------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGS---VTFQILL 308          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Match: sp|P43002|AT1B2_RHIMB (Sodium/potassium-transporting ATPase subunit beta-2 OS=Rhinella marina OX=8386 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.395e-24
Identity = 72/267 (26.97%), Postives = 125/267 (46.82%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKI--ISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCS---------DNRTPTNISNFCIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTN---QKNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N RT    GRTG +W  ++L+++ FY  LTA F   +++ +  I   +PK   R          PG+   P+M  ++  ++ ++N  N  +  Y+  +N   LK +        G+NC+               N    C F + +LG C   +D     + GK CV IK+N++  +LP+ +    +    + C  Q   D   LG   Y+P +  +++  G I  +YFP+     Q+NY  P VA++F   +K V  M++C +
Sbjct:   20 FMWNPRTREFMGRTGSSWALILLFYVVFYAFLTAVFSLSLWVMLQTIDEYTPKYADRLA-------NPGLMIRPKM--DTTEVVYSTNGMNGTWQAYVDNLNS-LLKDYNKTVQMERGVNCTPGVYNMQEDTGDVRNNPKKACWFFRDVLGDCSGVSDTTYGYQDGKPCVLIKMNRVINFLPVPIKELSNTSITIKCTAQNNDDL--LGSIQYFPSVNNQSL--GAIDLMYFPYYGNRAQQNYTQPFVAVKFLNATKGVDHMVECRV 272          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Match: A0A564YRD5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8659 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.804e-52
Identity = 92/271 (33.95%), Postives = 147/271 (54.24%), Query Frame = 2
Query:  140 NFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKF--FLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKN-SYKPIKFEIML 940
            N++YN++   I GRT ++W Q+  Y+  FY +L  FF  M+ +F+  I+ P+ P RTG  S+L F PG+   P +  +  LI  +  +   ++ +Y+  +N    + +   +   +      +D + P +    C F+   LGPC           K C  +K+N++YGW+P ++DP + + T V C GQ   D +N+G   +YP I      YGV  N YFPF  Q  Y SP VA+QF  ++K+V I+IQC+L+ +KN    P+ FEI+L
Sbjct:   25 NWIYNKKDKSILGRTCVSWAQIFTYYCIFYALLIGFFMGMMTVFLQLIVPPQYPLRTGQQSLLKFQPGLGVRPIVDEDKTLIFYSKKDPQ-VYYEYVDNINALLSYYEKINEKPETGFATCTTDGKVPNDPKKVCRFDLNSLGPCNKANNFGYPDDKPCAILKLNRVYGWMPDVMDPEIPH-TLVSCQGQNPEDHDNMGPVKFYPSITANGTEYGVFHNQYFPFLGQNGYTSPLVAVQFENLTKHVIILIQCTLQGVKNIDTDPVTFEILL 293          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Match: A0A0R3TQM6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9846 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 6.028e-52
Identity = 100/273 (36.63%), Postives = 150/273 (54.95%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL-NCS-DNRTPTNISNFCIFNKTMLGPCADPEKELKSG----KLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKN-SYKPIKFEIML 940
            ++Y+++   I GRT  +W Q+++YF  FY +L  FF AM+ +F+  I+  + P RTG  S+L F PG+   P +  E  LI  +  +   ++ +Y+  +N          Q    G  NC+ D + P +    C F+ T LGPC    KE   G    K CV +K+N+IYGW+P ++DP   + TFV C GQ   D  N+G   +YP  +  N  YGV  N +FPF  Q  Y SP VA+QF  ++++V I+IQC+L   +N    P+ FEI+L
Sbjct:   24 WIYDKKDKSIFGRTCASWAQILIYFCLFYAILFGFFMAMMTVFLQLIVPSQYPLRTGQQSLLKFQPGLGVRPIIDEEKTLIFYSKKDPQ-VYYEYVDNINALLAYYEEVNQKPGTGFANCTQDGKNPNDPKKVCRFDLTSLGPC---NKENNYGYPNDKPCVILKLNRIYGWMPDVIDPEFPH-TFVSCHGQNPEDTVNMGPVKFYPSKEMNNTEYGVFHNQFFPFLGQNGYTSPLVAMQFENVTRHVMILIQCTLHGARNIDTDPVNFEILL 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Match: A0A4E0S2L7 (Putative sodium/potassium-transporting ATPase subunit beta-3 OS=Fasciola hepatica OX=6192 GN=D915_001356 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 8.808e-51
Identity = 98/289 (33.91%), Postives = 157/289 (54.33%), Query Frame = 2
Query:  101 KVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLK----TFPDLQNSSAGLNCSDNRTPTNISNF-CIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIK-TENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIMLLSK 949
            K + +  ++++     ++  T    GR G NW  + ++++  Y +L  F+F MI +F+N  ++   P  TG +SIL   PG++  PR+S+     L T N+     T Y S+VN  +++    T     N++   +CS    P +  +  C F  + LG C  PE E+  G  C ++++N+IYGWLP + +    ++  + C GQ   D + LG+P YYPEI   +  TYG I  +YFPF  Q NY SP  A+QFPE+ +N  I+ +C +R I NS   ++FEI + SK
Sbjct:    3 KRQEQGTRWERMKKTCFDPETRKFLGRDGKNWALIFVFYLIAYTLLVGFWFGMIAVFLNVCVTVDKPTLTGMHSILKLNPGMSYLPRLSL-----LNTFNQ----VTAYPSSVNADYIQKAIQTLQKYSNTTHTADCSSG-IPQDFPDLPCRFPVSTLGACEHPENEVNKGMPCFFLRLNRIYGWLPELANKTQFDKILIECTGQNAIDKSLLGRPKYYPEISGVDGKTYGYIDPMYFPFLRQDNYQSPLAAVQFPEVHRNTVILTECHVRGISNSEAIVQFEICVDSK 281          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Match: A0A0R3WEL6 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9270 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.583e-49
Identity = 96/270 (35.56%), Postives = 146/270 (54.07%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL-NCSDNR-TPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKN-SYKPIKFEIML 940
            +LYN++     GRT  +W ++++Y+  FY +L  FF AMI +F+  I+  K P RTG  S+L F PG+   P +  +  LI  +S +   ++ +Y+  +N          +  S G   C+++R  P   +  C F+ T LGPC           K CV +K+N++YGW+P + DP   + T V C+GQ   D  N+G   +YP I      YGV  N YFPF  Q  Y SP VA+QF ++ K++ I++QC L    N   +P+KFEI+L
Sbjct:   24 WLYNKKDKSFLGRTCASWAKILIYYCFFYAILFGFFLAMIMVFLQFIVPAKVPLRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSSRDPQ-VYYEYVDNLNALISYYEAINEKPSIGFATCTNDRKDPNEPTKVCRFDLTSLGPCNKANNYGYPDDKPCVILKLNRVYGWMPDVTDPGFPH-TLVTCEGQNPEDQVNIGPMKFYPGIPKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEKHILILVQCRLLGATNVDLEPVKFEILL 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Match: A0A074ZLX3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_05042 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 4.385e-49
Identity = 95/273 (34.80%), Postives = 150/273 (54.95%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLI--LATSNESNPIFTKYLSAVNKFFLKTFP--DLQNSSAGLNCSDN-RTPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYK-PIKFEIML 940
            +LY+ +   I GRT  +W   IL+++ +Y+ L  FF  M+ +F++  +    P R+G +SIL   PG+   P + ++  LI    T  +S  ++T+ + A    FL+T+   + +  +   NC+D  ++P      C F    LG C   EK     GK CV +K+NKIYGWLP I + +V+    ++C GQ   D  NLG+  Y+PE      TYG   ++YFPF  Q  Y  P VA++F  + +NVAI+++C LRN+ N+    + FEIM+
Sbjct:   24 WLYDPKNKAILGRTACSWALCILFYVVYYLCLAGFFMGMMMVFLHTQVPDDEPARSGMHSILQLQPGVGFRPMVDVQKSLIKFARTDPQSFLVYTENIDA----FLETYRVVNAKPENQFANCTDGVKSPDEPEKVCKFPLEQLGVCNAEEKYGYPEGKPCVILKLNKIYGWLPSIENADVAPNALINCTGQNPADVENLGELRYFPEASVNGKTYGYFDSIYFPFIGQPGYLGPLVAVKFENVRRNVAILVECKLRNLNNALDTQLAFEIMV 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 93.2041 bits (230), Expect = 2.397e-21
Identity = 70/281 (24.91%), Postives = 130/281 (46.26%), Query Frame = 2
Query:   95 EEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR---------TPTNISNFCIFNKTMLGPC---ADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            +E+ K K  ++++   F +N RT  + GRT  +W  ++L+++ FY  L   F   +Y+ +  +   K  ++         TPG+   P+    S + +  S ++   + KY+  +N  FL  + + Q       C+ ++            N    C FN+T+LG C    DP    + GK C++IK+N++ G LP           +V C G  + D+  LG   Y+P   + N+       +Y+P+  +K   NY  P VA++F  ++ N  + ++C +
Sbjct:    3 KEEDKKKSGEWRE---FFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGMFCLTMYVMLLTLDDYKPTWQD-----RLATPGLMIRPK---GSSMEIQYSKQNTESWDKYVKTLNS-FLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKPCIFIKLNRVIGMLP----GKDGQSPYVTC-GAKREDSELLGDMAYFPSNASFNL-------MYYPYYGKKAQVNYSQPLVAVKFLNLTLNTDVNVECKI 259          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Match: atp1b4 (ATPase Na+/K+ transporting family member beta 4 [Source:NCBI gene;Acc:103047107])

HSP 1 Score: 84.3445 bits (207), Expect = 6.642e-18
Identity = 74/295 (25.08%), Postives = 117/295 (39.66%), Query Frame = 2
Query:   98 EKVKIKP-------NKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNC-------SDNRTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKP----------DANNLGKPVYYPEIKTENITYGVIPNLYFPF---TNQKNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            EK K KP        K      +L+N  T    GR+G +W  ++ ++   YI L A F   +   M   ISP TP    T +     PG+N  P M    GL +  +      + KY  A++   LK + D       + C        D+   +     C F ++ LGPC+   D +     G+ C+ +K+N+I G+LP                GQG P            ++LG   +YP+         +   +Y+P+       NY SP +A  F  +  +  + +QC L
Sbjct:   59 EKWKPKPIPKRTLHEKIDDLKTYLWNPETKEFMGRSGKSWSLILFFYSALYIFLAAMFGGCMCCLMWS-ISPYTP----TYNDRVMPPGMNMIPHMHNVHGLDITFNASDRSSWKKYARALDS-QLKPYDDAVQERRNIACKQDAYFMQDDLEESAERKACQFKRSWLGPCSGMQDRDYGYSKGRPCILLKMNRILGYLP----------------GQGTPVNVACVVKKGTEDSLGTVDFYPK--------NIFNLMYYPYYGKLRHVNYSSPLIAAHFTSLHVDTHLHVQCKL 323          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 83.5741 bits (205), Expect = 7.064e-18
Identity = 71/279 (25.45%), Postives = 122/279 (43.73%), Query Frame = 2
Query:  113 KPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNC---------SDNRTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVD--PNVSNETFVHCDGQGK--PDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            K +K  +   F +N RT   CGRT  +W  + L+++ FYI L   F   +Y+ +  +   K  ++         TPG+   P+   E  +I A  N  +  +  ++ A+N  FL  + D         C           +    N    C F +++L  C+   D       GK C+ IK+N++ G LP      P++S     +  G+ +   D + +G+  Y+P   T N+       +YFP+  +K   NY  P VAI+F  ++ N  I ++C +
Sbjct:    3 KGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDNKPTYQD-----RLATPGLMIRPKGE-EMEIIYAKENTES--WDTHVQALNS-FLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISCAPKKYKIGKDEWIDDTDKMGEVAYFPRNGTFNL-------MYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKI 265          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 82.8037 bits (203), Expect = 1.308e-17
Identity = 70/275 (25.45%), Postives = 116/275 (42.18%), Query Frame = 2
Query:  113 KPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNC---------SDNRTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            K +K  +   F +N RT   CGRT  +W  + L+++ FYI L   F   +Y+ +  +   K  ++         TPG+   P+   E  +I A  N  +  +  ++ A+N  FL  + D         C           +    N    C F +++L  C+   D       GK C+ IK+N++ G LP       S       D     D + +G+  Y+P   T N+       +YFP+  +K   NY  P VAI+F  ++ N  I ++C +
Sbjct:    3 KGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDNKPTYQD-----RLATPGLMIRPKGE-EMEIIYAKENTES--WDTHVQALNS-FLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQAPSISCAPKID-----DTDKMGEVAYFPRNGTFNL-------MYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKI 256          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:103031172])

HSP 1 Score: 81.6481 bits (200), Expect = 3.414e-17
Identity = 66/281 (23.49%), Postives = 117/281 (41.64%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL-NCSDN----------RTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF--------------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQ---KNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N  T  + GRTG +W +++L+++ FY  L   F   I   +  + + K  ++          PG+   PR S +S L  + ++     + KY  ++ +F      + Q       +C D            +       C F +T LGPC+   D E     GK C+ +K+N+I  + P    P ++NE+               ++C  + + D   LG+  YY          G  P  Y+P+  +     Y  P VA+QF  ++ N  + I+C +
Sbjct:   14 FMWNSETREVLGRTGGSWAKILLFYVIFYGFLAGIFIGTIQALLLTLSNYKPTWQD-----RIAPPGLTHTPR-SDKSELSFSVNDVET--YLKYTKSMREFLEAYNEETQRDQMKFEDCGDQPQEYKHRGDLESDIGARKACRFQRTFLGPCSGIEDKEFGFSEGKPCLIVKLNRIVNFKP---KPPLTNESIPEEAQHKIQRNVIPIYCHNKREEDEGKLGEVKYYG-------IGGGFPLQYYPYYGKLLHPQYLQPLVAVQFVNLTMNYELRIECKV 276          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005979.1 (pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-1 gene:ENSPMAG00000005385.1 transcript:ENSPMAT00000005979.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 1.806e-15
Identity = 60/247 (24.29%), Postives = 114/247 (46.15%), Query Frame = 2
Query:  203 LILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSS-----AGLNCSDNRTPTNISNF---CIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL--RNIK 904
            ++L++  FY  L + F   +++ +  +      ++   +S     PG+   P+M+    L +  +  S+ I       +N FF + + ++  ++     AG    + + P N  N    C FN++  G CA P+    +   CV+IK+N+I G+ P      V     V C    K ++ NLG+  Y+P         G +  +YFP+  +K    Y  P VA++F  ++K + + ++C +  RN+K
Sbjct:    3 ILLFYTVFYAFLASLFVFTMWVMLQTVDDKNPKYQDRVSS-----PGVVMRPKMNKALELYINRNTHSDII-----EHLNTFF-EAYNEVNQTNKALCEAGKYRDNQKGPPNEDNVWPACRFNRSDFGECASPDYGYTNQTPCVFIKLNRIIGFKP----GTVKEAPKVMC--SSKKESGNLGELEYFP-------NGGTMDQMYFPYYGKKLDPMYTQPLVAVRFLNLTKQMEVTVECKVIARNVK 225          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Nematostella
Match: EDO32320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.517e-18
Identity = 69/248 (27.82%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFM----NKIISPKTPFRTGTNSILTFTP-----GINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEKELK----SGKLCVYIKVNKIYGWLPMIVDPNVS-NETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQ 844
            FLYN+  G + GR G +W ++ L+F+ FY+ L  FF AM+ IF+    ++   PK         +L   P     G + N   S  S +     ++ N    +Y+        +  PD  N ++G        P +    C F+ T LGPC   E   K    +G  C ++++NK++ ++P   +PN   +   V CD +     NNL K   YPE   EN  +   P  ++P+  + N+ +P +A+Q
Sbjct:   27 FLYNKEKGEVMGRNGQSWAKIGLFFLVFYLCLAGFFAAMLSIFLSTLPDRADGPKLTQYIAGKPVLNPVPSNKIEGYDPNKASSYSSHV-----SDINSFLNQYVRQGGANKDQFAPDFCNGTSG-----EPRPKDAKKQCRFDLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNFVP---EPNSGLSYIKVECDAKDS-SKNNLIK--VYPE---ENPGW---PVSFYPYRMEDNWLAPVIAVQ 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 85.5001 bits (210), Expect = 1.450e-18
Identity = 68/265 (25.66%), Postives = 120/265 (45.28%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR---------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            +L+N RT    GRT  +W  ++L+++ FYI L   F   +YI +  +   K  ++         TPG+   P       ++    N  +  +  Y  A++K FL  + D   +     C+ ++            N    C FN+T+L  C+   D     + G+ C+ IK+N++ G LP       S    V C  + + D++ LG+ VY+P   T N+       +Y+P+  +K   NY  P VA++F  ++ N  + I+C +
Sbjct:   12 YLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTLDDHKPTWQD-----RLATPGMVIRPNTDETFEIVYNIQNTES--WDMYAQALDK-FLAPYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPS----VTCAAK-RDDSDKLGELVYFPPNGTFNL-------MYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 256          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 80.8777 bits (198), Expect = 5.871e-17
Identity = 69/266 (25.94%), Postives = 119/266 (44.74%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSN-ESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNR---------TPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            +L+N RT    GRT  +W  ++L+++ FYI L   F   +YI +  +   K  ++         TPG+   P       ++    N ES  IF  Y+ A       ++ D   +     C+ ++            N    C FN+T+L  C+   D     + G+ C+ IK+N++ G LP       S    V C  + + D++ LG+ VY+P   T N+       +Y+P+  +K   NY  P VA++F  ++ N  + I+C +
Sbjct:   12 YLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTLDDHKPTWQD-----RLATPGMVIRPNTDETFEIVYNIQNTESWDIF--YIKA------DSYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQTPS----VTCAAK-RDDSDKLGELVYFPPNGTFNL-------MYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:101166353])

HSP 1 Score: 80.4925 bits (197), Expect = 1.034e-16
Identity = 70/285 (24.56%), Postives = 124/285 (43.51%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQ--NSSAGLNC-------------SDNRTPTNISNFCIFNKTMLGPCADPEKE---LKSGKLCVYIKVNKIYGWLPMIVDPNVSNETF--------------VHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F+++   G   GRTG +W ++ L+++ F+  L   F   I + +  +   K  ++          PG++  P++            E+   FTK L      F+  + D +  ++S   NC              DN     +   C F++T+LGPC+  E E    K GK CV +K+N+I  + P    P  SN++               + C  + + DA+ +G      EIK   I  G  P  Y+P+  ++   +Y  P VA+QF  +++N+ + I+C +
Sbjct:   13 FVWDSDKGEFMGRTGGSWFKITLFYVVFFGCLAGVFVGTIQVMLLTLNDFKPTWQD-----RVAPPGLSHTPKLDKAEVSYSIKGIETYLPFTKTLRE----FVSQYDDSKQLDASKFENCPAEPADYKERGTLDDN---AGVRKACRFSRTLLGPCSGLEDETFGFKDGKPCVIVKLNRIVNFRPR---PPSSNDSIPEEAWPKVQPNLIPLFCTNKREEDADKIG------EIKYYGIN-GGFPLQYYPYYGKRLHPHYLQPLVAVQFTNLTQNMELRIECKV 275          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Match: atp1b1a (sodium/potassium-transporting ATPase subunit beta-233 [Source:NCBI gene;Acc:101164636])

HSP 1 Score: 77.411 bits (189), Expect = 1.082e-15
Identity = 67/278 (24.10%), Postives = 118/278 (42.45%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGL-NCSDN----------RTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLP-----------MIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQK---NYYSPTVAIQFPEMSKNVAIMIQCSL 892
            F++N   G   GRTG +W ++ ++++ FY  L   F   I   +  + + K  ++          PG++  PR S +S +    S+  N  F KY+ ++N+  LK   D Q +     +C +N             +     C F +  LG C+   D     K GK C+ +K+N+I  + P            +   + +N   V+C  +   DA+ +G+  Y+          G  P  Y+P+  ++   NY  P VAIQF  ++    + I C +
Sbjct:   15 FMWNSEKGEFLGRTGCSWFKIFMFYLIFYGCLAGIFIGTIQALLLTLSNYKPTYQD-----RVAPPGLSHTPR-SDKSEISFKMSD--NSTFKKYVDSMNELLLKYDEDRQTAQGKYESCGENPDTYKEQGGLEEGSGQRTSCRFLRKWLGDCSGLTDNTYGFKEGKPCLIVKLNRIVFFRPKGPSNNSTLPEALQGKSYNNLIPVYCKNKRPEDASKIGEIKYFG-------FGGGFPLQYYPYYGKQLHPNYLQPLVAIQFTNLTIGEDLRIDCRV 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Match: atp1b4 (ATPase Na+/K+ transporting family member beta 4 [Source:NCBI gene;Acc:101161164])

HSP 1 Score: 68.9366 bits (167), Expect = 1.097e-12
Identity = 66/273 (24.18%), Postives = 113/273 (41.39%), Query Frame = 2
Query:  143 FLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCS-------DNRTPTNISNFCIFNKTMLGPCA---DPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKP----------DANNLGKPVYYPEIKTENITYGVIPNLYFPF---TNQKNYYSPTVAIQFPEMSKNVAIMIQCSL 892
            +L+N  T    GR+G +W  ++L++   Y  L A F   ++  M   ISP  P    T +     PG+   P +    G  +A +      + KY  ++++ FL+ + D       + C+       D+   +     C F ++ LG C+   DP      G+ C+ +++N+I G+LP                GQGKP           A  LG+  ++P          +    Y+P+       NY SP VA++F  +  +  I +QC L
Sbjct:   77 YLWNAETKEFMGRSGKSWSLILLFYAALYAFLAAMFGGCLFCLMWS-ISPYHP----TYNDRVMPPGMTMAPHL---EGHEIAFNASDRKSWKKYARSMDE-FLRPYNDGAQDRKNIRCTHDAYFMQDDLEESAERKACQFKRSWLGDCSGLQDPHYGYSQGRPCILLRMNRILGYLP----------------GQGKPINVTCAVKKGPAETLGEIQFFPR--------SIFDLKYYPYYGKLRHVNYSSPVVAVRFAGVQYDTHIQVQCKL 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Match: SMESG000064592.1 (SMESG000064592.1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 296/297 (99.66%), Postives = 297/297 (100.00%), Query Frame = 2
Query:   59 MSTKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIMLLSK 949
            MSTKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSD+RTPTNISNFCIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIMLLSK
Sbjct:    1 MSTKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSDDRTPTNISNFCIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIMLLSK 297          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Match: SMESG000064593.1 (SMESG000064593.1)

HSP 1 Score: 302.368 bits (773), Expect = 9.378e-102
Identity = 146/294 (49.66%), Postives = 200/294 (68.03%), Query Frame = 2
Query:   65 TKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDLQNSSAGLNCSD--NRTPTNISNFCIFNKTMLGPCADPEKELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIML 940
            + Y +AK DE +    K NK QK L  LYN + G ICGRT  +W  + ++++ FY  L+ FF  MI +FM   +S   P RTG NSILTFTPG+NANPR + ES LI+ ++N+ + ++  YL   N+F  K      N   G+ C++  ++TP N++ FC F+ ++LGPCA+PE EL  G LCVY++ NKIYGWLP I +PN+SN+  + CDGQ   D NNLGKP +YP       TYG IPN+++PF  Q+NY SP VA+QFPEM KN+AI++QCSL+N+ NSYKP++FE+ML
Sbjct:    2 SSYHKAKTDEFDTTSEK-NKCQKCLTNLYNNKKGTICGRTPKSWGLICVFYLIFYSCLSGFFLGMISVFMYGFVSKMEPMRTGRNSILTFTPGVNANPRSTNESALIVGSTNKDSKLYKNYLKMANEFLKKY---TLNPVDGVKCNETVDQTPKNLTKFCKFDLSLLGPCANPEAELDKGLLCVYVRPNKIYGWLPQIENPNLSNDILIECDGQNPGDTNNLGKPKFYPSYTNNTKTYGRIPNMFYPFVMQRNYSSPMVAVQFPEMVKNLAILVQCSLKNLINSYKPVRFEVML 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Match: SMESG000032752.1 (SMESG000032752.1)

HSP 1 Score: 157.147 bits (396), Expect = 3.491e-45
Identity = 87/258 (33.72%), Postives = 133/258 (51.55%), Query Frame = 2
Query:  146 LYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKF---FLKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEKELKSG-KLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKN 907
             Y+++ G  CGRT  +W  L ++ + FY VL  +F  +  IF   I+  K PFR G N++    PG +  P+M  +S  I+ T+N ++  +  Y      +   + KT P+ +N   G N SD+  P      C F+ + LGPC +    L +G  LC+Y  +N +YGWLP I   + S +  + C G    D + +G   YYP      I YG I N YFPF NQ +Y SP  A+    +++NV + + C+L N+ N
Sbjct:   32 FYDKKEGTFCGRTPKDWGFLFIFLVLFYSVLAGYFAILFTIFTKGIMVAKIPFRQGNNTLNGPAPGFSYRPQMDNKSNTIVVTANPNDLSYQYYKKQFELYISDYSKTQPNAKNCQNGSN-SDSTGP------CAFDLSQLGPCQNGSLPLANGTGLCIYWHINNLYGWLPNISSSSGSKDGLIFCTGYNSSDTDKIGSIQYYPSQNISGIVYGSIQNAYFPFLNQDSYLSPIAAVFLSNITRNVQVNLVCNLINVIN 282          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Match: SMESG000071416.1 (SMESG000071416.1)

HSP 1 Score: 152.525 bits (384), Expect = 1.813e-43
Identity = 91/296 (30.74%), Postives = 151/296 (51.01%), Query Frame = 2
Query:   65 TKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDL---QNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIML 940
            + YI   ED E K + KP++ Q  +   YN R+    GRT  +WC++ +++  +Y  LTAFF +M+ +F+  ++    P RTG +S+L   PG+   P     + LI    NE     + Y+    + FL  + D+   ++ +  +    ++ P N+   C FN TML  C +        G  CV IK+NKI+GW+P   D   ++   + C GQ   D +N+G+  Y+P     +   G   + ++P+  Q  Y SP VA+QF  + KN  +M++C   N+K     +KFEI++
Sbjct:    2 SNYINFDEDIE-KYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDM--RTFLTPYEDIYLKEDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNNKNNFGYSKGNPCVLIKMNKIFGWIPDTTD---NSSPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILV 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Match: SMESG000061672.1 (SMESG000061672.1)

HSP 1 Score: 145.976 bits (367), Expect = 3.364e-41
Identity = 81/272 (29.78%), Postives = 137/272 (50.37%), Query Frame = 2
Query:  146 LYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTF--PDLQNSSAGLNCSDNR-TPTNISNFCIFNKTMLGPCADPEKELKSG----KLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIML 940
            +Y+       GR+ ++W + + +F    I++   F  M ++F   +I+   P+RTG NSIL   P ++  P +  ++ LI   S+     +  Y+ ++ +  ++T+   DL +  +   C D + TP +I+  C FN   L  C    K+   G    K CV IK+N+I+GWLP I + + S +  + C GQ   D  N     YYP +    + YG + +LY+P+  Q  Y  P V ++F    KNV +MI C + N+     P+ FEI++
Sbjct:    2 IYDSANKKFLGRSKIDWVKFLAFFFICLILMIIIFIGMFFLFTEGVINEDVPYRTGLNSILKNIPNLSFRPVIDFKTALI-RYSDADPSTYMLYIQSM-RALVQTYEDADLISEDSYATCIDGKKTPDDITKPCRFNILQLDRCI---KQYNFGYDRTKPCVLIKMNRIFGWLPDIANSSFSKDILIKCAGQNAEDVENFNTVRYYPNVTINGVVYGYMSSLYYPYLVQYGYRQPLVGVEFDRPKKNVLLMITCHIVNLLTKSAPLTFEILI 268          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B29.092e-2127.55ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
ATP4B6.792e-2026.64ATPase H+/K+ transporting subunit beta [Source:HGN... [more]
ATP4B6.792e-2026.64ATPase H+/K+ transporting subunit beta [Source:HGN... [more]
ATP1B41.697e-1326.18ATPase Na+/K+ transporting family member beta 4 [S... [more]
ATP1B11.266e-1124.01ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-31.269e-2725.99Probable sodium/potassium-transporting ATPase subu... [more]
nkb-31.380e-2725.99Probable sodium/potassium-transporting ATPase subu... [more]
nkb-17.387e-2625.09Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-17.387e-2625.09Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-17.387e-2625.09Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv32.575e-3128.62gene:FBgn0032946 transcript:FBtr0081519[more]
nrv32.575e-3128.62gene:FBgn0032946 transcript:FBtr0081518[more]
nrv32.575e-3128.62gene:FBgn0032946 transcript:FBtr0081520[more]
nrv36.373e-3028.75gene:FBgn0032946 transcript:FBtr0333355[more]
nrv11.175e-2527.88gene:FBgn0015776 transcript:FBtr0332370[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b1.468e-2025.27ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2b1.468e-2025.27ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2a1.205e-1826.15ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b1b1.825e-1825.98ATPase Na+/K+ transporting subunit beta 1b [Source... [more]
atp1b43.965e-1726.15ATPase Na+/K+ transporting subunit beta 4 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam151a1.069e-1927.96family with sequence similarity 151 member A [Sour... [more]
tmem1413.874e-1827.76transmembrane protein 141 [Source:Xenbase;Acc:XB-G... [more]
ATP1B43.392e-1623.81pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B43.569e-1623.81pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B43.676e-1623.81pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1b21.956e-2128.30ATPase, Na+/K+ transporting, beta 2 polypeptide [S... [more]
Atp4b3.516e-1827.99ATPase, H+/K+ exchanging, beta polypeptide [Source... [more]
Atp1b42.280e-1226.01ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp1b42.861e-1227.47ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp1b11.169e-1023.21ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8X4W9|AT1B3_CAEBR1.032e-2728.57Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q9XUY5|AT1B3_CAEEL1.755e-2625.99Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q93235|AT1B1_CAEEL9.397e-2525.09Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|Q24046|ATPB1_DROME1.178e-2427.88Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|P43002|AT1B2_RHIMB4.395e-2426.97Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YRD51.804e-5233.95Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3TQM66.028e-5236.63Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4E0S2L78.808e-5133.91Putative sodium/potassium-transporting ATPase subu... [more]
A0A0R3WEL62.583e-4935.56Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A074ZLX34.385e-4934.80Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2a2.397e-2124.91sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b46.642e-1825.08ATPase Na+/K+ transporting family member beta 4 [S... [more]
atp1b2b7.064e-1825.45sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b1.308e-1725.45sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1b3.414e-1723.49sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005979.11.806e-1524.29pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323201.517e-1827.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b1.450e-1825.66ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b2b5.871e-1725.94ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b1b1.034e-1624.56sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1a1.082e-1524.10sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b41.097e-1224.18ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064592.10.000e+099.66SMESG000064592.1[more]
SMESG000064593.19.378e-10249.66SMESG000064593.1[more]
SMESG000032752.13.491e-4533.72SMESG000032752.1[more]
SMESG000071416.11.813e-4330.74SMESG000071416.1[more]
SMESG000061672.13.364e-4129.78SMESG000061672.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018173 ID=SMED30018173|Name=Sodium/potassium-transporting ATPase subunit beta-1 isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1078bp
AAAATCAGTATTTAAAGCAAACTTTGAATTTATAATTTCAAAATTAGAAA
TATTTTTAATGTCAACAAAATATATTCGTGCTAAAGAAGATGAAGAAGAA
AAAGTGAAAATTAAACCGAATAAATTTCAGAAAAAATTGAATTTTCTCTA
CAACAGAAGAACGGGGCACATTTGCGGACGAACAGGATTGAATTGGTGCC
AATTAATATTGTACTTTATTTGTTTCTATATAGTTTTGACTGCCTTTTTC
TTCGCTATGATTTATATATTCATGAATAAAATCATATCTCCAAAAACACC
ATTCCGCACCGGGACGAACAGTATTCTAACATTCACGCCAGGAATCAACG
CAAATCCAAGAATGTCAATTGAAAGCGGTTTGATTCTTGCCACTTCTAAC
GAGTCTAATCCTATATTTACCAAATATTTGTCTGCTGTTAATAAATTCTT
TCTGAAAACCTTTCCGGACCTTCAAAATTCTTCAGCAGGTTTAAATTGTT
CTGACAACCGAACTCCAACAAATATTTCAAACTTTTGCATATTCAACAAA
ACTATGCTTGGACCTTGTGCAGATCCAGAAAAGGAATTGAAATCTGGAAA
GCTCTGTGTCTATATCAAAGTCAACAAGATTTATGGGTGGTTACCGATGA
TCGTTGATCCTAACGTGTCAAATGAGACATTTGTTCATTGTGATGGCCAG
GGCAAACCAGATGCAAACAATCTCGGCAAGCCTGTGTATTATCCTGAAAT
TAAGACGGAAAATATTACGTACGGAGTTATTCCTAATCTGTATTTTCCTT
TTACAAACCAAAAGAATTATTACAGCCCGACAGTTGCCATTCAATTTCCA
GAGATGTCGAAAAATGTTGCGATAATGATCCAGTGTTCATTGCGTAATAT
CAAAAATTCTTACAAGCCAATAAAGTTTGAAATAATGTTGCTGAGCAAAT
GACAAAATTTGTGGATAGACTTCGAATAAATAAATGCTCAAATTAAATAA
TATATTTCATATTTTGTTTTAATTTTGATTGTCTAACTTTATGTTAGAGG
TGAATATGAATAAAATATTAGACTCAAA
back to top

protein sequence of SMED30018173-orf-1

>SMED30018173-orf-1 ID=SMED30018173-orf-1|Name=SMED30018173-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
KSVFKANFEFIISKLEIFLMSTKYIRAKEDEEEKVKIKPNKFQKKLNFLY
NRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTP
FRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFF
LKTFPDLQNSSAGLNCSDNRTPTNISNFCIFNKTMLGPCADPEKELKSGK
LCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEI
KTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNI
KNSYKPIKFEIMLLSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006813potassium ion transport
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 40..303
e-value: 8.3E-47
score: 159.7
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 27..301
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 30..314
e-value: 1.1E-52
score: 181.3
NoneNo IPR availableTMHMMTMhelixcoord: 68..90