Potassium channel subfamily K member 18

Overview
NamePotassium channel subfamily K member 18
Smed IDSMED30018157
Length (bp)1690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel subfamily K member 18 (SMED30018157) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30018157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member 18 (SMED30018157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member 18 (SMED30018157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018157SMESG000079785.1 SmedASXL_011024SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018157SMESG000079785.1 dd_Smed_v4_13333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018157SMESG000079785.1 dd_Smed_v4_13333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30018157SMESG000079785.1 dd_Smed_v4_13333_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018157SMESG000079785.1 dd_Smed_v6_13333_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018157SMESG000079785.1 OX_Smed_1.0.22961ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30018157SMESG000079785.1 dd_Smed_v4_13333_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 83.1889 bits (204), Expect = 1.554e-16
Identity = 76/277 (27.44%), Postives = 124/277 (44.77%), Query Frame = 1
Query:  661 NDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG-------DAFKIFYIFLRNHIK--CRRKPRKKSASILSLTESQPQ---------SNKTTTVPXXXXXXXXXXXXXXXXXXXXRIT--------ESSCEKQKKLHFTISIDTGDFMNNLHRKGDESE-LPLILPLCVFII--YILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            N T  W++  ++ +  TV +T+GYG I PVT  GK   ++YA+ GIPLM L LT+ G I         + F+ F  F R  +   C +   KK        E+ PQ           K  T P+       L   S        +          +SC +      + SI     ++NL   G + E L + LP+   I+  YI   A ++  WE  + + N+ YF F+T +TIGFGD V        ++ +  +  ++Y+  G+ ++ + F+L+Q+
Sbjct:   96 NRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLSYSI-----ISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTV-------LEHPNFFLFFSIYIIVGMEIVFIAFKLVQN 360          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK5 (potassium two pore domain channel subfamily K member 5 [Source:HGNC Symbol;Acc:HGNC:6280])

HSP 1 Score: 64.3142 bits (155), Expect = 3.002e-10
Identity = 33/101 (32.67%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGV-VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRK 900
            +D  ++ + +    GV +T N     W +  A++++ TVITTIGYGN+ P T  G++  + Y + G+PL +  ++ LG  FG   K    FL       RK
Sbjct:   57 LDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRK 157          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 60.077 bits (144), Expect = 8.378e-10
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGVVTNNNDT--ALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKC--RRKPRKKSASILSL 933
            ++ FV+ I      GV    N T  + W +  +  ++ TV+TTIGYGN+ P T  G+V  + YA++GIPL V+ L +LG+            LR H+    R + R + + +L +
Sbjct:    1 MEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTG-----------LRAHLAAIERWEDRPRRSQVLQV 104          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 62.7734 bits (151), Expect = 9.079e-10
Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAF 852
            ++N+++ W    A  ++ TVITTIGYGNI P T  GK+  I+YA+ GIPL    L  +G   G  F
Sbjct:  145 SSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 210          

HSP 2 Score: 57.7658 bits (138), Expect = 3.861e-8
Identity = 32/107 (29.91%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGL-LNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            S +  IL  C  I+++ + A++    EGW  L S YFV +T +T+GFGD V G      ++   KP+V   ++  GL   +    ++ D++R  + K  + +G +K+
Sbjct:  235 STILFILAGC--IVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKA 338          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 62.7734 bits (151), Expect = 9.471e-10
Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAF 852
            ++N+++ W    A  ++ TVITTIGYGNI P T  GK+  I+YA+ GIPL    L  +G   G  F
Sbjct:  150 SSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 215          

HSP 2 Score: 57.7658 bits (138), Expect = 3.593e-8
Identity = 32/107 (29.91%), Postives = 57/107 (53.27%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGL-LNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            S +  IL  C  I+++ + A++    EGW  L S YFV +T +T+GFGD V G      ++   KP+V   ++  GL   +    ++ D++R  + K  + +G +K+
Sbjct:  240 STILFILAGC--IVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVW-FWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKA 343          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 134.42 bits (337), Expect = 1.639e-34
Identity = 82/258 (31.78%), Postives = 134/258 (51.94%), Query Frame = 1
Query:  670 ALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFY---IFLRNHIKCRRKPRK-----KSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGL-LNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRR 1416
            A WT+ GA LYS+TVITTIGYGN    T  GK  T++YA+IGIPLM+L LTN+G +    F+  Y   I L+  +    K RK     ++ S++S      +    ++V +  L                    +  + +  L   + ++  +       + +   +P+ L +   + Y+ VG  +  +WEGW +L S YF FI+ +TIGFGD  P   +++  + + K ++ ++YL FG+ LL+MCF L Q+ V+ +
Sbjct:  118 AQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKFRLILWHKKRKAAKIRRANSLVSRLTRGHRVKADSSVDSFGLG-------------------AGADVEDLLTARVEMEQLEVRETAAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQEEVQNK 356          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-28 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q22940])

HSP 1 Score: 119.783 bits (299), Expect = 1.356e-28
Identity = 92/298 (30.87%), Postives = 141/298 (47.32%), Query Frame = 1
Query:  565 ITREANKSIG-SMIDNFVKNIENITKLGVVTNNN-------DTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPI-VCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLG 1431
            I+REA  +I     +  VKN+    +   +T  +       D  LWT+  ++ ++ TVITTIGYGN+VP+T  G+VA II+A++GIPL+++ + ++G    +     Y   R++   +RK R++S  I S   SQ QS  ++ + ++K                             LH  I  D+ D        GDE  +P+ + L V + Y  +G  L   WE   Y  + YF FIT +T+GFGD+VP        NE   +     Y+ FGL L +MC  L      R+   LG
Sbjct:  121 ISREAFNAINQEYFEQLVKNMFQAYRNQFITAKHLLNKTREDEVLWTFPNSMFFAATVITTIGYGNLVPITVTGRVACIIFALLGIPLLLVTIADIGKFLSEFLSYLY---RSYRGFKRKLRRQSKKITSQYRSQSQSRSSSVMGSSKAGSM------------------------NLH-DIDSDSED------SAGDELRIPVFMVLLVLLAYTAIGGFLFQSWEHLEYFEAFYFCFITMATVGFGDIVP--------NEQVYVFFTMAYIIFGLSLATMCIDLAGTEYIRKIHYLG 376          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 114.775 bits (286), Expect = 4.318e-27
Identity = 87/268 (32.46%), Postives = 123/268 (45.90%), Query Frame = 1
Query:  640 LGVVTNNNDTAL-WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHI 1440
            LG+V  + D  + WT+ G+I Y +TV TTIGYGNIVP TG G+ ATI+YA IGIPL VL L  LGS+F    K+ + F    +K  R   K  ++ +S      +   T   P                         S EK +              NN     D    P+   L + +I+++  A+L +  E W +  S YF  I+F+TIGFGD++P         +  PIV  V L  GL L+S    L+Q  +   A  +  +I
Sbjct:  101 LGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFF---LKSTRVVSKDLSNKISEAADNIEEGTTAITP-------------------------SAEKTE--------------NN---DDDLLSFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPS------DYDFMPIV-GVLLLIGLSLVSTVMTLIQQQIEALASGMKDNI 316          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 114.775 bits (286), Expect = 4.318e-27
Identity = 87/268 (32.46%), Postives = 123/268 (45.90%), Query Frame = 1
Query:  640 LGVVTNNNDTAL-WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHI 1440
            LG+V  + D  + WT+ G+I Y +TV TTIGYGNIVP TG G+ ATI+YA IGIPL VL L  LGS+F    K+ + F    +K  R   K  ++ +S      +   T   P                         S EK +              NN     D    P+   L + +I+++  A+L +  E W +  S YF  I+F+TIGFGD++P         +  PIV  V L  GL L+S    L+Q  +   A  +  +I
Sbjct:  101 LGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFF---LKSTRVVSKDLSNKISEAADNIEEGTTAITP-------------------------SAEKTE--------------NN---DDDLLSFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPS------DYDFMPIV-GVLLLIGLSLVSTVMTLIQQQIEALASGMKDNI 316          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Match: twk-39 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A1EHR5])

HSP 1 Score: 110.153 bits (274), Expect = 3.752e-25
Identity = 51/119 (42.86%), Postives = 78/119 (65.55%), Query Frame = 1
Query: 1108 MNNLHRKG--DESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKSP 1458
            +++L R G  ++ ++P+ + +C+   +I  GA L S WE W   +  Y+ FIT STIGFGD+VPG    +   E K +VCA+YL FG+ L++MCF+LMQD V ++A  LG+ IG++  P
Sbjct:  478 LHSLRRNGHRNQEKMPVSVGICIVFAFISGGAWLFSWWENWNGFDGAYYCFITLSTIGFGDIVPGQALDEGSQE-KLVVCALYLLFGMALIAMCFKLMQDDVVQKARWLGQKIGILARP 595          

HSP 2 Score: 83.5741 bits (205), Expect = 1.284e-16
Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 1
Query:  667 TALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFL 873
            T  WT++GA+LYS+TV TTIGYG+I P T  G++ TI+Y+++GIPLM+LCL N+       F   Y  L
Sbjct:  118 TFQWTFSGALLYSITVFTTIGYGHICPKTDTGRLLTILYSILGIPLMLLCLANIAETLAQVFTYIYFKL 186          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 139.813 bits (351), Expect = 4.473e-36
Identity = 95/266 (35.71%), Postives = 143/266 (53.76%), Query Frame = 1
Query:  664 DTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTV-PXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILP--LCVFII--YILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPG---LLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRR--RAMKLG 1431
            D   W+++GA LYS+TVITTIGYGNI P +  GK+ TI+YA+IG+PL +L L+N+G +   +FK  Y        CR  P      I+       Q  +   +       G +    +S +T+    +       ++    + I   +  +++ R+   S   + +P  +CVF++  YIL GALL   WE W YL+  YF  I+ S+IGFGDLVPG   +   + K E   I+CA+YL  G+ +++MCF LMQ+ V    RA+K G
Sbjct:  123 DVEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIY---SKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIEREIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVHNIRAIKRG 385          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112644)

HSP 1 Score: 123.635 bits (309), Expect = 1.353e-29
Identity = 87/299 (29.10%), Postives = 146/299 (48.83%), Query Frame = 1
Query:  598 MIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCR--RKPRKKSA---------SILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWE-GWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQ----DFVRRRAMKLGKHIGL 1446
            +++ +   ++++ + G+V N   T  W++  A++YS T+ TTIGYG+I P TG G+  TI+YA+IGIP+ ++ L +LG +F    K  ++++R     R  R+ RK+           ++  +   +P    + + P N    +     +         T +S   +     T  +D            DE  LP+ +   + I YIL+G+    + E  W  L++ Y+VFI+ STIGFGDLVP        N    +V  +YL FGL L SM   ++Q    D  +  + K+G  IG+
Sbjct:  180 IMNTYPTVVQSLLRSGMVDN---TDPWSFWDAMVYSATIYTTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPE-----TFEVD------------DEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP-------SNPFYVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVGATIGM 451          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112645)

HSP 1 Score: 119.398 bits (298), Expect = 8.491e-28
Identity = 90/315 (28.57%), Postives = 147/315 (46.67%), Query Frame = 1
Query:  562 NITREANKSIGSM-IDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCR--RKPRKKSA---------SILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGAL-LISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKP---IVCAVYLFFGLVLLSMCFQLMQ----DFVRRRAMKLGKHIGL 1446
            N+  E  KS+    + +F   + N+ +LG+       + W +    ++  TVITTIGYG+I P TG G+  TI+YA+IGIP+ ++ L +LG +F    K  ++++R     R  R+ RK+           ++  +   +P    + + P N    +     +         T +S   +     T  +D            DE  LP+ +   + I YIL+G+   + +   W  L++ Y+VFI+ STIGFGDLVP          S P   +V  +YL FGL L SM   ++Q    D  +  + K+G  IG+
Sbjct:  576 NMREEDWKSLARQKLRSFEDELNNLAELGLRRYPGQKS-WNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPE-----TFEVD------------DEFNLPVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVP----------SNPFYVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVGATIGM 862          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG1688 (gene:FBgn0027589 transcript:FBtr0088495)

HSP 1 Score: 93.2041 bits (230), Expect = 1.834e-19
Identity = 40/101 (39.60%), Postives = 68/101 (67.33%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSN 957
            +  D+  W+++ A+LYSVTVITTIG+G++ P T  GK+ATI YA++G+PLM++CL++LG++  D  +  Y+ L   ++  ++ R+KS    S   +   +N
Sbjct:  184 DAGDSQSWSFSEALLYSVTVITTIGHGSLTPRTAAGKLATIFYALVGVPLMLMCLSSLGALLADGLQCTYVRLCCQLQRHQEHRRKSTPGTSTPSASSAAN 284          

HSP 2 Score: 73.559 bits (179), Expect = 3.181e-13
Identity = 34/105 (32.38%), Postives = 59/105 (56.19%), Query Frame = 1
Query: 1141 ELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            ++P+ L L +   YI VG ++ ++WE W  ++  YF F+T STIG+GD VP    S    E +   C  YL  GLVL++M F +++  +  +  ++   + L ++
Sbjct:  814 QVPISLVLLILASYICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPA--RSFNGPELQLYACCAYLLLGLVLVAMSFSILETQLMWKCKRIAVRLKLARA 916          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Match: CG9194 (gene:FBgn0035192 transcript:FBtr0072651)

HSP 1 Score: 92.0485 bits (227), Expect = 4.002e-19
Identity = 46/122 (37.70%), Postives = 73/122 (59.84%), Query Frame = 1
Query:  565 ITREAN--KSIGSMIDNFVKNIENITKLGVVTNNND--TALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSA 918
            + RE++   ++   + NF K I    K      + D   + WT+AG++ YS+ VITTIGYG+I P T  GKV TI YA++GIPLM++CL+N+G +   +F+  Y  +  ++  R   R ++A
Sbjct:   94 VLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRTAKRPRNA 215          

HSP 2 Score: 90.8929 bits (224), Expect = 9.720e-19
Identity = 45/108 (41.67%), Postives = 70/108 (64.81%), Query Frame = 1
Query: 1141 ELPLILPLCVFII--YILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIV--CAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVK 1452
            + P+ + LCVF++  YIL GA+L + WE W +L+S YF FIT +TIGFGD VP       K+ES+  +  C++YL FG+ LL+M F L+Q+       ++ + +G++K
Sbjct:  616 DRPVPIWLCVFLVVSYILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPA---KGVKDESEQSIAYCSLYLLFGIALLAMSFNLVQEEFIANVKEVARRLGILK 720          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 97.4413 bits (241), Expect = 2.361e-21
Identity = 73/293 (24.91%), Postives = 144/293 (49.15%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG----DAFKIFYIFLRN---HIKCRRKPRKKSAS-------------------ILSLTESQP--QSNKTTTVPXXXXXXXXXXXXXXXXXXXXRI-----TESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD----FVRR--RAMKLGK 1434
            WT+  ++ +  TV TT+GYG I P+T +GKVA ++YAM+GIPLM+L ++++G +       A+    +F R    H   R +  +K+++                   +L  T +Q   Q+  +    + +L     +          RI        SC +  +    +     +  N++ ++ ++ ++PL++ L +   Y+++ + ++  WE  + + ++ YF FIT +TIGFGD+VP       ++    +V  +++  G+ ++SM F+L Q     F RR  +++ +GK
Sbjct:  100 WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDR----VPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRRCIKSLSMGK 381          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 97.0561 bits (240), Expect = 2.920e-21
Identity = 73/293 (24.91%), Postives = 144/293 (49.15%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG----DAFKIFYIFLRN---HIKCRRKPRKKSAS-------------------ILSLTESQP--QSNKTTTVPXXXXXXXXXXXXXXXXXXXXRI-----TESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD----FVRR--RAMKLGK 1434
            WT+  ++ +  TV TT+GYG I P+T +GKVA ++YAM+GIPLM+L ++++G +       A+    +F R    H   R +  +K+++                   +L  T +Q   Q+  +    + +L     +          RI        SC +  +    +     +  N++ ++ ++ ++PL++ L +   Y+++ + ++  WE  + + ++ YF FIT +TIGFGD+VP       ++    +V  +++  G+ ++SM F+L Q     F RR  +++ +GK
Sbjct:  100 WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDR----VPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRRCIKSLSMGK 381          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 97.0561 bits (240), Expect = 3.106e-21
Identity = 73/293 (24.91%), Postives = 144/293 (49.15%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG----DAFKIFYIFLRN---HIKCRRKPRKKSAS-------------------ILSLTESQP--QSNKTTTVPXXXXXXXXXXXXXXXXXXXXRI-----TESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD----FVRR--RAMKLGK 1434
            WT+  ++ +  TV TT+GYG I P+T +GKVA ++YAM+GIPLM+L ++++G +       A+    +F R    H   R +  +K+++                   +L  T +Q   Q+  +    + +L     +          RI        SC +  +    +     +  N++ ++ ++ ++PL++ L +   Y+++ + ++  WE  + + ++ YF FIT +TIGFGD+VP       ++    +V  +++  G+ ++SM F+L Q     F RR  +++ +GK
Sbjct:  100 WTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDR----VPTPKDELFNDIGQEMEQLDVPLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVP-------EHPKFFMVTFLFIITGMAIMSMAFKLGQSQIVCFYRRCIKSLSMGK 381          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk2b (potassium channel, subfamily K, member 2b [Source:ZFIN;Acc:ZDB-GENE-051120-69])

HSP 1 Score: 68.1662 bits (165), Expect = 8.509e-12
Identity = 38/92 (41.30%), Postives = 56/92 (60.87%), Query Frame = 1
Query:  595 SMIDNFVKNIENITKLGV---VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLT----NLGSIFGDA 849
            S ++N VK + +  + GV     ++N ++LW  + +  +S TVITTIG+GNI P T  G++  IIYA++GIPL    L      LG+IFG A
Sbjct:   56 SDLENLVKQVVSALRAGVNPSGNSSNQSSLWDLSNSFFFSGTVITTIGFGNISPHTEVGRIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKA 147          

HSP 2 Score: 50.447 bits (119), Expect = 3.800e-6
Identity = 35/114 (30.70%), Postives = 54/114 (47.37%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNES------------KPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIG 1443
            S L  IL  C  ++++ + A++    EGW  L S YFV IT +TIGFGD V G    +   ES            KP+V   ++  GL   +    ++ D+ R  + K  + +G
Sbjct:  169 STLLFILFGC--LLFVTLPAVIFKHIEGWSALESIYFVVITLTTIGFGDFVAGEAERRHHEESSGGSQLEYLDYYKPLVW-FWILVGLAYFAAVLSMIGDWFRVISKKTKEEVG 279          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Match: kcnk17 (potassium channel, subfamily K, member 17 [Source:ZFIN;Acc:ZDB-GENE-120113-3])

HSP 1 Score: 65.855 bits (159), Expect = 2.548e-11
Identity = 37/104 (35.58%), Postives = 61/104 (58.65%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGVVTNNNDTA--LWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHI---KCRR 897
            +    + I++ +  G+  ++NDTA  LW +  + +++ TV+TTIGYGNIVP+T  G++  +++A+ GIPL V+ L  +G       + F  FL   I   KC R
Sbjct:   73 LSELAQMIKSASLSGLSPDSNDTADGLWKFTSSSVFAATVVTTIGYGNIVPLTTAGQIFCVMFALFGIPLNVVVLNRVGKYMLAIERHFCNFLEKKIDRGKCVR 176          

HSP 2 Score: 52.7582 bits (125), Expect = 4.684e-7
Identity = 29/72 (40.28%), Postives = 43/72 (59.72%), Query Frame = 1
Query: 1177 IYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLV----PGLLNSQWKNESKPIVCAVYLFFGLVLLSM 1380
            +Y++V  LL   +EGW Y  + Y+ FIT STIGFGD V    P +   +W +     + AV++FFGL  L++
Sbjct:  190 LYLVVPMLLFKEYEGWSYAEAIYYCFITLSTIGFGDYVADHNPEINYPEWYS----CLMAVWIFFGLAWLAL 257          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 65.4698 bits (158), Expect = 7.556e-11
Identity = 33/102 (32.35%), Postives = 62/102 (60.78%), Query Frame = 1
Query: 1108 MNNLHRKGDESE---LPLILPLCVFIIYILVGALLISIWEG-WVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            M N  + G+E +   +P++L + V + YI+ GA ++ +WE  W  +++ YF F+T +TIGFGD++P       K+ +  ++ + Y   G+V++ M F+L Q+
Sbjct:  237 MQNFDKIGEELDHLDVPIVLIVLVMVAYIMCGACILPLWEDDWTTIDAFYFCFVTLTTIGFGDIIP-------KHPNYFLLLSAYTVVGMVIVCMAFKLGQN 331          

HSP 2 Score: 55.0694 bits (131), Expect = 1.562e-7
Identity = 24/57 (42.11%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  631 ITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIP 801
            IT L V         W++  ++ +  TV TT+GYG+I PVT  GK+A ++YA +GIP
Sbjct:   51 ITDLQVEWLQKPEEQWSFKSSLFFCCTVFTTVGYGHICPVTMYGKLACMVYATLGIP 107          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: pold2 (polymerase (DNA directed), delta 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-999387])

HSP 1 Score: 65.0846 bits (157), Expect = 1.579e-10
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  625 ENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPR 906
            + +T  G  T NN    W +  A++++ TVITTIGYGNI P T  G++  I Y + G+PL +  ++ LG  FG   K    FL       RK +
Sbjct:   70 QGVTITGNTTFNN----WNWPNAVIFAATVITTIGYGNIAPKTSAGRLFCIFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVTLRKAQ 159          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: nkx3-2 (NK3 homeobox 2 [Source:Xenbase;Acc:XB-GENE-876834])

HSP 1 Score: 64.6994 bits (156), Expect = 2.392e-10
Identity = 37/103 (35.92%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGV---VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLT----NLGSIFGDAF-KIFYIFLRNHI 885
            +D  +K   +    GV     N+N ++ W    A  ++ TVITTIG+GNI P T  GK+  I+YA+ GIPL    L      LG+IFG +  ++  +FL+  +
Sbjct:  134 LDALIKRAIDADNAGVNPIGNNSNSSSHWDIGSAFFFAGTVITTIGFGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFLKKQV 236          

HSP 2 Score: 56.225 bits (134), Expect = 9.020e-8
Identity = 28/95 (29.47%), Postives = 53/95 (55.79%), Query Frame = 1
Query: 1174 IIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGL-LNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            ++++ + A++    EGW  L S YFV +T +TIGFGD V G   +  ++   KP+V   ++  GL   +    ++ D++R  + K  + +G +K+
Sbjct:  255 LVFVTIPAVIFKQIEGWTELESLYFVVVTLTTIGFGDFVAGGNADISYREWYKPLVW-FWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEIKA 348          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: ENSXETT00000028438.1 (potassium channel subfamily K member 17 [Source:NCBI gene;Acc:101731658])

HSP 1 Score: 60.8474 bits (146), Expect = 5.749e-10
Identity = 25/58 (43.10%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNL 828
            N+++   W++ G+  +SVTV+TTIGYGN+ P T   +   ++YA+ GIPL ++ LT L
Sbjct:   23 NSSNLGSWSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGIPLNLILLTKL 80          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Match: ENSXETT00000012069.1 (potassium channel subfamily K member 17 [Source:NCBI gene;Acc:101731658])

HSP 1 Score: 60.4622 bits (145), Expect = 1.101e-9
Identity = 25/58 (43.10%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNL 828
            N+++   W++ G+  +SVTV+TTIGYGN+ P T   +   ++YA+ GIPL ++ LT L
Sbjct:   46 NSSNLGSWSFGGSFFFSVTVVTTIGYGNLCPSTAGARAFCVVYALFGIPLNLILLTKL 103          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 86.6557 bits (213), Expect = 8.126e-18
Identity = 75/273 (27.47%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGD----AFKIFYIFL---------RNHIKCRRKPRKK-----------SASILSLTESQPQSN-KTTTVPXXXXXXXXXXXXXXXXXXXXRITE--SSCEKQKKLHFTISIDTGDFMNNLHRKGDESE-LPLILPLCVFII--YILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            W++  A+ +  TV +T+GYG++ PVT  GK   ++YA+ GIPLM L LT++G I       A+  F   L         R+   CR++P  K            A +  L   QP  +  + +               ++    TR  E  +SC +      + SI     ++NL   G + E L + LP+   ++  YI   A ++  WE  + + ++ YF F+T +TIGFGD+V  L++  +      +  ++Y+  G+ +L + F+LMQ+
Sbjct:  112 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSI-----LSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV--LVHPHFF-----LFFSIYIIVGMEILFIAFKLMQN 372          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk5 (potassium channel, subfamily K, member 5 [Source:MGI Symbol;Acc:MGI:1336175])

HSP 1 Score: 65.855 bits (159), Expect = 7.193e-11
Identity = 33/101 (32.67%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGVVTNNNDT-ALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFL-RNHIKCRR 897
            +D  ++ + +    GV    N T   W +  A++++ TVITTIGYGN+ P T  G++  + Y + G+PL +  ++ LG  FG   K    FL R  +  R+
Sbjct:   57 LDKILQVVSDAADQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTRRGVSLRK 157          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 62.7734 bits (151), Expect = 1.599e-10
Identity = 35/92 (38.04%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  619 NIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTN----LGSIFGDAFKIFYIFLRNH 882
            + +N     V  ++N ++ W    A  ++ TVITTIGYGNI P T  GK+  I+YA+ GIPL    L      LG+IFG +        R H
Sbjct:  133 DADNAGVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRAH 224          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk4 (potassium channel, subfamily K, member 4 [Source:MGI Symbol;Acc:MGI:1298234])

HSP 1 Score: 62.3882 bits (150), Expect = 5.701e-10
Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFK-----IFYIFLRNHIK 888
            ++N ++ W    A  +S T+ITTIGYGNIV  T  G++  I YA++GIPL  + L  +G   G + +     I  IFL+ H+ 
Sbjct:   82 SSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAIFLKWHVP 164          

HSP 2 Score: 51.2174 bits (121), Expect = 2.461e-6
Identity = 25/90 (27.78%), Postives = 46/90 (51.11%), Query Frame = 1
Query: 1174 IIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIG 1443
            ++++L    + S  E W  L + YFV +T +T+GFGD VPG    Q     +P+V   ++ FGL   +     + +++R  + +    +G
Sbjct:  182 LLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVW-FWILFGLAYFASVLTTIGNWLRAVSRRTRAEMG 270          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Match: Kcnk15 (potassium channel, subfamily K, member 15 [Source:MGI Symbol;Acc:MGI:2675209])

HSP 1 Score: 61.6178 bits (148), Expect = 7.457e-10
Identity = 25/52 (48.08%), Postives = 37/52 (71.15%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLG 831
            W +AG+  +++TVITTIGYG+  P T  GKV  + YA++GIPL ++   +LG
Sbjct:   78 WRFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLG 129          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 5.492e-26
Identity = 87/268 (32.46%), Postives = 123/268 (45.90%), Query Frame = 1
Query:  640 LGVVTNNNDTAL-WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHI 1440
            LG+V  + D  + WT+ G+I Y +TV TTIGYGNIVP TG G+ ATI+YA IGIPL VL L  LGS+F    K+ + F    +K  R   K  ++ +S      +   T   P                         S EK +              NN     D    P+   L + +I+++  A+L +  E W +  S YF  I+F+TIGFGD++P         +  PIV  V L  GL L+S    L+Q  +   A  +  +I
Sbjct:  101 LGIVPADMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLWRFF---LKSTRVVSKDLSNKISEAADNIEEGTTAITP-------------------------SAEKTE--------------NN---DDDLLSFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPS------DYDFMPIV-GVLLLIGLSLVSTVMTLIQQQIEALASGMKDNI 316          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|P34410|TWK7_CAEEL (TWiK family of potassium channels protein 7 OS=Caenorhabditis elegans OX=6239 GN=twk-7 PE=3 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 6.410e-21
Identity = 66/223 (29.60%), Postives = 100/223 (44.84%), Query Frame = 1
Query:  649 VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGS--------IFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVP 1293
            V  N  T  WT++ +I ++VTV+TTIGYGN VPVT  G++  I+++++GIPL ++ + +LG         ++G+  K+ Y+ L  H    RK R+                                             E  CE         S   G  MN      +E  +P  L L + I+Y   G +L+S  E W +  S Y+ FIT +T+GFGDL+P
Sbjct:  256 VKKNAATETWTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLYGNYLKLKYLILSRH----RKERR---------------------------------------------EHVCEHCH------SHGMGHDMNI-----EEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLMP 418          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6VV64|KCNKI_MOUSE (Potassium channel subfamily K member 18 OS=Mus musculus OX=10090 GN=Kcnk18 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.684e-17
Identity = 75/273 (27.47%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGD----AFKIFYIFL---------RNHIKCRRKPRKK-----------SASILSLTESQPQSN-KTTTVPXXXXXXXXXXXXXXXXXXXXRITE--SSCEKQKKLHFTISIDTGDFMNNLHRKGDESE-LPLILPLCVFII--YILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            W++  A+ +  TV +T+GYG++ PVT  GK   ++YA+ GIPLM L LT++G I       A+  F   L         R+   CR++P  K            A +  L   QP  +  + +               ++    TR  E  +SC +      + SI     ++NL   G + E L + LP+   ++  YI   A ++  WE  + + ++ YF F+T +TIGFGD+V  L++  +      +  ++Y+  G+ +L + F+LMQ+
Sbjct:  112 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSI-----LSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV--LVHPHFF-----LFFSIYIIVGMEILFIAFKLMQN 372          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q6Q1P3|KCNKI_RAT (Potassium channel subfamily K member 18 OS=Rattus norvegicus OX=10116 GN=Kcnk18 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.559e-16
Identity = 72/273 (26.37%), Postives = 128/273 (46.89%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLG----SIFGDAFKIFYIFL---------RNHIKCRRKPRKKSAS--------------ILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESE-LPLILPLCVFII--YILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            W++  A+ +  TV +T+GYG++ PVT  GK   ++YA+ GIPLM L LT++G    +I   A+  F   L         R  + CR++   K A               +L    S+  ++ +  V   + +         +         +SC +      + SI     ++NL   G + E L + LP+   +I  YI   A ++  WE  + + ++ YF F+T +TIGFGD+V  L++  +      +  ++Y+  G+ +L + F+LMQ+
Sbjct:  123 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILAAILSRAYSRFQALLCLPRDISKWRPLLLCRKQTDSKPADEAIPQIVIDAGADELLDPQPSREPASPSCNVELFERLVAREKQNELQPPMRPVERSNSCPELVLGRLSCSI-----LSNLDEVGQQVERLDIPLPVIALVIFAYISCAAAILPFWETDLGFEDAFYFCFVTLTTIGFGDIV--LVHPHFF-----LFFSIYIIVGMEILFIAFKLMQN 383          
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Match: sp|Q7Z418|KCNKI_HUMAN (Potassium channel subfamily K member 18 OS=Homo sapiens OX=9606 GN=KCNK18 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.465e-16
Identity = 76/277 (27.44%), Postives = 124/277 (44.77%), Query Frame = 1
Query:  661 NDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG-------DAFKIFYIFLRNHIK--CRRKPRKKSASILSLTESQPQ---------SNKTTTVPXXXXXXXXXXXXXXXXXXXXRIT--------ESSCEKQKKLHFTISIDTGDFMNNLHRKGDESE-LPLILPLCVFII--YILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            N T  W++  ++ +  TV +T+GYG I PVT  GK   ++YA+ GIPLM L LT+ G I         + F+ F  F R  +   C +   KK        E+ PQ           K  T P+       L   S        +          +SC +      + SI     ++NL   G + E L + LP+   I+  YI   A ++  WE  + + N+ YF F+T +TIGFGD V        ++ +  +  ++Y+  G+ ++ + F+L+Q+
Sbjct:   96 NRTTHWSFLSSLFFCCTVFSTVGYGYIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSRPSCSMELFERSHALEKQNTLQLPPQAMERSNSCPELVLGRLSYSI-----ISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAILPFWETQLDFENAFYFCFVTLTTIGFGDTV-------LEHPNFFLFFSIYIIVGMEIVFIAFKLVQN 360          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A0L8GLX0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031907mg PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.835e-52
Identity = 106/263 (40.30%), Postives = 145/263 (55.13%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDF--MNNLHRKGDESELPLILPLCVFIIYILVGALLISIWE-GWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            W++AGA+LYSVTVITTIGYG+I P T  G++ TI YA++GIPL +LCL NLGS+FG  F+ FY           K   +    L      PQ  K      N       +           I + S             D GD+   N   +  D + +P+I+ + +  IYI  GA+L ++WE  W YL   YF FIT STIGFGD VPG  +  WKN+ K I+CA+YL FGL L++MCF LMQ+ VR + + LG+ +G++ +
Sbjct:  322 WSFAGALLYSVTVITTIGYGHIAPKTAYGRIVTIFYALVGIPLTLLCLANLGSVFGTGFRCFY-----------KHACRFLCYLCFKSDSPQPRKPIRYRPNNRTNSEEVQEPLRGDQGDIIAQDS-------------DNGDYDDKNTNQKSKDGTRVPIIVSILLIAIYIFGGAMLFTLWEQDWDYLIGSYFCFITLSTIGFGDFVPGTSHDSWKNQEKLILCALYLVFGLALIAMCFDLMQEEVRAKCLWLGQRLGILDT 560          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: K1PY12 (TWiK family of potassium channels protein 7 OS=Crassostrea gigas OX=29159 GN=CGI_10019735 PE=3 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.810e-48
Identity = 109/301 (36.21%), Postives = 161/301 (53.49%), Query Frame = 1
Query:  559 ENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTA--LWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            +N T E  +    ++  F   I   TKL      +DTA   W++  ++LYS+TVITTIGYG+I P T QGK  TI+YA++GIP+ +LCLTNLG   GD F+ FY               K   +L++    P   K T+                ++       + S EK +     ++    D    ++ K  +  +P+ + L +  +YI  GA+L S WE W +L+  YF FIT STIGFGDLVPG+ +    N+ K I+C+ YL FGL +++MCF LMQ+ VR +   LG+ +GL++S
Sbjct:  254 QNWTYEMER----VLKEFQTEIYEATKLRGWDGQSDTAEAQWSFPNSLLYSITVITTIGYGHIAPKTDQGKFVTIVYALVGIPITLLCLTNLGGFLGDCFRWFY---------------KHVCLLTIWLCCPSQAKWTSERKRMSRTLTKGSHLPQTLPKKGKNDESLEKGE-----LTGSHEDITMAMNAK--QVRVPIFVSLMLIALYIFGGAILFSEWENWPWLDGAYFCFITLSTIGFGDLVPGMRSDSVANQEKLILCSFYLIFGLAIIAMCFDLMQEEVRAKFRWLGQKLGLIES 528          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A210QTX8 (TWiK family of potassium channels protein 18 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15723 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.403e-47
Identity = 106/306 (34.64%), Postives = 162/306 (52.94%), Query Frame = 1
Query:  550 SFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNND------TALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLV 1449
            +F  N+   AN ++ +  D+ +++ + +       N  D         W++AGA+LYS+TVITTIGYG+I P T  G++ T++YA+ GIPL +LCL N+GS   + F+  Y  +   +     P        S  +   QS+     P  +                  +  SS  K+ +LH  ++I  GD  +N + K ++  +P+++ L +   YI  GA L ++WEGW YL   YF FIT ST+GFGD VPG     + N  K I+CA YL FGL L++MCF+LMQ+ VR +   LG   G++
Sbjct:  198 TFLYNVFHTANWTVAA--DDILRDFQTLIYKATKENGWDGKDGEGEVQWSFAGALLYSITVITTIGYGHIAPKTANGRMVTVVYALFGIPLTLLCLANMGSFLANCFRFLYKNVCLAVIWLCCP--------SQAKWHRQSDSRIKTPTKEEAD---------------LIRSS--KKGELHDEVTIVIGDKTSNTNNKNEKVRVPILVSLMLIAAYIFGGATLFAMWEGWDYLVGSYFCFITLSTVGFGDFVPGAGVYSFSNNQKLIICAFYLIFGLSLIAMCFELMQEEVRAKFRWLGLKCGII 476          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: T1EJ43 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20196593 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.790e-47
Identity = 100/262 (38.17%), Postives = 149/262 (56.87%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCE-KQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWE-GWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            WT+AGA+LYS+TVITTIGYG+I P T  G++ T++YA++GIPL +  +TNLGS    AF+  Y   RN + CR   +K +      ++ +PQ++  +                   +    +T S+ +    +  F +   T D          + ++P+ + L +  IYI +GA L S+WE  W YL  CYF FIT STIGFGD VPG  + QW +++K ++CA+YLF GL L++MCF LM + +R    +  K IGL+ S
Sbjct:  112 WTFAGALLYSITVITTIGYGHIAPKTDWGRIVTMLYAILGIPLTLFTITNLGSFMATAFRFTY---RN-VCCRLTLKKYNKQTTLHSKLRPQTSPIS-----------KKRRKKHHSPQDHVTSSNHDVDDWRKRFDLIFFTSDI--------KQVKVPIYISLLIITIYIALGATLFSLWEKNWSYLIGCYFCFITLSTIGFGDYVPGTSSDQWNSQAKLVLCALYLFVGLALIAMCFDLMLEQIRSNLKEFAKKIGLLTS 350          
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Match: A0A4Z2DMW5 (Potassium channel subfamily K member 18 OS=Schistosoma japonicum OX=6182 GN=EWB00_010611 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.758e-45
Identity = 109/292 (37.33%), Postives = 156/292 (53.42%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFY----IFLRNHIKCRRKPRKKSASILSLTES----QPQSNK-----------------TTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEK-----QKKLHFTISIDTGDFMNNLHR--KGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQW-KNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVK 1452
            WT  GA+LY+VTVITTIGYG+IVP T  G+  T+IYA+ GIPL++LCL NLG    +  +I Y    +    H   ++  ++ ++SIL + +     QP   K                  T +P            S ES N   I +    +     Q  LH T++       +N+ +  K DE  +P+ L L VF IY+ VGA++ + WE W  L S YFVFIT STIGFGD VPG+   +W +N +KP+ C  YL FGL +++M F LMQ+ VR +  +    +GL++
Sbjct:  445 WTLTGALLYAVTVITTIGYGHIVPKTDLGRATTVIYALFGIPLVLLCLANLGGFLANTVRIIYANSCLKYHEHRVKKKLSKQHTSSILPILKDEDFIQPPKRKLLNRKITNHLTTHTTHDKTEMPTITNYVDQNKYTSKESINKQHINDYHAVRFERRAQSILH-TLTSSQSIISSNMQKVKKTDEVHVPMWLTLLVFFIYMTVGAIIFANWESWNLLQSAYFVFITLSTIGFGDFVPGIQTDKWHENSTKPVFCCFYLLFGLSMVAMSFNLMQEEVRAKFRRFASKVGLIE 735          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 1.550e-22
Identity = 94/336 (27.98%), Postives = 157/336 (46.73%), Query Frame = 1
Query:  487 TIKKLEGFKSISAKYKSMPIN-SFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRR------KPRKKSASILSLTESQPQSNKTTTV---------------------PXXXXXXXXXXXXXXXXXXXXR---ITES-SCEKQKKL-HFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWV-YLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQL 1392
            T++  EGF+    +  +   N S   N++ E  +++G  I    K         V   ++D   W + G++ +  TV TT+GYG I PVT  G+VA I+YA +GIPLM+L +T++G I    F   Y   R H  CRR       P +K    +++ +     N+   V                     P++ L  KN+           R   +T S SC +  ++    +     DF++  H + +   +P ++ L V   YIL+ AL++ IWE  +   ++ YF FIT +TIGFGD+VP       K+    ++  +++  G+ ++SM F+L
Sbjct:  169 TLEIHEGFRKFVHEVVNEARNKSTSANVSEEVLEAVGEKILREFK--------AVWMQSSDR--WHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSY--RRLHSSCRRLLYRVWNPHQKPRDPVTIRDGTYIFNRDVVVQEVSVDHRIGTAIDSSVIEQKPDHLLKNKNIFNHIIAKEKFRRKRPLTRSCSCPELNQMPPPPVGFKIKDFLSIGH-EMERFNVPFLVILLVVFAYILIWALILPIWEDDLGKFDAFYFCFITLTTIGFGDIVP-------KHPKFFMLTFLFIIMGMAIMSMAFKL 484          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:103027816])

HSP 1 Score: 65.4698 bits (158), Expect = 7.778e-11
Identity = 37/103 (35.92%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  625 ENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSL 933
            + +T  G  T NN    W +  A++++ TVITTIGYGNI P T  G+V  I Y + G+PL +  ++ LG  FG   K    +L       RK +    +I  L
Sbjct:   70 QGVTITGDKTFNN----WNWPNAVIFAATVITTIGYGNIAPKTPSGRVFCIFYGLFGVPLCLTWISELGKFFGGRAKHLGQYLTKRGVTLRKAQFTCTAIFLL 168          

HSP 2 Score: 50.8322 bits (120), Expect = 2.639e-6
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 1
Query: 1153 ILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGL-LNSQWKNESKPIVCAVYLFFGLVLLSMCF 1386
            I  L   ++++++   +    EGW Y+   YF F+T +TIGFGDLV G+  N+ +    +  V  V+++ GL  LS+ F
Sbjct:  165 IFLLWGVLVHLVIPPFVFMSQEGWTYIEGLYFSFVTLTTIGFGDLVAGVDPNADYPTLYRYFV-EVWIYLGLAWLSLFF 242          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 65.4698 bits (158), Expect = 7.899e-11
Identity = 37/88 (42.05%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  604 DNFVKNIENITKL---GVVTNNND-TALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFK 855
            +N  + +ENIT+    GV   NN  ++ W  A A  +S T+ITTIGYGNI P T  GK+  I YA++GIPL    L  +G   G   +
Sbjct:  123 ENLHELLENITEAIEAGVNAKNNTFSSSWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGLR 210          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: kcnk5b (potassium channel subfamily K member 5-like [Source:NCBI gene;Acc:103027221])

HSP 1 Score: 65.0846 bits (157), Expect = 9.281e-11
Identity = 30/86 (34.88%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGV-VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFK 855
            +D+ ++ +      GV +T  N    W++  A++++ T+ITTIGYGN+ P T  G+V  I++ + GIPL +  ++ LG+ FG   K
Sbjct:   57 LDSIIEVVAKAAGQGVTITGENHFNNWSWQNAVIFAATIITTIGYGNVSPKTVGGRVFCILFGLSGIPLCLTWISELGTFFGSRAK 142          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Match: KCNK4 (potassium channel subfamily K member 4-like [Source:NCBI gene;Acc:103026898])

HSP 1 Score: 64.6994 bits (156), Expect = 1.159e-10
Identity = 37/88 (42.05%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  604 DNFVKNIENITKL---GVVTNNND-TALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFK 855
            +N  + +ENIT+    GV   NN  ++ W  A A  +S T+ITTIGYGNI P T  GK+  I YA++GIPL    L  +G   G   +
Sbjct:   60 ENLHELLENITEAIEAGVNAKNNTFSSSWDLASAFFFSGTIITTIGYGNISPQTKWGKLFCICYALVGIPLFGFLLAGVGDHLGTGLR 147          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 1.297e-28
Identity = 69/246 (28.05%), Postives = 117/246 (47.56%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHI----KCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQD 1401
            W + G++ +  T+ TTIGYG+I P T  GK+  ++YA  GIP+M+L L ++G +        Y   R+ +    +C R+               P+ N                          +   S  E  ++L  T+SI  G  +    R+  E ++P  L   +  +Y++ G  L+  WE W YL++ YFVF+T +TIG GD+VP       K+ +  ++ ++Y+  G+ ++SM F+L QD
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRHRLLPGARCGRQHPPGDG---------PEGNDLQRSRTKIDDSHRHEGEDDAVDVPLKSPGSDVEGGRELPATVSIAEGADVPEADREVKELDVPFTLIFLIVFVYLMFGTFLLPCWEEWSYLDAFYFVFVTMTTIGLGDIVP-------KHPNFFMLTSIYIIIGMAIISMGFKLTQD 231          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 62.7734 bits (151), Expect = 4.007e-11
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  508 FKSISAKYKS---MPINSFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTA--LWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNL 828
            F ++   Y+    M +    +   R+        ++ F+++       GV    N TA   W +  A+ ++ TV+TT+GYG+ VP++  GK   I+YA++GIP  +L LT++
Sbjct:   27 FSTLERPYEERLRMDVRRLRDAFVRQHACLSDEALEGFLRDALEARTHGVSALRNATAGPHWDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSI 138          

HSP 2 Score: 50.0618 bits (118), Expect = 5.927e-7
Identity = 22/57 (38.60%), Postives = 33/57 (57.89%), Query Frame = 1
Query: 1180 YILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVY 1350
            +++  A+  S+ EGW +L + YF FI+ ST+G GD VPG  + Q   E   +   VY
Sbjct:  189 FVVPAAVFASLEEGWGFLGAFYFCFISLSTVGLGDYVPGEADRQPSRELYKVCVTVY 245          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 61.6178 bits (148), Expect = 1.053e-10
Identity = 30/84 (35.71%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  655 NNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTN----LGSIFGDAF-KIFYIFLRNHIKC 891
             N+ ++LW    A  ++ TV+TTIGYGN+ P T  G++    YA++GIP+    L      LG+IFG A  ++  +F++ H+  
Sbjct:   95 TNHSSSLWDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIFGKAIGRVEKVFMKWHVSA 178          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 51.9878 bits (123), Expect = 1.571e-7
Identity = 24/71 (33.80%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGV---VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPL 804
            +D F++ + +    GV       +  + W ++ A+L++VTV+TTIGYG+  P +  G+ +   YA++GIPL
Sbjct:   57 LDLFLQEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPL 127          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 51.2174 bits (121), Expect = 1.668e-7
Identity = 24/71 (33.80%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  601 IDNFVKNIENITKLGV---VTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPL 804
            +D F++ + +    GV       +  + W ++ A+L++VTV+TTIGYG+  P +  G+ +   YA++GIPL
Sbjct:   67 LDLFLQEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPL 137          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 50.8322 bits (120), Expect = 4.503e-7
Identity = 46/205 (22.44%), Postives = 79/205 (38.54%), Query Frame = 1
Query:  679 TYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVP 1293
            TY  A+ +    + T+G G+I+P +   K+  +I+++ G+ LM L +    SI   +    + F R   K R K  K       +  S+  S +                       +  I +++  KQ     +++I                         +F+ + L+GAL+    E W Y N  YF F+   TIG+GD  P
Sbjct:  273 TYGNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLIVFMTRSIIQKSSGPIFFFHRVE-KGRSKSWKHY-----MDSSKNLSEREA------------------FDLMKCIRQTASRKQHWFSLSVTI------------------------AIFMAFWLLGALVFKFAENWSYFNCIYFCFLCLLTIGYGDYAP 429          

HSP 2 Score: 47.3654 bits (111), Expect = 5.329e-6
Identity = 20/57 (35.09%), Postives = 32/57 (56.14%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGD 846
            W+Y   I +    + TIGYG+  P TG G+   +I+A+  +PLM   L+ +G +  D
Sbjct:  406 WSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGAVPLMGAILSTVGDLLFD 462          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 63.5438 bits (153), Expect = 4.091e-11
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 1
Query:  562 NITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLG 831
            NI+R+  K        FV  ++     G+  +  +   W+Y G++ +S TVITTIGYG++ P T  G++  ++YA+ GIP+  L LT+LG
Sbjct:   57 NISRKEMK-------EFVDVVQKAASFGLTQDWLEK--WSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLG 137          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO30949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZB8])

HSP 1 Score: 63.5438 bits (153), Expect = 4.320e-11
Identity = 35/114 (30.70%), Postives = 64/114 (56.14%), Query Frame = 1
Query:  559 ENITREANKSIGSMIDNF-------VKNIENITKLGVVT-NNNDTALWTY-AGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFL 873
            ++I +E  +++ ++ D+         +  EN T +   T + N+ A W+Y   AI + V + TT+GYG++ P +   +  T++ A+ GIPLM++ L++ G +F  A   F IFL
Sbjct:   34 QDIKQEKQQNLSNLFDHMRAKYNMTSQEFENFTSIAHATLSPNNKAKWSYFRNAIRFMVALCTTVGYGDLTPTSTLSRALTMLIALFGIPLMLMTLSSFGELFTTAMDKFIIFL 147          

HSP 2 Score: 47.7506 bits (112), Expect = 5.747e-6
Identity = 25/79 (31.65%), Postives = 40/79 (50.63%), Query Frame = 1
Query: 1162 LCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESK--PIVCAVYLFFGLVLLSMCFQL 1392
            L V +++I +G L+      W Y  S Y+ FITF+TIGFGD +       W    +   I   +Y+  GL +++  F +
Sbjct:  186 LLVLVMFIQIGILITKTLTPWSYEESFYYWFITFTTIGFGDYIIERDQGDWDLTYRVMSIAVVIYMLVGLSIMTSAFSV 264          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 62.003 bits (149), Expect = 9.321e-11
Identity = 37/87 (42.53%), Postives = 53/87 (60.92%), Query Frame = 1
Query:  676 WTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLT 936
            W++AG++ ++ TVITTIGYG+ VP T +GK+  +IYA +GIP   L LT   SI G+ F  F   +   +K  RK   K+  + S T
Sbjct:   79 WSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIP---LALTMFQSI-GERFNTFLACMFRRLK--RKLGMKATDVSSTT 159          

HSP 2 Score: 47.7506 bits (112), Expect = 4.660e-6
Identity = 28/81 (34.57%), Postives = 47/81 (58.02%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIV--CAVYLFFGLVLL 1374
            + L ++  L   +I +  GA + + +E W Y +S Y+ FIT +TIGFGD V  L +S+ +  S   V    +++FFGL ++
Sbjct:  159 TNLVVVCGLLAMVITVSSGAFIFTHYEKWDYFHSLYYCFITVTTIGFGDYV-ALQDSKDERYSNKYVGISLLFIFFGLTIV 238          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 60.4622 bits (145), Expect = 2.583e-10
Identity = 34/92 (36.96%), Postives = 50/92 (54.35%), Query Frame = 1
Query:  559 ENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGS 834
            +N+  + N S   M  N  K I      G    N D   W++AG++ ++ TV+TTIGYG + P T  G+V  I YA+ GIP+  L L ++G 
Sbjct:   31 QNLIEKYNISEKDM-RNLFKEISKAIDEGYFDVNYDR--WSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGE 119          

HSP 2 Score: 47.7506 bits (112), Expect = 3.862e-6
Identity = 37/104 (35.58%), Postives = 49/104 (47.12%), Query Frame = 1
Query: 1099 GDFMNNLHRK---GDESELPLILPLCVF---IIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIV---CAVYLFF--GLVLLS 1377
             DF   + R+    D   + +   L VF   I  +LV A L   +EGW Y    YF FIT STIGFGD VP   +    N    ++      +L+F  GL L+S
Sbjct:  126 ADFWRIIDRRLFNRDPKSIHMKTVLTVFALVITMLLVLAALAVEYEGWTYFQGIYFGFITLSTIGFGDYVPAHPSKDETNHPAFVIIFTLITFLYFTVGLALVS 229          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Match: EDO47667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC4])

HSP 1 Score: 58.9214 bits (141), Expect = 4.147e-10
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  610 FVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLG 831
            F++ IE I   G   +   +  W+  G++ ++ TV+TTIGYG++ P T  G+V  I YA++GIPL  L L+ L 
Sbjct:   51 FLERIEEIVDHGF--SREWSRRWSLLGSLFFAGTVVTTIGYGHVTPCTISGRVFCIFYALVGIPLTWLLLSTLA 122          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk5b (potassium channel subfamily K member 5-like [Source:NCBI gene;Acc:101156677])

HSP 1 Score: 73.1738 bits (178), Expect = 1.967e-13
Identity = 31/85 (36.47%), Postives = 54/85 (63.53%), Query Frame = 1
Query:  646 VVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGD-AFKIFYIFLRNHIKCRR 897
             +T +N    W +  +++++ T++TTIGYGN+ P T  G+V  I+Y + GIPL ++ L+ LGS FGD A ++  + +R  I  ++
Sbjct:   73 AITGDNHRNTWDWVNSVIFAATIVTTIGYGNVAPKTKGGRVFCILYGLCGIPLCLVWLSELGSFFGDRAKRLSQVMIRKGISVKK 157          

HSP 2 Score: 50.8322 bits (120), Expect = 2.763e-6
Identity = 26/73 (35.62%), Postives = 42/73 (57.53%), Query Frame = 1
Query: 1171 FIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCA-VYLFFGLVLLSMCF 1386
             ++++++   +    EGW YL   YF FIT +T+GFGD V G +N   +      VCA ++++ GL  LS+ F
Sbjct:  171 LLVHLVIPPFVFMSVEGWTYLEGIYFSFITLTTVGFGDYVAG-VNPDIQYPRLYRVCAEIWIYMGLAWLSLFF 242          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 69.707 bits (169), Expect = 1.949e-12
Identity = 33/92 (35.87%), Postives = 53/92 (57.61%), Query Frame = 1
Query:  559 ENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGS 834
             N ++  + S   M+D   K ++    +     +N    WT+ G++ +  TV TT+GYG I PVT  GKV  ++YAM+GIPLM+L + ++G 
Sbjct:   66 RNHSQNTSCSQSCMVDQVEKKMKTFNSIWFQNPDN----WTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGD 153          

HSP 2 Score: 57.7658 bits (138), Expect = 1.539e-8
Identity = 29/90 (32.22%), Postives = 54/90 (60.00%), Query Frame = 1
Query: 1132 DESELPLILPLCVFIIYILVGALLISIWE-GWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQ 1398
            D+ ++P +L L     YI +G L++ +WE  +   +  YF FIT +TIGFGD++P       K+ +  ++ ++++  G+ ++SM F+L Q
Sbjct:  285 DQLDVPFVLILFAVFAYICLGGLILPLWEKDFTDFDPYYFCFITLTTIGFGDIIP-------KHPNYFMLISLFIIVGMAIMSMAFKLSQ 367          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: ENSORLT00000039865.1 (potassium two pore domain channel subfamily K member 2 [Source:NCBI gene;Acc:101165275])

HSP 1 Score: 67.0106 bits (162), Expect = 2.059e-11
Identity = 34/90 (37.78%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  592 GSMIDNFVKNIENITKLGVVTNNN---DTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAF 852
             S +++ VK + +  + GV    N    T+LW  + +  ++ TVITTIG+GNI P T  G++  IIYA++GIPL    L  +G   G  F
Sbjct:  110 ASELEDLVKQVVSAVRAGVTPTGNLSLQTSLWDLSSSFFFAGTVITTIGFGNISPHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGTIF 199          

HSP 2 Score: 55.4546 bits (132), Expect = 9.279e-8
Identity = 35/102 (34.31%), Postives = 54/102 (52.94%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIG 1443
            S L  IL  C  +I++ + A++    EGW  L S YFV IT +TIGFGD V G    ++ N  KP+V   ++  GL   +    ++ D+ R  + K  + +G
Sbjct:  223 STLLFILFGC--LIFVALPAVIFKHIEGWSTLESIYFVVITLTTIGFGDFVAG--EKEYLNYYKPVVW-FWILVGLAYFAAVLSMIGDWFRVISKKTKEEVG 319          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: ENSORLT00000021678.2 (potassium two pore domain channel subfamily K member 2 [Source:NCBI gene;Acc:101165275])

HSP 1 Score: 67.0106 bits (162), Expect = 2.133e-11
Identity = 34/90 (37.78%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  592 GSMIDNFVKNIENITKLGVVTNNN---DTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAF 852
             S +++ VK + +  + GV    N    T+LW  + +  ++ TVITTIG+GNI P T  G++  IIYA++GIPL    L  +G   G  F
Sbjct:   97 ASELEDLVKQVVSAVRAGVTPTGNLSLQTSLWDLSSSFFFAGTVITTIGFGNISPHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGTIF 186          

HSP 2 Score: 50.0618 bits (118), Expect = 4.581e-6
Identity = 35/111 (31.53%), Postives = 54/111 (48.65%), Query Frame = 1
Query: 1138 SELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNS---------QWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIG 1443
            S L  IL  C  +I++ + A++    EGW  L S YFV IT +TIGFGD V G             ++ N  KP+V   ++  GL   +    ++ D+ R  + K  + +G
Sbjct:  217 STLLFILFGC--LIFVALPAVIFKHIEGWSTLESIYFVVITLTTIGFGDFVAGEKGHLTEGGSESLEYLNYYKPVVW-FWILVGLAYFAAVLSMIGDWFRVISKKTKEEVG 324          
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:101161107])

HSP 1 Score: 67.0106 bits (162), Expect = 2.483e-11
Identity = 31/73 (42.47%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  625 ENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFG 843
            + +T  G  T NN    W +  A++++ TVITTIGYGNI P T  G+V  I Y + G+PL +  ++ LG  FG
Sbjct:   70 QGVTITGSKTFNN----WNWPNAVIFAATVITTIGYGNIAPKTSSGRVFCIFYGLFGVPLCLTWISELGKFFG 138          

HSP 2 Score: 51.2174 bits (121), Expect = 2.124e-6
Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 1
Query: 1153 ILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIV----CAVYLFFGLVLLSMCF 1386
            I  L   ++++++   +    EGW Y+   YF F+T +TIGFGDLV G+      N+  P +      V+++ GL  LS+ F
Sbjct:  165 IFLLWGVLVHLVLPPFVFMSQEGWTYIEGLYFSFVTLTTIGFGDLVAGVE----PNKEYPTLYRYFVEVWIYLGLAWLSLFF 242          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000079785.1 (SMESG000079785.1)

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 278/280 (99.29%), Postives = 280/280 (100.00%), Query Frame = 1
Query:  121 MYGQRLNRKKRKSRLVRQSISCFTSNXXXXXXXXXXXXAGGFLFVFTEAGAERERINERILAVQSYKQKFIDESKKQTETFKKNLLNHAKHLFTEADKVVSIIDKPLNSNQLGRSMIFNRPETIKKLEGFKSISAKYKSMPINSFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNK 960
            MYGQRLNRKKRKSRLVRQSISCFTSNVTLVLILILYVIAGGFLFVFTEAGAERERINERILAVQSYKQKFIDESKKQTETFKKNLLNHAKHLFTEADKVVSIIDKPLNSNQLGRSMIFNRPETIKKLEGFK+ISAKYKSMPINSFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFY+FLRNHIKCRRKPRKKSASILSLTESQPQSNK
Sbjct:    1 MYGQRLNRKKRKSRLVRQSISCFTSNVTLVLILILYVIAGGFLFVFTEAGAERERINERILAVQSYKQKFIDESKKQTETFKKNLLNHAKHLFTEADKVVSIIDKPLNSNQLGRSMIFNRPETIKKLEGFKNISAKYKSMPINSFGENITREANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYLFLRNHIKCRRKPRKKSASILSLTESQPQSNK 280          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000031911.1 (SMESG000031911.1)

HSP 1 Score: 219.55 bits (558), Expect = 1.480e-63
Identity = 167/521 (32.05%), Postives = 266/521 (51.06%), Query Frame = 1
Query:  103 YFFPSRMYGQRLNRKKRKSRLVRQSISCFTSNXXXXXXXXXXXXAGGFLFVFTEAGAE-----------RERINERILAVQSYKQKFIDESK----------------KQTETFK--KNLLNHA--------KHLFTEADKVVSIIDKPLNSNQLGR------------------SMIFNRPETIKKLEG----FKSISAKYKSMPINSFGENITREANKS---------IGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIF--LRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPG--LLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLV 1449
            +FF ++   QR  R+++  R  +QSI+ F S + ++ I++ Y+IAGGFLF   EA  E            + + + +  ++S +Q+ +D+ K                + TE F   K  LN+A        + + T   + ++ I   LN  +  +                  + +++  E IKKLE     FK+   + +  P+      + +  +K+         I   I   + ++ N T+ G V N N   LWT++GA+LYS+T+ITTIGYG+IVP T  G+  TI+YA+IGIPLM+LCLTNLG +  D FK  Y F   + +IK R++   K   +L    +Q + +     P    I         +    T+ T  S         ++ +   +FM+++H   +E ++P+ LPL +  +YILVGA + S W+GW +  SCYFVFIT +TIGFGDLVPG   L  + ++++K I CA YL  GL + +MCF L+Q+ V+    +LGK IGL+
Sbjct:  106 HFFDAK---QREIRRQKCIRCCKQSIAFFFSQIGVMCIVVAYIIAGGFLFQNLEAKNEINISKSGESNINDSLKKLMEKIRSSEQETVDKYKSFCKRLIINQSSESNLRLTEFFNVNKKQLNNAIYTLQWNFQDMRTFIQEKITNIQSNLNLTKSSKFVSNNSALVIKDNLIEISNRLWDVGEEIKKLEALQNTFKTFPNQGEDPPLLKTKVKLLKTIDKTEFPNKDSDVINGKIKYLILSVFNATRNGYVFNGN--ILWTFSGALLYSITIITTIGYGHIVPKTFSGRFLTIVYAIIGIPLMLLCLTNLGKVMADLFKFMYRFTCFKVYIKSRKRKECKQ-KLLDSQNNQRKRSGNQNKPEFINILSENPSSILKKEITTKPTMHS------FRMSLPLGNANFMDSVHEISEEVDVPIWLPLTILGLYILVGAAVFSYWDGWTFFESCYFVFITLTTIGFGDLVPGNFELGEKSQDQTKSIFCAFYLVTGLAVFAMCFTLIQEKVKEWFEELGKRIGLI 614          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000013544.1 (SMESG000013544.1)

HSP 1 Score: 155.606 bits (392), Expect = 3.467e-40
Identity = 111/341 (32.55%), Postives = 172/341 (50.44%), Query Frame = 1
Query:  490 IKKLEGFKS-ISAKYKSMPINSF-GENIT-REANKSIGSMIDNF---VKNIENITKLGVVTNN--------NDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFY----------IFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHI 1440
            +KK++   + I+ KY    INS  G N++ R+ +  I S+  NF    + + ++TK G +  N        +   LWT+ G+ILY +TVITTIGYG+I P T  G+  TIIYA+ GIP+M++CL ++GS+  + F++ Y                 KC+   ++ S S   L +S  + N+ +                            S  + +K+ F I     + +    +K    E+P+ L + VFIIY LVG++  +I EGW   +S YF FIT STIGFGD VP  + ++ + + K I+C+ Y+ FGL L  M F LM+   +    K  K I
Sbjct:  350 LKKIDNLSNFINMKYNGKDINSLIGNNLSLRQKSSFIESLTKNFENLTETVFDVTKDGWIHENGHIGTEKGSGKTLWTFGGSILYCITVITTIGYGHITPKTIPGRFGTIIYAIFGIPIMLICLAHIGSLMANMFRLIYRVSCLKAFKKYKKSQKSKCQNSEKQSSTSNELLDKSDDEDNQISLTVVKNPHNPTGNYF------------GSTVQFRKILFHIP--NPNRLLEAAKKSKSVEVPVSLVITVFIIYNLVGSVFFTICEGWKITDSFYFSFITLSTIGFGDFVPVAIGNEAE-QYKSIMCSFYVLFGLSLCVMSFDLMEKKCKSTIKKTVKRI 675          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000078172.1 (SMESG000078172.1)

HSP 1 Score: 153.68 bits (387), Expect = 4.943e-40
Identity = 89/245 (36.33%), Postives = 134/245 (54.69%), Query Frame = 1
Query:  664 DTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFY-IFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNESKPIVCAVYLFFGLVLLSMCFQLM 1395
            +  +W + GA+LY+VTVITTIGYG+I P T  G++ TI+YA++GIPLM++CL N+G++  D  ++ Y IF       R+  + K  ++ S + S    + T TV     +        S           +C    KL    SI          R+   +E+P  L   +FI Y L+G+ +   WE W +L + YF FIT STIGFGDLVP + +++   + K I+C++Y+ FGL L  MCF L+
Sbjct:  309 ENTMWNFGGALLYAVTVITTIGYGHITPQTPLGRITTILYAIMGIPLMIICLANIGTLMADILRLIYRIF-----SMRKNNKPKMVNVKSDSFSDIFKSLTITVIRKNKLETKDNNFQSIF--------QNCNVSFKLPTPNSILKA------ARQSKSTEVPATLVFFIFIFYNLIGSTIFMYWEDWNFLEAVYFSFITLSTIGFGDLVP-IKSTRQTEQYKSIICSIYVLFGLSLCIMCFDLL 533          
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 136.346 bits (342), Expect = 7.894e-35
Identity = 106/322 (32.92%), Postives = 162/322 (50.31%), Query Frame = 1
Query:  529 YKSMPINSFGENITREANKSIGSMIDNFVKNI--------ENITKLGVVTNNNDTALWTYAGAILYSVTVITTIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIFLRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPXXXXXXXXXXXXXXXXXXXXRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESE---LPLILPLCVFIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKNES--KPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKS 1455
            Y+ + I + G N T    + + SM+ NF K +        ++ T +G     ++ + W  A +I +  T+ITTIGYGNIVP T  G++  IIYA IGIPLM+L L+N G +   AF+  Y    N   CR   + K  SI   +E +  S ++              + + E  N   +  +  +      F   ID    +  +  + D+ E   +PL + +   IIY+ +GAL+  IWE W  + + YF FIT STIGFGDL P   N+   + +  + IV AVY   GL +LSMC  L+++ +  +   LG  +G+VKS
Sbjct:   65 YRGVSIGNSGYNATIYYQQ-MYSMLFNFSKEVYTLGFSPSKDCTTIG---QPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVY---TNLCCCRCFVKGKYTSI---SEFESMSKRSAI-----------EIKNFELENAENLNSNPVKATPPPKF---IDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPA-KNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKS 361          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK181.554e-1627.44potassium two pore domain channel subfamily K memb... [more]
KCNK53.002e-1032.67potassium two pore domain channel subfamily K memb... [more]
KCNK168.378e-1032.17potassium two pore domain channel subfamily K memb... [more]
KCNK109.079e-1043.94potassium two pore domain channel subfamily K memb... [more]
KCNK109.471e-1043.94potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-481.639e-3431.78TWiK family of potassium channels [Source:UniProt... [more]
twk-281.356e-2830.87TWiK family of potassium channels [Source:UniProt... [more]
twk-184.318e-2732.46TWiK family of potassium channels protein 18 [Sou... [more]
twk-184.318e-2732.46TWiK family of potassium channels protein 18 [Sou... [more]
twk-393.752e-2542.86TWiK family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sand4.473e-3635.71gene:FBgn0033257 transcript:FBtr0088780[more]
CG343961.353e-2929.10gene:FBgn0085425 transcript:FBtr0112644[more]
CG343968.491e-2828.57gene:FBgn0085425 transcript:FBtr0112645[more]
CG16881.834e-1939.60gene:FBgn0027589 transcript:FBtr0088495[more]
CG91944.002e-1937.70gene:FBgn0035192 transcript:FBtr0072651[more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk182.361e-2124.91potassium channel, subfamily K, member 18 [Source:... [more]
kcnk182.920e-2124.91potassium channel, subfamily K, member 18 [Source:... [more]
kcnk183.106e-2124.91potassium channel, subfamily K, member 18 [Source:... [more]
kcnk2b8.509e-1241.30potassium channel, subfamily K, member 2b [Source:... [more]
kcnk172.548e-1135.58potassium channel, subfamily K, member 17 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK187.556e-1132.35potassium two pore domain channel subfamily K memb... [more]
pold21.579e-1037.23polymerase (DNA directed), delta 2, accessory subu... [more]
nkx3-22.392e-1035.92NK3 homeobox 2 [Source:Xenbase;Acc:XB-GENE-876834][more]
ENSXETT00000028438.15.749e-1043.10potassium channel subfamily K member 17 [Source:NC... [more]
ENSXETT00000012069.11.101e-943.10potassium channel subfamily K member 17 [Source:NC... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk188.126e-1827.47potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk57.193e-1132.67potassium channel, subfamily K, member 5 [Source:M... [more]
Kcnk101.599e-1038.04potassium channel, subfamily K, member 10 [Source:... [more]
Kcnk45.701e-1038.55potassium channel, subfamily K, member 4 [Source:M... [more]
Kcnk157.457e-1048.08potassium channel, subfamily K, member 15 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18120|TWK18_CAEEL5.492e-2632.46TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|P34410|TWK7_CAEEL6.410e-2129.60TWiK family of potassium channels protein 7 OS=Cae... [more]
sp|Q6VV64|KCNKI_MOUSE5.684e-1727.47Potassium channel subfamily K member 18 OS=Mus mus... [more]
sp|Q6Q1P3|KCNKI_RAT2.559e-1626.37Potassium channel subfamily K member 18 OS=Rattus ... [more]
sp|Q7Z418|KCNKI_HUMAN7.465e-1627.44Potassium channel subfamily K member 18 OS=Homo sa... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GLX02.835e-5240.30Uncharacterized protein OS=Octopus bimaculoides OX... [more]
K1PY121.810e-4836.21TWiK family of potassium channels protein 7 OS=Cra... [more]
A0A210QTX81.403e-4734.64TWiK family of potassium channels protein 18 OS=Mi... [more]
T1EJ436.790e-4738.17Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A4Z2DMW51.758e-4537.33Potassium channel subfamily K member 18 OS=Schisto... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047723.11.550e-2227.98pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
kcnk5a7.778e-1135.92potassium two pore domain channel subfamily K memb... [more]
KCNK47.899e-1142.05potassium channel subfamily K member 4-like [Sourc... [more]
kcnk5b9.281e-1134.88potassium channel subfamily K member 5-like [Sourc... [more]
KCNK41.159e-1042.05potassium channel subfamily K member 4-like [Sourc... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.11.297e-2828.05pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
kcnk74.007e-1128.57potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK101.053e-1035.71potassium two pore domain channel subfamily K memb... [more]
KCNK161.571e-733.80potassium two pore domain channel subfamily K memb... [more]
KCNK161.668e-733.80potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK14.503e-722.44Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO476684.091e-1136.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309494.320e-1130.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331939.321e-1142.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359232.583e-1036.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476674.147e-1039.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk5b1.967e-1336.47potassium channel subfamily K member 5-like [Sourc... [more]
kcnk181.949e-1235.87potassium two pore domain channel subfamily K memb... [more]
ENSORLT00000039865.12.059e-1137.78potassium two pore domain channel subfamily K memb... [more]
ENSORLT00000021678.22.133e-1137.78potassium two pore domain channel subfamily K memb... [more]
kcnk5a2.483e-1142.47potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member 18 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079785.10.000e+099.29SMESG000079785.1[more]
SMESG000031911.11.480e-6332.05SMESG000031911.1[more]
SMESG000013544.13.467e-4032.55SMESG000013544.1[more]
SMESG000078172.14.943e-4036.33SMESG000078172.1[more]
SMESG000016405.17.894e-3532.92SMESG000016405.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018157 ID=SMED30018157|Name=Potassium channel subfamily K member 18|organism=Schmidtea mediterranea sexual|type=transcript|length=1690bp
AGTAGTGAGTCGCTTTTTTGTAACAAAATAAACATGTGGAGAATGTTTAC
AAGAATGTTTACAACTGTTTCATAAATATCAATAAATTGTGAAGTTTACG
CATATTTTTTTCCCTCTCGCATGTATGGTCAAAGGCTCAACCGCAAGAAG
AGGAAATCGCGTTTGGTCCGCCAATCAATTTCTTGTTTCACGTCCAATGT
CACTTTAGTTTTAATTTTAATATTATACGTAATAGCTGGTGGATTTCTTT
TCGTTTTTACCGAAGCCGGAGCAGAAAGAGAACGTATCAACGAAAGAATT
TTAGCCGTTCAAAGTTACAAACAGAAATTTATTGACGAAAGTAAAAAGCA
AACGGAAACATTTAAGAAAAATCTTTTGAATCATGCTAAACATCTTTTTA
CCGAGGCTGATAAAGTTGTGTCAATAATAGACAAACCCTTGAATAGCAAT
CAGCTTGGTCGAAGTATGATTTTCAACAGGCCTGAAACCATTAAAAAATT
GGAAGGATTTAAAAGTATTTCCGCAAAATACAAATCAATGCCAATAAACA
GTTTTGGAGAAAATATTACCAGGGAAGCTAATAAATCTATTGGTTCTATG
ATTGACAACTTTGTTAAAAACATTGAAAACATAACCAAATTAGGGGTTGT
GACAAATAACAATGATACGGCTTTGTGGACCTATGCCGGGGCCATTTTGT
ACTCAGTCACAGTCATTACCACAATAGGATACGGAAATATAGTTCCTGTT
ACAGGCCAAGGGAAAGTGGCGACAATTATTTATGCTATGATTGGAATTCC
TCTGATGGTTCTCTGTCTCACCAATCTCGGTTCAATATTTGGTGATGCTT
TCAAGATATTTTATATATTTCTAAGAAATCACATAAAATGTCGACGGAAA
CCGAGAAAGAAAAGTGCATCTATATTATCCTTGACTGAAAGTCAACCTCA
ATCAAACAAAACTACAACAGTACCGAATAATAAGTTGATTGGGAAAAATC
TGTTGCTGCTTTCCAGTGAATCTACAAATTTGACAAGAATTACAGAATCA
AGTTGTGAAAAACAAAAGAAACTTCACTTTACCATTTCCATAGACACGGG
AGACTTCATGAATAATCTCCATAGGAAAGGAGACGAATCGGAATTGCCAT
TAATTTTACCGTTGTGCGTATTTATTATTTACATTTTGGTGGGAGCTTTA
TTAATCAGTATATGGGAGGGTTGGGTGTATTTAAATAGTTGTTATTTTGT
ATTCATTACATTTTCCACGATTGGCTTCGGGGACCTCGTTCCCGGGTTGC
TAAACTCACAGTGGAAAAACGAAAGTAAACCGATCGTCTGTGCTGTGTAT
TTATTTTTTGGGTTAGTTTTGTTGTCAATGTGTTTCCAATTAATGCAAGA
CTTCGTACGAAGGAGAGCCATGAAGTTGGGTAAGCATATTGGTCTAGTTA
AATCTCCCAGTCCCGCTTGAGCAGAAAGTAATCATTTTTCATGAAATATC
ATTCGAAATTTAAATTAGAAGATTTTTCTATAAAACAAATTAGATTTACT
CGTTATTTTTTATTTTAGTCTGTGTAATTTGATGTATATTATAAATATTG
TTAGATATGAGCACAAACTTTTTTTTTCAACTTCTGTATCATAAATATTT
TATTTGGATTTTCTCTTATAATTTTAGTTTTACATACGTG
back to top

protein sequence of SMED30018157-orf-1

>SMED30018157-orf-1 ID=SMED30018157-orf-1|Name=SMED30018157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MYGQRLNRKKRKSRLVRQSISCFTSNVTLVLILILYVIAGGFLFVFTEAG
AERERINERILAVQSYKQKFIDESKKQTETFKKNLLNHAKHLFTEADKVV
SIIDKPLNSNQLGRSMIFNRPETIKKLEGFKSISAKYKSMPINSFGENIT
REANKSIGSMIDNFVKNIENITKLGVVTNNNDTALWTYAGAILYSVTVIT
TIGYGNIVPVTGQGKVATIIYAMIGIPLMVLCLTNLGSIFGDAFKIFYIF
LRNHIKCRRKPRKKSASILSLTESQPQSNKTTTVPNNKLIGKNLLLLSSE
STNLTRITESSCEKQKKLHFTISIDTGDFMNNLHRKGDESELPLILPLCV
FIIYILVGALLISIWEGWVYLNSCYFVFITFSTIGFGDLVPGLLNSQWKN
ESKPIVCAVYLFFGLVLLSMCFQLMQDFVRRRAMKLGKHIGLVKSPSPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport