SMED30018138

Overview
NameSMED30018138
Smed IDSMED30018138
Length (bp)1873
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018138 (SMED30018138) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018138 (SMED30018138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018138 (SMED30018138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018138 (SMED30018138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018138SMESG000017276.1 Contig553newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018138SMESG000017276.1 Contig553uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018138SMESG000015393.1 Contig553newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018138SMESG000015393.1 Contig553uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermal cellSMED30018138SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30018138SMESG000017276.1 dd_Smed_v4_639_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018138SMESG000017276.1 dd_Smed_v6_639_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018138SMESG000017276.1 dd_Smed_v6_639_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30018138SMESG000017277.1 SMESG000017274.1 SMESG000017276.1 dd_Smed_v6_1245_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30018138SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018138SMESG000017276.1 dd_Smed_v4_1245_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30018138SMESG000017276.1 dd_Smed_v4_639_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018138SMESG000017276.1 dd_Smed_v4_639_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018138SMESG000017276.1 dd_Smed_v4_639_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30018138 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008447:8312..10702 -8755
v31.068434:46..2256 -8455
Homology
BLAST of SMED30018138 vs. Ensembl Human
Match: ANKRD50 (ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:HGNC:29223])

HSP 1 Score: 66.2402 bits (160), Expect = 1.616e-10
Identity = 33/99 (33.33%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIAC-----CAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +  EDVDG   + +A        GH  +V LLIDR  +++ CD DG  P+  A  E  +++V LL++   D+D  D+  + P+  A  +G   +VN L+
Sbjct:  524 VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL 622          

HSP 2 Score: 58.5362 bits (140), Expect = 3.867e-8
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            +E  D +G   +H++C  GH  +V++LI  H D+ A D +    +  A  +  +++V+LLI+H   +D   ++    + IA   G  ++V +L+ H  + ++A
Sbjct:  793 VEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHA 895          

HSP 3 Score: 56.6102 bits (135), Expect = 1.269e-7
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  159 RNAVKSGSEELFRRYFKEEFLEREDV-----DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            RNA++  + E  R   +  F    DV     DG   ++I        + +  ++   ++EA D +G   +H +C +  +E+V++LI +H D++A D++ +  +  A   G  ++V LLI H
Sbjct:  735 RNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEH 855          

HSP 4 Score: 53.1434 bits (126), Expect = 1.647e-6
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  153 LFRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            L  NA  SGS ++      +   LE ED  G+ P+ +A   GHT +V  LI    +I   D DGW  +  A      E+V  L+     +D  D+ ++  +  A   G  +IV  L+ H   ++ A ++
Sbjct:  369 LLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNE 497          
BLAST of SMED30018138 vs. Ensembl Human
Match: ANKRD50 (ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:HGNC:29223])

HSP 1 Score: 65.855 bits (159), Expect = 1.930e-10
Identity = 33/99 (33.33%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIAC-----CAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +  EDVDG   + +A        GH  +V LLIDR  +++ CD DG  P+  A  E  +++V LL++   D+D  D+  + P+  A  +G   +VN L+
Sbjct:  703 VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL 801          

HSP 2 Score: 58.151 bits (139), Expect = 4.635e-8
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            +E  D +G   +H++C  GH  +V++LI  H D+ A D +    +  A  +  +++V+LLI+H   +D   ++    + IA   G  ++V +L+ H  + ++A
Sbjct:  972 VEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHA 1074          

HSP 3 Score: 56.6102 bits (135), Expect = 1.493e-7
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  159 RNAVKSGSEELFRRYFKEEFLEREDV-----DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            RNA++  + E  R   +  F    DV     DG   ++I        + +  ++   ++EA D +G   +H +C +  +E+V++LI +H D++A D++ +  +  A   G  ++V LLI H
Sbjct:  914 RNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEH 1034          

HSP 4 Score: 52.7582 bits (125), Expect = 1.950e-6
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  153 LFRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            L  NA  SGS ++      +   LE ED  G+ P+ +A   GHT +V  LI    +I   D DGW  +  A      E+V  L+     +D  D+ ++  +  A   G  +IV  L+ H   ++ A ++
Sbjct:  548 LLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNE 676          
BLAST of SMED30018138 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 63.5438 bits (153), Expect = 2.155e-10
Identity = 32/103 (31.07%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  210 EEFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
             E L+RE +VD     GN  +HIA  AG   +VK+L+    ++ A   +G+ P++ A  E  +E+VK L+D+             P+ +A   G  ++V+LL+
Sbjct:   65 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 167          

HSP 2 Score: 55.4546 bits (132), Expect = 9.038e-8
Identity = 32/102 (31.37%), Postives = 46/102 (45.10%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
            E  D N     A  AGH       I    DI  C+ +G   +H A  E  +E+V  L+    ++DA   K    + IA   GQ E+V +L+ +  N+ NA S
Sbjct:   11 EQSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANV-NAQS 111          
BLAST of SMED30018138 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 62.3882 bits (150), Expect = 1.235e-9
Identity = 32/103 (31.07%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  210 EEFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
             E L+RE +VD     GN  +HIA  AG   +VK+L+    ++ A   +G+ P++ A  E  +E+VK L+D+             P+ +A   G  ++V+LL+
Sbjct:   74 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 176          

HSP 2 Score: 60.4622 bits (145), Expect = 5.423e-9
Identity = 27/85 (31.76%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  252 IHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            +H+A   GH  + K+L+D+  +  A   +G+ P+H AC +  I++++LL+ H   I A       PI +A  +G   IV+ L++H
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH 438          

HSP 3 Score: 57.7658 bits (138), Expect = 3.743e-8
Identity = 33/121 (27.27%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            L  R    +F  R D+    P+H+A   G+  +VKLL+DR   I+A   DG  P+H        ++V++L+D    I +       P+ +A        V LL+ H   + +  +D+  A 
Sbjct:  237 LLNRAAAVDFTARNDIT---PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTAL 354          

HSP 4 Score: 53.9138 bits (128), Expect = 6.715e-7
Identity = 36/121 (29.75%), Postives = 53/121 (43.80%), Query Frame = 3
Query:  180 SEELFRRYFKEEFLERE--DVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            SEE   +  K    +R+    D N     A  AGH       I    DI  C+ +G   +H A  E  +E+V  L+    ++DA   K    + IA   GQ E+V +L+ +  N+ NA S 
Sbjct:    2 SEEPKEKNAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANV-NAQSQ 121          
BLAST of SMED30018138 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 62.003 bits (149), Expect = 2.774e-9
Identity = 36/110 (32.73%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  210 EEFLEREDVD------GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E+ L+R DVD      G+  +  A   GH  I+KLL+ ++ D+EA D DG R +HHA    +  ++++L     D++A + + Q P+ IA   G  ++V  L++  C+ S
Sbjct:  448 EDLLKRPDVDVNGQCAGHTAMQAASQNGHVDILKLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPS 557          
BLAST of SMED30018138 vs. Ensembl Celegans
Match: C46H3.2 (pep chromosome:WBcel235:X:1211770:1230758:-1 gene:WBGene00016725.1 transcript:C46H3.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C46H3.2)

HSP 1 Score: 65.4698 bits (158), Expect = 8.568e-11
Identity = 36/124 (29.03%), Postives = 63/124 (50.81%), Query Frame = 3
Query:  138 NRDFHLFRNAVKSGSEELFRRYF--KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            N +F    NAVK G+  + + +   K  +++  D  G   +H++   G T +  LL+    ++++ D+DG    H AC +  I+   LLI +H DI   D   + P D+AC  GQ +++  L +
Sbjct:   28 NEEFTPLHNAVKMGNTVMAKNFIDSKSVWIDEPDCRGQTALHLSITYGDTEMTSLLLKGGANVDSVDYDGISACHIACKDGMIDHFNLLIYYHADICLVDRSGRTPFDLACEYGQEKMLERLFS 151          
BLAST of SMED30018138 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 61.2326 bits (147), Expect = 2.099e-9
Identity = 31/94 (32.98%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            VD   P+H+A   GH  + KLL+DR  D  +   +G+ P+H AC +  I++V+LL+ +   I+A       P+ +A  +G   IV  L+    N
Sbjct:  357 VDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          

HSP 2 Score: 53.1434 bits (126), Expect = 5.799e-7
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            P+HIA   G+T IV LL+    +  A   D + P+H A  E   E+  +L+DH+ D      K   P+ +A   G  E+V LL+
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 3 Score: 51.9878 bits (123), Expect = 1.395e-6
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E V G  P+H+A  A  T +V++LI     ++A   +   P+H A    + +IV LL+    + +A    N  P+ IA   GQ E+  +L++H  + +
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKT 551          

HSP 4 Score: 50.0618 bits (118), Expect = 6.247e-6
Identity = 28/91 (30.77%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            ++G  P+HIAC      +V+LL+     IEA    G  P+H A     I IV  L+    + D    + + P+ +A    QT++V +LI +
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          
BLAST of SMED30018138 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 61.2326 bits (147), Expect = 2.099e-9
Identity = 31/94 (32.98%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            VD   P+H+A   GH  + KLL+DR  D  +   +G+ P+H AC +  I++V+LL+ +   I+A       P+ +A  +G   IV  L+    N
Sbjct:  357 VDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          

HSP 2 Score: 53.1434 bits (126), Expect = 5.799e-7
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            P+HIA   G+T IV LL+    +  A   D + P+H A  E   E+  +L+DH+ D      K   P+ +A   G  E+V LL+
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 3 Score: 51.9878 bits (123), Expect = 1.395e-6
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E V G  P+H+A  A  T +V++LI     ++A   +   P+H A    + +IV LL+    + +A    N  P+ IA   GQ E+  +L++H  + +
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKT 551          

HSP 4 Score: 50.0618 bits (118), Expect = 6.247e-6
Identity = 28/91 (30.77%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            ++G  P+HIAC      +V+LL+     IEA    G  P+H A     I IV  L+    + D    + + P+ +A    QT++V +LI +
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          
BLAST of SMED30018138 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 61.2326 bits (147), Expect = 2.104e-9
Identity = 31/94 (32.98%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            VD   P+H+A   GH  + KLL+DR  D  +   +G+ P+H AC +  I++V+LL+ +   I+A       P+ +A  +G   IV  L+    N
Sbjct:  357 VDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          

HSP 2 Score: 53.1434 bits (126), Expect = 5.809e-7
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            P+HIA   G+T IV LL+    +  A   D + P+H A  E   E+  +L+DH+ D      K   P+ +A   G  E+V LL+
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 3 Score: 51.9878 bits (123), Expect = 1.397e-6
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E V G  P+H+A  A  T +V++LI     ++A   +   P+H A    + +IV LL+    + +A    N  P+ IA   GQ E+  +L++H  + +
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKT 551          

HSP 4 Score: 50.0618 bits (118), Expect = 6.257e-6
Identity = 28/91 (30.77%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            ++G  P+HIAC      +V+LL+     IEA    G  P+H A     I IV  L+    + D    + + P+ +A    QT++V +LI +
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          
BLAST of SMED30018138 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 61.2326 bits (147), Expect = 2.104e-9
Identity = 31/94 (32.98%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            VD   P+H+A   GH  + KLL+DR  D  +   +G+ P+H AC +  I++V+LL+ +   I+A       P+ +A  +G   IV  L+    N
Sbjct:  357 VDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          

HSP 2 Score: 53.1434 bits (126), Expect = 5.809e-7
Identity = 29/84 (34.52%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            P+HIA   G+T IV LL+    +  A   D + P+H A  E   E+  +L+DH+ D      K   P+ +A   G  E+V LL+
Sbjct:  494 PLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL 577          

HSP 3 Score: 51.9878 bits (123), Expect = 1.397e-6
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E V G  P+H+A  A  T +V++LI     ++A   +   P+H A    + +IV LL+    + +A    N  P+ IA   GQ E+  +L++H  + +
Sbjct:  454 ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKT 551          

HSP 4 Score: 50.0618 bits (118), Expect = 6.257e-6
Identity = 28/91 (30.77%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            ++G  P+HIAC      +V+LL+     IEA    G  P+H A     I IV  L+    + D    + + P+ +A    QT++V +LI +
Sbjct:  390 LNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN 480          
BLAST of SMED30018138 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 61.2326 bits (147), Expect = 1.534e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            VD    +H+A   GH  + KLL+DR+ D  A   +G+ P+H AC +  +++V+LL+ H   I A       P+ +A  +G   IV  L+ H
Sbjct:  335 VDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH 425          

HSP 2 Score: 52.373 bits (124), Expect = 9.313e-7
Identity = 31/128 (24.22%), Postives = 58/128 (45.31%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYFKEEF-LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            F  A ++G+ E    + K    +   + +G   +H+A   GH  +V  L+ R   +++    G   +H A      E+VKLL++H+  ++        P+ +A       +V LL+++  N S A  D
Sbjct:   15 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATED 142          

HSP 3 Score: 51.6026 bits (122), Expect = 2.027e-6
Identity = 27/101 (26.73%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            P+H+A   G T +V LL+++  +IEA   DG  P+H A      ++V +L++    I A       P+ +A      +   +L+ HR  +     D+  A 
Sbjct:  241 PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTAL 341          

HSP 4 Score: 50.8322 bits (120), Expect = 3.232e-6
Identity = 26/88 (29.55%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLL 497
            V G  P+H+A  A  T I+++L+     ++A   +   P+H A    +++IV LL+ H   +DA        + IA   GQ E+ +L+
Sbjct:  434 VRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLI 521          

HSP 5 Score: 50.447 bits (119), Expect = 3.908e-6
Identity = 26/89 (29.21%), Postives = 43/89 (48.31%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            ++G  P+HIAC      +V+LL+     I A    G  P+H A     + IV  L+ H    D    + + P+ +A    QT+I+ +L+
Sbjct:  368 LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 456          

HSP 6 Score: 49.6766 bits (117), Expect = 6.562e-6
Identity = 28/105 (26.67%), Postives = 46/105 (43.81%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
             G  P+H+A   G   IV  L+      +     G  P+H A      +I+++L+ +   +DA   + Q P+ IA  +G  +IV LL+ H   +     D   A 
Sbjct:  402 SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTAL 506          
BLAST of SMED30018138 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 61.2326 bits (147), Expect = 2.457e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            VD    +H+A   GH  + KLL+DR+ D  A   +G+ P+H AC +  +++V+LL+ H   I A       P+ +A  +G   IV  L+ H
Sbjct:  335 VDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH 425          
BLAST of SMED30018138 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 61.2326 bits (147), Expect = 2.786e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            VD    +H+A   GH  + KLL+DR+ D  A   +G+ P+H AC +  +++V+LL+ H   I A       P+ +A  +G   IV  L+ H
Sbjct:  335 VDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH 425          
BLAST of SMED30018138 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 61.2326 bits (147), Expect = 2.801e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            VD    +H+A   GH  + KLL+DR+ D  A   +G+ P+H AC +  +++V+LL+ H   I A       P+ +A  +G   IV  L+ H
Sbjct:  335 VDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH 425          
BLAST of SMED30018138 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 61.2326 bits (147), Expect = 2.805e-9
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            VD    +H+A   GH  + KLL+DR+ D  A   +G+ P+H AC +  +++V+LL+ H   I A       P+ +A  +G   IV  L+ H
Sbjct:  335 VDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH 425          
BLAST of SMED30018138 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 68.5514 bits (166), Expect = 1.728e-11
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
              +A +SG +E+ +    K   L   D    +PIH A   GH  +VKLL+ +  D    D  G+ P+H A     +++VK L+ +  +ID  ++     + +AC  GQ  + N L+N   N+ N P+
Sbjct:  144 LHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANV-NQPN 269          

HSP 2 Score: 57.7658 bits (138), Expect = 3.847e-8
Identity = 30/91 (32.97%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            P+HIA     T  V+ L+     +   D  G  P+HHA      E+VKLL++   ++ A D K+++PI  A  +G  E+V LL++   + S
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKS 200          

HSP 3 Score: 56.6102 bits (135), Expect = 7.631e-8
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            L   D  G  P+H A  +G+  +VKLL+++  ++ A D    +PIH A     +E+VKLL+    D    D +   P+  A   G  ++V  L+
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLL 226          
BLAST of SMED30018138 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 68.5514 bits (166), Expect = 1.797e-11
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
              +A +SG +E+ +    K   L   D    +PIH A   GH  +VKLL+ +  D    D  G+ P+H A     +++VK L+ +  +ID  ++     + +AC  GQ  + N L+N   N+ N P+
Sbjct:  144 LHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANV-NQPN 269          

HSP 2 Score: 57.7658 bits (138), Expect = 3.927e-8
Identity = 30/91 (32.97%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            P+HIA     T  V+ L+     +   D  G  P+HHA      E+VKLL++   ++ A D K+++PI  A  +G  E+V LL++   + S
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKS 200          

HSP 3 Score: 56.6102 bits (135), Expect = 7.657e-8
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            L   D  G  P+H A  +G+  +VKLL+++  ++ A D    +PIH A     +E+VKLL+    D    D +   P+  A   G  ++V  L+
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLL 226          
BLAST of SMED30018138 vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 65.855 bits (159), Expect = 2.699e-11
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER------EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            A K G  EL      EE LER          GN  +HIAC AG   + KLL+ +  D+ +   +G+ P++ A  E  +++V+ L+++  +          P+ IA   G  ++V+LL+ H
Sbjct:   58 AAKEGHVELV-----EELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEH 172          

HSP 2 Score: 48.9062 bits (115), Expect = 9.185e-6
Identity = 30/128 (23.44%), Postives = 59/128 (46.09%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYFKE-EFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            F  A ++G+ E    + K  + +   + +G   +H+A   GH  +V+ L++R   +++    G   +H AC     E+ KLL+    D+++       P+ +A      ++V  L+ +  N S A  D
Sbjct:   22 FLRAARAGNIEKVLEFLKSGQDISTCNQNGLNALHLAAKEGHVELVEELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATED 149          
BLAST of SMED30018138 vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 65.0846 bits (157), Expect = 1.005e-10
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER------EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            A K G  EL      EE LER          GN  +HIAC AG   + KLL+ +  D+ +   +G+ P++ A  E  +++V+ L+++  +          P+ IA   G  ++V+LL+ H
Sbjct:   49 AAKEGHVELV-----EELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEH 163          

HSP 2 Score: 50.447 bits (119), Expect = 4.287e-6
Identity = 32/121 (26.45%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            L  R    +F  R   +G  P+H+A   G+T ++ LL+DR   I+A   DG  P+H A        V++L++    I A       P+ ++      E V  L+ H+  + +   D+  A 
Sbjct:  230 LLNRGAAVDFTAR---NGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTAL 347          
BLAST of SMED30018138 vs. Ensembl Zebrafish
Match: BX511162.1 (ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926])

HSP 1 Score: 65.0846 bits (157), Expect = 1.135e-10
Identity = 36/120 (30.00%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER------EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            A K G  EL      EE LER          GN  +HIAC AG   + KLL+ +  D+ +   +G+ P++ A  E  +++V+ L+++  +          P+ IA   G  ++V+LL+ H
Sbjct:   74 AAKEGHVELV-----EELLERGAAVDSSTKKGNTALHIACLAGQKEVAKLLVKKTADVNSQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSMATEDGFTPLAIALQQGHNQVVSLLLEH 188          

HSP 2 Score: 60.8474 bits (146), Expect = 2.857e-9
Identity = 30/100 (30.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  252 IHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHR-----CNMSNAPSD 536
            +H+A   GH  + KLL+D+  +  A   +G+ P+H AC +  +++++LL+ +   I A       PI ++  +G   IV LL+ +      CN+ +APS 
Sbjct:  372 LHVAAHCGHYRVTKLLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVSAFMGHLNIVLLLLQNGASPDVCNIVSAPSS 471          

HSP 3 Score: 50.8322 bits (120), Expect = 3.626e-6
Identity = 32/121 (26.45%), Postives = 54/121 (44.63%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            L  R    +F  R   +G  P+H+A   G+T ++ LL+DR   I+A   DG  P+H A        V++L++    I A       P+ ++      E V  L+ H+  + +   D+  A 
Sbjct:  255 LLNRGAAVDFTAR---NGITPLHVASKRGNTNMIALLLDRGSQIDAKTRDGLTPLHCAARSGHDSAVEILLEKGAPILARTKNGLSPLHMSAQGDHVECVKHLLQHKAPVDDVTLDYLTAL 372          
BLAST of SMED30018138 vs. Ensembl Xenopus
Match: ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:779804])

HSP 1 Score: 66.2402 bits (160), Expect = 1.223e-10
Identity = 37/114 (32.46%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEF-LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            A K+G  E  R+ F++   L+ +D+    P+  AC +G+  +V+ L+++  D+ A D   W P+HHAC  +   I  LL+ H   IDA       P+  A   G     +LLIN
Sbjct:  504 ATKTGDMESLRKAFEDGVPLDVKDMFYKTPLMSACASGNLNVVQYLLEQGADVNATDNFLWTPLHHACHASQDAIADLLLKHGAKIDALAFNGSTPLMRAIESGSLNCAHLLIN 617          
BLAST of SMED30018138 vs. Ensembl Xenopus
Match: ankef1 (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:779804])

HSP 1 Score: 65.855 bits (159), Expect = 1.394e-10
Identity = 37/114 (32.46%), Postives = 58/114 (50.88%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEF-LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            A K+G  E  R+ F++   L+ +D+    P+  AC +G+  +V+ L+++  D+ A D   W P+HHAC  +   I  LL+ H   IDA       P+  A   G     +LLIN
Sbjct:  504 ATKTGDMESLRKAFEDGVPLDVKDMFYKTPLMSACASGNLNVVQYLLEQGADVNATDNFLWTPLHHACHASQDAIADLLLKHGAKIDALAFNGSTPLMRAIESGSLNCAHLLIN 617          
BLAST of SMED30018138 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 63.1586 bits (152), Expect = 6.084e-10
Identity = 31/123 (25.20%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  162 NAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDR------HCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC 512
            +AV  G   + R   ++  +   +  G   +HIA  +GH  +++ LI++        ++ A D     P+H A      E+V+LL+++  D ++ +   + P+ IA   G  EIVN+++  R 
Sbjct:  135 DAVTKGDLSILRNILRDTDINAVNPSGETLLHIAAASGHVAVIEYLINKDSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRA 257          
BLAST of SMED30018138 vs. Ensembl Xenopus
Match: senp1 (SUMO specific peptidase 1 [Source:Xenbase;Acc:XB-GENE-1014921])

HSP 1 Score: 63.929 bits (154), Expect = 6.399e-10
Identity = 37/136 (27.21%), Postives = 65/136 (47.79%), Query Frame = 3
Query:  147 FHLFRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRA 548
            F     + ++G E + R    K   L   D+ G  P+H+AC  G   IV++ + R  D+     D W  +H+A  +  + IV+LL      +I+A  S  + P+ +A   G   +  +L++ RC++ N PS   + 
Sbjct:  506 FTALHFSAQNGDECITRMLLEKSASLNEVDIKGRTPLHVACQHGQENIVRVFLRREADLTFKGQDNWLALHYAAWQGHLNIVRLLAKQPGANINAQTSDGRTPLHLAAQRGHYRVARILVDLRCDV-NIPSILMKT 640          

HSP 2 Score: 52.7582 bits (125), Expect = 1.759e-6
Identity = 24/97 (24.74%), Postives = 45/97 (46.39%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +  DG  P+H+A   GH  + ++L+D  CD+         P+H A         + L+     ++A  S+    +D+A  +G    V LL++ + N+
Sbjct:  601 QTSDGRTPLHLAAQRGHYRVARILVDLRCDVNIPSILMKTPLHVAAETGHTSTARFLLSRGASVNAVTSEGFTALDLASNLGHYSAVKLLMDEQSNV 697          

HSP 3 Score: 51.2174 bits (121), Expect = 5.059e-6
Identity = 32/126 (25.40%), Postives = 57/126 (45.24%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEF-LEREDVDGNRPIHIACCAGHTGIVKLLIDR-HCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            A + G E + R + + E  L  +  D    +H A   GH  IV+LL  +   +I A   DG  P+H A       + ++L+D  CD++      + P+ +A   G T     L++   +++   S+
Sbjct:  545 ACQHGQENIVRVFLRREADLTFKGQDNWLALHYAAWQGHLNIVRLLAKQPGANINAQTSDGRTPLHLAAQRGHYRVARILVDLRCDVNIPSILMKTPLHVAAETGHTSTARFLLSRGASVNAVTSE 670          
BLAST of SMED30018138 vs. Ensembl Xenopus
Match: dapk1 (death associated protein kinase 1 [Source:NCBI gene;Acc:100144678])

HSP 1 Score: 63.929 bits (154), Expect = 7.956e-10
Identity = 35/94 (37.23%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +G  PI  A   G+  IV+ L+D   D++A D DG   +H A     +E+VK LI H C +D  D     P+ +AC  G   IV  L   RCN+
Sbjct:  510 EGETPILTAAARGYHDIVECLVDHGGDLDATDKDGHIALHLAVRRCQMEVVKTLIIHGCFVDFQDRHGNTPLHVACKDGNLPIVMALCEARCNL 603          
BLAST of SMED30018138 vs. Ensembl Mouse
Match: Ankrd50 (ankyrin repeat domain 50 [Source:MGI Symbol;Acc:MGI:2139777])

HSP 1 Score: 65.855 bits (159), Expect = 1.317e-10
Identity = 33/99 (33.33%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIAC-----CAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +  EDVDG   + +A        GH  +V LLIDR  +++ CD DG  P+  A  E  +++V LL++   D+D  D+  + P+  A  +G   +VN L+
Sbjct:  666 VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL 764          

HSP 2 Score: 58.5362 bits (140), Expect = 2.784e-8
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            +E  D +G   +H++C  GH  +V++LI  H D+ A D +    +  A  +  +++V+LLI+H   +D   ++    + IA   G  ++V +L+ H  + ++A
Sbjct:  935 VEASDAEGRTALHVSCWQGHVEMVRVLIACHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHVDVVQVLLEHGADPNHA 1037          

HSP 3 Score: 56.225 bits (134), Expect = 1.399e-7
Identity = 31/121 (25.62%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  159 RNAVKSGSEELFRRYFKEEF-----LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            RNA++  + E  R   +  F     +  +D DG   ++I        + +  ++   ++EA D +G   +H +C +  +E+V++LI  H D++A D++ +  +  A   G  ++V LLI H
Sbjct:  877 RNALRVAALEGHRDIVELLFSHGADVNYKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGRTALHVSCWQGHVEMVRVLIACHADVNAADNEKRSALQSAAWQGHVKVVQLLIEH 997          

HSP 4 Score: 52.7582 bits (125), Expect = 1.332e-6
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  153 LFRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            L  NA  SGS ++      +   LE ED  G+ P+ +A   GHT +V  LI    +I   D DGW  +  A      E+V  L+     +D  D+ ++  +  A   G  +IV  L+ H   ++ A ++
Sbjct:  511 LLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNE 639          
BLAST of SMED30018138 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 2.528e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  210 EEFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
             E L+RE +VD     GN  +HIA  AG   +VK+L+    ++ A   +G+ P++ A  E  +E+V+ L+D+             P+ +A   G  ++V+LL+
Sbjct:   61 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 163          

HSP 2 Score: 53.5286 bits (127), Expect = 2.044e-7
Identity = 30/99 (30.30%), Postives = 45/99 (45.45%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
            D N     A  AGH       I    D+  C+ +G   +H A  E  +E+V  L+    ++DA   K    + IA   GQ E+V +L+ +  N+ NA S
Sbjct:   10 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANV-NAQS 107          

HSP 3 Score: 50.0618 bits (118), Expect = 3.069e-6
Identity = 25/100 (25.00%), Postives = 48/100 (48.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            +G   +H+A   GH  +V  L+ R  +++A    G   +H A      E+VK+L+ +  +++A       P+ +A      E+V  L+++  + S A  D
Sbjct:   43 NGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATED 142          
BLAST of SMED30018138 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 62.3882 bits (150), Expect = 4.313e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  210 EEFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
             E L+RE +VD     GN  +HIA  AG   +VK+L+    ++ A   +G+ P++ A  E  +E+V+ L+D+             P+ +A   G  ++V+LL+
Sbjct:   65 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 167          

HSP 2 Score: 55.8398 bits (133), Expect = 5.441e-8
Identity = 31/102 (30.39%), Postives = 47/102 (46.08%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
            E+ D N     A  AGH       I    D+  C+ +G   +H A  E  +E+V  L+    ++DA   K    + IA   GQ E+V +L+ +  N+ NA S
Sbjct:   11 EESDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANV-NAQS 111          
BLAST of SMED30018138 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 61.6178 bits (148), Expect = 6.857e-10
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  210 EEFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
             E L+RE +VD     GN  +HIA  AG   +VK+L+    ++ A   +G+ P++ A  E  +E+V+ L+D+             P+ +A   G  ++V+LL+
Sbjct:   74 SELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL 176          

HSP 2 Score: 53.1434 bits (126), Expect = 4.551e-7
Identity = 30/100 (30.00%), Postives = 45/100 (45.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            D N     A  AGH       I    D+  C+ +G   +H A  E  +E+V  L+    ++DA   K    + IA   GQ E+V +L+ +  N+ NA S 
Sbjct:   23 DANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANV-NAQSQ 121          
BLAST of SMED30018138 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 62.7734 bits (151), Expect = 1.101e-9
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E V G  P+H+A   GHT +V LL+ +  +    +  G  P+H    E  + +  +LI H   +DA       P+ +A   G  ++V  L+ H+ +++
Sbjct:  228 ESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVN 325          

HSP 2 Score: 60.4622 bits (145), Expect = 6.486e-9
Identity = 28/93 (30.11%), Postives = 50/93 (53.76%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            +G  P+H+A    +  IVKLL+ R     +  W+G+ P+H A  +  IE+ + L+ +    +A   +   P+ +A   G TE+V LL++ + N
Sbjct:  165 NGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQAN 257          

HSP 3 Score: 59.3066 bits (142), Expect = 1.463e-8
Identity = 28/100 (28.00%), Postives = 49/100 (49.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
             G  P+H+    GH  +  +LI     ++A    G+ P+H A    +I++VK L+ H  D++A       P+  A   G T+IV LL+ +  + +   S+
Sbjct:  264 SGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSN 363          

HSP 4 Score: 50.447 bits (119), Expect = 7.725e-6
Identity = 25/90 (27.78%), Postives = 39/90 (43.33%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            D   P+H A   GHTG+VKLL++           G  P+H A  E  ++    L++          K   P+ +A   G+  +  LL+ H
Sbjct:   66 DDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEH 155          
BLAST of SMED30018138 vs. UniProt/SwissProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.322e-10
Identity = 38/127 (29.92%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
              +A +SG +E+ +    K   L   D    +PIH A   GH  +VKLL+ +  D    D  G+ P+H A     +++VK L+ +  +ID  ++     + +AC  GQ  + N L+N   N+ N P+
Sbjct:  144 LHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANV-NQPN 269          

HSP 2 Score: 57.7658 bits (138), Expect = 2.816e-7
Identity = 30/91 (32.97%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            P+HIA     T  V+ L+     +   D  G  P+HHA      E+VKLL++   ++ A D K+++PI  A  +G  E+V LL++   + S
Sbjct:  110 PLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKS 200          

HSP 3 Score: 56.9954 bits (136), Expect = 5.491e-7
Identity = 29/94 (30.85%), Postives = 47/94 (50.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            L   D  G  P+H A  +G+  +VKLL+++  ++ A D    +PIH A     +E+VKLL+    D    D +   P+  A   G  ++V  L+
Sbjct:  133 LNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLL 226          
BLAST of SMED30018138 vs. UniProt/SwissProt
Match: sp|Q5UPG5|YL093_MIMIV (Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L93 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.510e-10
Identity = 35/109 (32.11%), Postives = 58/109 (53.21%), Query Frame = 3
Query:  207 KEEFLEREDVDGNRPIHIACCAGHTG----IVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            K   +  +D  G   + +AC   +T     I+KLL+D+  DI   + +GW  +  AC  A+IE +KLL+D + DI+A D     P+  AC     E + LL++ R +++
Sbjct:  310 KNADINAKDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKDGWTPLMFACVYANIETIKLLLDKRADIN 418          

HSP 2 Score: 58.5362 bits (140), Expect = 1.063e-7
Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTG----IVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQT----EIVNLLI 500
            +D  G   + +AC   +T     I+KLL+D+  DI   + +GW  +  AC  A+IE +KLL+D + DI+A D      + +AC    T    EI+ LL+
Sbjct:  247 KDKIGLTALMLACKYANTPNSIEIIKLLLDKGADINTGNGEGWTALMFACKYANIEAIKLLLDKNADINAKDKIGLTALMLACKYANTPNSIEIIKLLL 345          
BLAST of SMED30018138 vs. UniProt/SwissProt
Match: sp|Q9ULJ7|ANR50_HUMAN (Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4)

HSP 1 Score: 65.855 bits (159), Expect = 9.270e-10
Identity = 33/99 (33.33%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIAC-----CAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +  EDVDG   + +A        GH  +V LLIDR  +++ CD DG  P+  A  E  +++V LL++   D+D  D+  + P+  A  +G   +VN L+
Sbjct:  703 VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDGMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL 801          

HSP 2 Score: 58.151 bits (139), Expect = 2.226e-7
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            +E  D +G   +H++C  GH  +V++LI  H D+ A D +    +  A  +  +++V+LLI+H   +D   ++    + IA   G  ++V +L+ H  + ++A
Sbjct:  972 VEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEHGAVVDHTCNQGATALCIAAQEGHIDVVQVLLEHGADPNHA 1074          

HSP 3 Score: 56.6102 bits (135), Expect = 7.172e-7
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  159 RNAVKSGSEELFRRYFKEEFLEREDV-----DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            RNA++  + E  R   +  F    DV     DG   ++I        + +  ++   ++EA D +G   +H +C +  +E+V++LI +H D++A D++ +  +  A   G  ++V LLI H
Sbjct:  914 RNALRVAALEGHRDIVELLFSHGADVNCKDADGRPTLYILALENQLTMAEYFLENGANVEASDAEGRTALHVSCWQGHMEMVQVLIAYHADVNAADNEKRSALQSAAWQGHVKVVQLLIEH 1034          

HSP 4 Score: 52.7582 bits (125), Expect = 9.364e-6
Identity = 37/129 (28.68%), Postives = 59/129 (45.74%), Query Frame = 3
Query:  153 LFRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            L  NA  SGS ++      +   LE ED  G+ P+ +A   GHT +V  LI    +I   D DGW  +  A      E+V  L+     +D  D+ ++  +  A   G  +IV  L+ H   ++ A ++
Sbjct:  548 LLANAAYSGSLDVVNLLVSRGADLEIEDAHGHTPLTLAARQGHTKVVNCLIGCGANINHTDQDGWTALRSAAWGGHTEVVSALLYAGVKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNE 676          
BLAST of SMED30018138 vs. UniProt/SwissProt
Match: sp|Q5ZLC8|ANR52_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus OX=9031 GN=ANKRD52 PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.284e-9
Identity = 41/128 (32.03%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
              +AV SG  E+      K   L   D    +PIH A   GH  ++KLL+ R  D+   D  G+  +H A     IE+V+ L+    +ID  +S     + IAC +GQ  + N L+N+  N+ N P++
Sbjct:  144 LHHAVHSGHLEMVNLLLNKGASLSTCDKKDRQPIHWAAFLGHLEVLKLLVARGADVMCKDKKGYTLLHTAAASGQIEVVRHLLRLGVEIDEPNSFGNTALHIACYMGQDAVANELVNYGANV-NQPNE 270          

HSP 2 Score: 53.5286 bits (127), Expect = 6.399e-6
Identity = 25/84 (29.76%), Postives = 43/84 (51.19%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            P+H+A     T  V+ +I     +   D  G   +HHA     +E+V LL++    +  CD K+++PI  A  +G  E++ LL+
Sbjct:  110 PLHVAAANRATKCVEAIIPLLSTVNVADRTGRTALHHAVHSGHLEMVNLLLNKGASLSTCDKKDRQPIHWAAFLGHLEVLKLLV 193          
BLAST of SMED30018138 vs. UniProt/SwissProt
Match: sp|A1X157|CTTB2_ECHTE (Cortactin-binding protein 2 OS=Echinops telfairi OX=9371 GN=CTTNBP2 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.021e-9
Identity = 35/118 (29.66%), Postives = 61/118 (51.69%), Query Frame = 3
Query:  153 LFRNAVKSGSEELFRRYFKEEFLEREDV--DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            L + A   G+  L      EE L+      DG+  ++ A   GHT  V+LL++    + A D DG+ P+  A  +  ++ V+LL+ +H +I+   ++ Q P+ +AC  G  E + LL+
Sbjct:  716 LLQQAAAQGNVTLLSMLLNEEGLDINHSCEDGHSALYSAAKNGHTDCVRLLLNAEAQVNAADNDGFTPVCAAAAQGHVKCVELLVAYHANINHAAAEGQTPLYLACKNGNKECIKLLL 833          
BLAST of SMED30018138 vs. TrEMBL
Match: A0A1X7T0Y0 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 3.513e-14
Identity = 48/104 (46.15%), Postives = 65/104 (62.50%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTE--IVNLLIN-HRCN 515
            LE ED   NRP+H AC +G+  IV  L+ID+HCD+ A  W+G+ P+H AC     EIVK+L +H HC+I+A D  N RP+ +A      +  IVN L+   RCN
Sbjct:  324 LEAEDNSNNRPLHEACESGNVDIVCHLVIDKHCDVNAKRWNGYTPLHKACESGHFEIVKILTNHSHCNIEAEDEYNMRPLHVALNKRSPDMNIVNYLVEVKRCN 427          

HSP 2 Score: 80.8777 bits (198), Expect = 5.505e-12
Identity = 42/104 (40.38%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            LE ED   +RP+H AC +G+  IV+ L+ID+HCD+ A     + P+H+AC +   EIVK+L ++  C+++A D+ N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  256 LEAEDYSNDRPLHKACESGNVDIVRQLVIDKHCDVNAKGRSDYTPLHYACEKGYFEIVKVLTNNPQCNLEAEDNSNNRPLHEACESGNVDIVCHLVIDKHCDVN 359          

HSP 3 Score: 78.5666 bits (192), Expect = 3.502e-11
Identity = 42/104 (40.38%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  222 EREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDA-CDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            E ED   +RP+H AC +G+  IV+ L+ID+HCD+ A +  G+ P+H+AC +   EIVK+L +H  C+ +A  +  N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  120 EAEDNSNDRPLHKACESGNVDIVRHLVIDKHCDVNAKERFGYTPLHYACEKGHFEIVKILTNHPQCNTEAESNYSNDRPLHKACKSGNVDIVRHLVIDKHCDVN 223          

HSP 4 Score: 78.1814 bits (191), Expect = 3.850e-11
Identity = 44/107 (41.12%), Postives = 67/107 (62.62%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDR-HCDIEACDWDGWRPIHHACGEADIEIVK-LLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH-RCNMSNAPSDF 539
            ++++G  P+H AC  GH  IVK+LI+   C+ EA D    RP+H AC   +++IV+ L+ID HCD++A +     P+  AC  G  EIV +L NH +CN + A S++
Sbjct:   88 KEMNGYTPLHYACKKGHFEIVKILINHPQCNTEAEDNSNDRPLHKACESGNVDIVRHLVIDKHCDVNAKERFGYTPLHYACEKGHFEIVKILTNHPQCN-TEAESNY 193          

HSP 5 Score: 76.6406 bits (187), Expect = 1.460e-10
Identity = 42/101 (41.58%), Postives = 66/101 (65.35%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSDF 539
            R +  AC +G+  IV  L+ID+HCD+ A + +G+ P+H+AC +   EIVK+LI+H  C+ +A D+ N RP+  AC  G  +IV +L+I+  C++ NA   F
Sbjct:   60 RSLFDACESGNVDIVHHLVIDKHCDVNAKEMNGYTPLHYACKKGHFEIVKILINHPQCNTEAEDNSNDRPLHKACESGNVDIVRHLVIDKHCDV-NAKERF 159          

HSP 6 Score: 73.9442 bits (180), Expect = 8.069e-10
Identity = 38/96 (39.58%), Postives = 63/96 (65.62%), Query Frame = 3
Query:  243 NRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +RP+H AC +G+  IV+ L+ID+HCD+ A     + P+H+AC +   EIVK+L ++  C+++A D  N RP+  AC  G  +IV  L+I+  C+++
Sbjct:  196 DRPLHKACKSGNVDIVRHLVIDKHCDVNAKGRSDYTPLHYACEKGYFEIVKILTNNPQCNLEAEDYSNDRPLHKACESGNVDIVRQLVIDKHCDVN 291          
BLAST of SMED30018138 vs. TrEMBL
Match: A0A1X7VDC4 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.731e-14
Identity = 44/104 (42.31%), Postives = 70/104 (67.31%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED D +RP+H+AC +G+  IV+ L+ID+HCD+ A   DG+ P+H+AC +   E+ K+L DH  C+ +A  + N RP+  AC  G  +IV +L+I+  CN++
Sbjct:  292 IEAEDNDQDRPLHLACGSGNLDIVRHLVIDKHCDVNAKGRDGYTPLHYACEKGHFEMAKILTDHSQCNTEAESNSNDRPLHKACESGNLDIVPHLVIDKHCNVN 395          

HSP 2 Score: 83.9593 bits (206), Expect = 6.843e-13
Identity = 44/109 (40.37%), Postives = 69/109 (63.30%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLI-DHHCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSD 536
            +E ED D +RP+H+AC +G+  IV+ L+ID+HCD+ A  WDG  P+H AC   + E V+ L     C+I+A D+   RP+ +AC  G  +IV +L+I+  C+++    D
Sbjct:  224 IEAEDNDQDRPLHLACGSGNLDIVRHLVIDKHCDVNAKGWDGLTPLHVACLNRNFETVQFLTSSSECNIEAEDNDQDRPLHLACGSGNLDIVRHLVIDKHCDVNAKGRD 332          

HSP 3 Score: 83.5741 bits (205), Expect = 1.035e-12
Identity = 43/104 (41.35%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLI-DHHCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED D +RP+H+AC +G+  IV+ L+ID+HCD+ A  WDG  P+H AC   + E V+ L     C+I+A D+   RP+ +AC  G  +IV +L+I+  C+++
Sbjct:  156 IEAEDNDQDRPLHLACRSGNLDIVRHLVIDKHCDVNAKGWDGLTPLHVACLNRNFETVQFLTSSSECNIEAEDNDQDRPLHLACGSGNLDIVRHLVIDKHCDVN 259          

HSP 4 Score: 78.5666 bits (192), Expect = 3.068e-11
Identity = 42/104 (40.38%), Postives = 67/104 (64.42%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED D +RP+H+AC  G+  IV+ L+ID+HC + A  W  +  +H+ACG+   EIVK+L +H  C+I+A D  N RPI      G  +IV +L+++  C+++
Sbjct:  428 IEAEDNDQDRPLHLACRLGNVDIVRHLVIDKHCYVNAKGWHDYTALHYACGKGHFEIVKILTNHPQCNIEAEDILNDRPIHKVYESGNVDIVRHLVVDKHCDVN 531          

HSP 5 Score: 78.1814 bits (191), Expect = 4.253e-11
Identity = 41/104 (39.42%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED D +RP+H+AC +G+  IV+ L+ID+HCD+ A   +G+ P+H AC   + E V+ L     C+I+A D+   RP+ +AC  G  +IV +L+I+  C+++
Sbjct:   88 IEAEDNDQDRPLHLACRSGNLDIVRHLVIDKHCDVNAKGRNGYTPLHMACLNRNFETVQFLTSSTECNIEAEDNDQDRPLHLACRSGNLDIVRHLVIDKHCDVN 191          

HSP 6 Score: 73.559 bits (179), Expect = 1.319e-9
Identity = 39/104 (37.50%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED+  +RPIH    +G+  IV+ L++D+HCD+ A   +G+ P+H+AC +   EIVK+L +H  C+++A D  N RP+  A   G  +IV +L+++  C+++
Sbjct:  496 IEAEDILNDRPIHKVYESGNVDIVRHLVVDKHCDVNAKRGNGYTPLHYACEKGHFEIVKILTNHPQCNLEAKDILNDRPLHKAYESGNVDIVRHLVVDKHCDVN 599          

HSP 7 Score: 70.4774 bits (171), Expect = 1.006e-8
Identity = 36/83 (43.37%), Postives = 57/83 (68.67%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLI-DHHCDIDACDSKNQRPIDIA 461
            LE +D+  +RP+H A  +G+  IV+ L++D+HCD+ A   +G+ P+H+AC E   EIVK+L  D  C+I+A    N+RP+D+A
Sbjct:  564 LEAKDILNDRPLHKAYESGNVDIVRHLVVDKHCDVNAKRRNGYAPLHYACEEGHFEIVKILTNDPQCNIEAKSYCNRRPLDLA 646          

HSP 8 Score: 69.707 bits (169), Expect = 1.741e-8
Identity = 38/100 (38.00%), Postives = 61/100 (61.00%), Query Frame = 3
Query:  222 EREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRC 512
            E E    +RP+H AC +G+  IV  L+ID+HC++ A   +G+ P+H AC   + E V+ L     C+I+A D+   RP+ +AC +G  +IV +L+I+  C
Sbjct:  361 EAESNSNDRPLHKACESGNLDIVPHLVIDKHCNVNAKGRNGYTPLHAACLNGNFETVQFLTSSTECNIEAEDNDQDRPLHLACRLGNVDIVRHLVIDKHC 460          
BLAST of SMED30018138 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 9.821e-14
Identity = 46/104 (44.23%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED   NRP+H AC +G+  IV+ L+ID+HCD+ A  W+G+ P+H+AC +   EIVK+L +H  C+++A  S N RP+  AC  G  +IV +L+IN  C+++
Sbjct:  275 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVN 378          

HSP 2 Score: 83.1889 bits (204), Expect = 1.139e-12
Identity = 44/104 (42.31%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E +D   NRP+H AC +G+  IV+ L+ID+HCD+ A  W+G+ P+H+AC +   EIVK+L +H  C+++A  S N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  615 IEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVN 718          

HSP 3 Score: 80.1073 bits (196), Expect = 1.080e-11
Identity = 43/109 (39.45%), Postives = 71/109 (65.14%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSD 536
            +E E    +RP+H AC +G+  IV+ L+ID+HCD+ A  W+G+ P+H+AC +   EIVK+L +H  C+++A  + N RP+  AC  G  +IV +L+I+  C+++    D
Sbjct:  139 IEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKD 247          

HSP 4 Score: 79.337 bits (194), Expect = 1.733e-11
Identity = 44/104 (42.31%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED   +RP+H AC +G+  IV+ L+ID+HCD+ A    G+ P+H+AC +   EIVK+L +H  C+++A  S N RP+  AC  G  +IV +L+IN  C+++
Sbjct:  479 IEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVN 582          

HSP 5 Score: 78.9518 bits (193), Expect = 2.187e-11
Identity = 44/104 (42.31%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED   NRP+H AC +G+  IV+ L+ID+HCD+ A   +G+ P+H+AC +   EIVK+L +H  C+I+A D    RP+  AC  G  +IV +L+I+  C+++
Sbjct:  411 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVN 514          

HSP 6 Score: 78.9518 bits (193), Expect = 2.575e-11
Identity = 45/104 (43.27%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            LE E    +RP+H AC +G+  IV  L+ID+HCD+ A   DG+ P+H+AC +   EIVK+L +H  C+I+A D+ N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  207 LEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVN 310          

HSP 7 Score: 78.1814 bits (191), Expect = 4.353e-11
Identity = 44/104 (42.31%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            LE E    +RP+H AC +G+  IV+ L+ID+HCD+ A D  G+ P+H+AC +   E VK+L +H  C+I+A D+ N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  683 LEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVN 786          

HSP 8 Score: 77.0258 bits (188), Expect = 9.605e-11
Identity = 43/104 (41.35%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            LE E    +RP+H AC +G+  IV+ L+I++HCD+ A D  G+ P+H+AC +   E VK+L +H  C+I+A D+ N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  547 LEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVN 650          

HSP 9 Score: 76.6406 bits (187), Expect = 1.233e-10
Identity = 43/104 (41.35%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            LE E    +RP+H AC +G+  IV+ L+I++HCD+ A D  G+ P+H+AC +   E VK+L +H  C+I+A D+ N RP+  AC  G  +IV +L+I+  C+++
Sbjct:  343 LEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVN 446          

HSP 10 Score: 75.0998 bits (183), Expect = 3.673e-10
Identity = 42/104 (40.38%), Postives = 68/104 (65.38%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED   +RP+H AC +G+  IV  L+ID+HC++ A   +G+ P+H+AC +   EIVK+L +H  C+I+   S N RP+  AC  G  +IV +L+I+  C+++
Sbjct:   71 IEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVN 174          

HSP 11 Score: 72.7886 bits (177), Expect = 1.784e-9
Identity = 40/96 (41.67%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +E ED   NRP+H AC +G+  IV+ L+ID+HCD+ A   +G+ P+H+AC +   EIVK L +H  C+  A D  + RP+  AC     +IV  L+
Sbjct:  751 IEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLV 846          

HSP 12 Score: 70.0922 bits (170), Expect = 1.274e-8
Identity = 46/124 (37.10%), Postives = 68/124 (54.84%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEF--LEREDVDGNRPIHIACCAGHTGIVKLLIDR-HCDIEACDWDGWRPIHHACGEADIEIVK-LLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH-RCNMS 521
            A +SG+ ++ R    ++   +  +D  G  P+H AC  GH   VK+L +   C+IEA D    RP+H AC   +++IV+ L+ID HCD++A       P+  AC  G  EIV  L NH +CN  
Sbjct:  697 ACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTK 820          

HSP 13 Score: 67.3958 bits (163), Expect = 9.158e-8
Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            EDV  +RP+H AC + +  IV+ L+ID+H D+ A   DG+ P+H+AC +   EIVK+L +H  C+ +A D  + R +  AC  G+ +IV  L+
Sbjct:  822 EDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLV 914          

HSP 14 Score: 67.3958 bits (163), Expect = 9.641e-8
Identity = 39/95 (41.05%), Postives = 61/95 (64.21%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            R +  AC   +  IV+ L+ID+HCD+ A   +G+ P+H+AC E   EIV++L DH  C+I+  D+ N RP+  AC  G  +IV +L+I+  CN++
Sbjct:   12 RSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVN 106          

HSP 15 Score: 62.7734 bits (151), Expect = 2.457e-6
Identity = 41/103 (39.81%), Postives = 57/103 (55.34%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDR-HCDIEACDWDGWRPIHHACGEADIEIVK-LLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH-RCNMSNAPSD 536
            DG  P+H AC  GH  IVK+L +   C+ EA D    R +H AC    ++IV+ L+ID H D++A       P+  AC  G  EIV +L NH +CN+    +D
Sbjct:  859 DGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENND 961          

HSP 16 Score: 61.6178 bits (148), Expect = 5.130e-6
Identity = 34/82 (41.46%), Postives = 54/82 (65.85%), Query Frame = 3
Query:  222 EREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIA 461
            E EDV  +R +H AC  G   IV+ L+ID+H D+ A   +G+ P+H+AC +   EIVK+L +H  C+I+A ++ N+ P+ +A
Sbjct:  888 EAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLA 969          
BLAST of SMED30018138 vs. TrEMBL
Match: A0A1V5NP54 (Phosphocholine transferase AnkX OS=bacterium ADurb.Bin374 OX=1866937 GN=ankX_3 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.977e-13
Identity = 34/103 (33.01%), Postives = 59/103 (57.28%), Query Frame = 3
Query:  207 KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            K E +  ++ DG  P+H AC AG   +V+ L+    D+ ACD +G  P+HHA    +  ++ LL++   +IDA DS+   P+ +A   G+ + V LL++ + +
Sbjct:   43 KPELVSLKNPDGETPLHCACAAGQKAVVEFLLSNGADVRACDGEGMTPLHHAATATEPAVISLLLEKGAEIDARDSEGVTPLLVAIAGGELKPVQLLLDAKAD 145          

HSP 2 Score: 65.0846 bits (157), Expect = 7.324e-8
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 3
Query:  231 DVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEAD------IEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            D +G  P+ +A   G    V+LL+D   D +A D  G   +H+A G+ +      IEI KLL+     I A D++   P+ +A   G+ E V  L+ H  + +
Sbjct:  117 DSEGVTPLLVAIAGGELKPVQLLLDAKADAKAVDKAGLAALHYAAGDGESEAPERIEIYKLLVAKGASIGATDAEGVTPLHLAAAAGEKEAVEFLLGHGADAA 219          
BLAST of SMED30018138 vs. TrEMBL
Match: A0A1X7T6C2 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.026e-13
Identity = 45/104 (43.27%), Postives = 70/104 (67.31%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E E  D  RP+H AC +G+  IV+ L+ID+HCD+ A D DG+ P+H+AC + + EIV++L +   C+I+A D  N RP+  AC  G  +IV +L+I+  CN++
Sbjct:  602 IEAEGTDSLRPLHKACKSGNVDIVRHLVIDKHCDVNAKDRDGYTPLHYACDKGNFEIVEILTNQSQCNIEAEDKYNDRPLHKACESGNVDIVCHLVIDKHCNVN 705          

HSP 2 Score: 80.1073 bits (196), Expect = 1.089e-11
Identity = 41/92 (44.57%), Postives = 58/92 (63.04%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV 488
            +E E  D  RP+H AC +G+  IV  L+ID+HCD+ A D DG+ P+H+AC +   EIVK+L +   C+ +A D+ N RPI  AC  G  +I 
Sbjct:  806 IEAEGTDSLRPLHKACKSGNVDIVCHLVIDKHCDVNAKDKDGYTPLHYACNKGLFEIVKILTNQPQCNFEAEDNSNDRPIHKACKSGNVDIA 897          

HSP 3 Score: 78.9518 bits (193), Expect = 2.443e-11
Identity = 42/104 (40.38%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD-IDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E E  D  RP+H AC +G+  IV  L+ID+HCD+ A D DG+ P+H+AC + D +IV++L    C+ I+A  + + RP+  AC  G  +IV +L+I+ +C+++
Sbjct:  427 IEAEGTDSLRPLHKACKSGNVDIVCHLVIDKHCDVNAKDKDGYTPLHYACDKGDFQIVQILTKSQCNTIEAEGTDSLRPLHKACKSGNVDIVRHLVIDKQCDVN 530          

HSP 4 Score: 77.7962 bits (190), Expect = 5.768e-11
Identity = 42/109 (38.53%), Postives = 70/109 (64.22%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD-IDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSD 536
            +E E  D  RP+H AC +G+  IV+ L+ID+HCD+ A + DG+ P+H+AC + D +IV++L    C+ I+A  + + RP+  AC  G  +IV +L+I+  C+++    D
Sbjct:  359 IEAEGTDSLRPLHKACKSGNVDIVRHLVIDKHCDVNAKNRDGYTPLHYACDKGDFQIVEILTKSQCNTIEAEGTDSLRPLHKACKSGNVDIVCHLVIDKHCDVNAKDKD 467          

HSP 5 Score: 77.7962 bits (190), Expect = 6.561e-11
Identity = 41/104 (39.42%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD-IDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E E  D  RP+H AC +G+  IV+ L+ID+HCD+ A D DG+ P+H+AC + + +IV++L    C+ I+A  + + RP+  AC  G  +IV +L+I+  C+++
Sbjct:  291 IEAEGTDSLRPLHKACKSGNVDIVRHLVIDKHCDVNAKDKDGYTPLHYACDKGNFQIVEILTKSQCNTIEAEGTDSLRPLHKACKSGNVDIVRHLVIDKHCDVN 394          

HSP 6 Score: 76.2554 bits (186), Expect = 1.822e-10
Identity = 42/104 (40.38%), Postives = 67/104 (64.42%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIV-KLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMS 521
            +E ED   +RP+H AC +G+  IV  L+ID+HC++ A   +G  P+H+AC  +  E VK+L +   C+I+A D+ N RP+  AC  G  +IV +L+IN  C+++
Sbjct:  670 IEAEDKYNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGTNGNTPLHYACERSHFEFVKILTNQSQCNIEAEDNSNDRPLHKACKSGNVDIVHHLVINKHCDVN 773          

HSP 7 Score: 75.485 bits (184), Expect = 3.498e-10
Identity = 40/98 (40.82%), Postives = 57/98 (58.16%), Query Frame = 3
Query:  240 GNRPIHIACCAGHTGIVKLLIDRHCD-IEACDWDGWRPIHHACGEADIEIVK-LLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            GN P+H AC  G+  IV++L    C+ IEA   D  RP+H AC   +++IV+ L+ID HCD++A D     P+  AC  G  +IV +L   +CN   A
Sbjct:  264 GNTPLHYACDKGNFQIVEILTKSQCNTIEAEGTDSLRPLHKACKSGNVDIVRHLVIDKHCDVNAKDKDGYTPLHYACDKGNFQIVEILTKSQCNTIEA 361          

HSP 8 Score: 74.7146 bits (182), Expect = 5.147e-10
Identity = 42/110 (38.18%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD-IDACDSKNQRPIDIACC-----VGQTEIVNLLINHRCNMSNA 527
            +E E  D  RP+H AC +G+  IV+ L+ID+ CD+ A D DG+ P+H+AC + +  IVK+L    C+ I+A  +   RP+  AC      +G  +IV  L   +CN   A
Sbjct:  495 IEAEGTDSLRPLHKACKSGNVDIVRHLVIDKQCDVNAKDRDGYTPLHYACDKGNFRIVKILTKSQCNTIEAEGTDRLRPLHKACKSGNVDIGNFQIVETLTKSQCNTIEA 604          

HSP 9 Score: 71.2478 bits (173), Expect = 6.290e-9
Identity = 40/109 (36.70%), Postives = 69/109 (63.30%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD-IDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSD 536
            +E ED   +RP+H AC +G+  IV  L+I++HCD+ A D  G+ P+H+AC + + +IV++L    C+ I+A  + + RP+  AC  G  +IV +L+I+  C+++    D
Sbjct:  738 IEAEDNSNDRPLHKACKSGNVDIVHHLVINKHCDVNAKDRYGYAPLHYACDKDNFQIVEILTKSQCNTIEAEGTDSLRPLHKACKSGNVDIVCHLVIDKHCDVNAKDKD 846          

HSP 10 Score: 71.2478 bits (173), Expect = 6.399e-9
Identity = 47/123 (38.21%), Postives = 72/123 (58.54%), Query Frame = 3
Query:  186 ELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWD-GWRPIHHACGEADIEIVKLLIDH-HCD-IDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSDF 539
            ++   + +   +E E    +RP+H AC +G+  IV  L+ID+HCD+ A  W     P+H+AC E   EIVK+L +H  C+ I+A    N+RP+  AC  G  +IV +L+I+  CN+ NA   F
Sbjct:  142 KILTNHLQYNNIEAETDYNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAWIINGTPLHYACEEGHFEIVKILTNHPQCNTIEASSFFNERPLHKACKSGNVDIVHHLVIDKHCNV-NAKEKF 263          

HSP 11 Score: 68.5514 bits (166), Expect = 4.626e-8
Identity = 43/129 (33.33%), Postives = 74/129 (57.36%), Query Frame = 3
Query:  186 ELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH--HCDIDACDSKNQRPIDIACCVGQTEIV-NLLINHRCNMSNAPSDFCRAWRTN 560
            E+   + +   +E      +RP+H AC +G+  IV+ L+ID+HC+++A   +G  P+H AC +   EIVK+L +H  + +I+A    N RP+  AC  G  +IV +L+I+  C+++       +AW  N
Sbjct:   73 EILTNHLQYNNIEAATDYKDRPLHKACESGNVDIVRHLVIDKHCNVKAKGRNGLTPLHLACVKGHFEIVKILTNHLQYNNIEAETDYNDRPLHKACESGNVDIVHHLVIDKHCDVN------AKAWIIN 195          

HSP 12 Score: 68.1662 bits (165), Expect = 5.443e-8
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 3
Query:  240 GNRPIHIACCAGHTGIVKLLID--RHCDIEACDWDGWRPIHHACGEADIEIVK-LLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH-RCNMSNAPSDF 539
            GN P+H AC  GH  IV++L +  ++ +IEA      RP+H AC   +++IV+ L+ID HC++ A       P+ +AC  G  EIV +L NH + N   A +D+
Sbjct:   56 GNIPLHYACEKGHFEIVEILTNHLQYNNIEAATDYKDRPLHKACESGNVDIVRHLVIDKHCNVKAKGRNGLTPLHLACVKGHFEIVKILTNHLQYNNIEAETDY 159          

HSP 13 Score: 66.2402 bits (160), Expect = 1.999e-7
Identity = 44/106 (41.51%), Postives = 62/106 (58.49%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLID--RHCDIEACDWDGWRPIHHACGEADIEIV-KLLIDHHCDIDACD-SKNQRPIDIACCVGQTEIVNLLINH-RCNMSNAPSDF 539
            +G  P+H+AC  GH  IVK+L +  ++ +IEA      RP+H AC   +++IV  L+ID HCD++A     N  P+  AC  G  EIV +L NH +CN   A S F
Sbjct:  124 NGLTPLHLACVKGHFEIVKILTNHLQYNNIEAETDYNDRPLHKACESGNVDIVHHLVIDKHCDVNAKAWIINGTPLHYACEEGHFEIVKILTNHPQCNTIEASSFF 229          

HSP 14 Score: 65.0846 bits (157), Expect = 4.661e-7
Identity = 31/83 (37.35%), Postives = 52/83 (62.65%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVK-LLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIA 461
             E ED   +RPIH AC +G+  I +  +I++HCD+ A   +G+ P+H+AC     EIVK+L +  +C+    ++ N+RP+ +A
Sbjct:  874 FEAEDNSNDRPIHKACKSGNVDIARHFVIEKHCDVNAKGMNGFTPLHYACESGHFEIVKILTNQPYCNTGVENNFNERPLHLA 956          
BLAST of SMED30018138 vs. Ensembl Cavefish
Match: ENSAMXT00000048191.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:3100273:3104460:1 gene:ENSAMXG00000036724.1 transcript:ENSAMXT00000048191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 2.295e-12
Identity = 38/125 (30.40%), Postives = 64/125 (51.20%), Query Frame = 3
Query:  165 AVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            A +SG +E+ +    K   L   D    +PIH A   GH  +VKLL+ +  D    D  G+ P+H A     +++VK L+ +  +ID  ++     + +AC +GQ  + N L+N   N+ N P++
Sbjct:  133 AAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYMGQEAVANELVNRGANV-NQPNN 256          

HSP 2 Score: 49.6766 bits (117), Expect = 4.373e-6
Identity = 28/94 (29.79%), Postives = 44/94 (46.81%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            L   D  G   +H A  +G   +VKLL+++   + A D    +PIH A     +E+VKLL+    D    D +   P+  A   G  ++V  L+
Sbjct:  119 LNIADRTGRAALHHAAQSGCQEMVKLLLNKGASLSASDKKERQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLL 212          
BLAST of SMED30018138 vs. Ensembl Cavefish
Match: dapk1 (death-associated protein kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060526-177])

HSP 1 Score: 65.0846 bits (157), Expect = 2.138e-10
Identity = 34/103 (33.01%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCR 545
            +G  P+  A   G   IV+ L++   D+++ D DG   +H A     IE+VK L+ HHC +D  D     P+ IAC  G   +++LL   + N+ + P+ F R
Sbjct:  508 EGESPLLTASARGFRDIVECLLEHGADMDSTDKDGHIALHLAVRRCQIEVVKCLLSHHCYVDHQDRHGNTPLHIACKDGNLPVISLLSTAKANL-DIPNKFGR 609          

HSP 2 Score: 52.373 bits (124), Expect = 1.545e-6
Identity = 26/94 (27.66%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  231 DVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC 512
            D +   P+H A   G++ + + L +  CD+ A + +G  P+  A      +IV+ L++H  D+D+ D      + +A    Q E+V  L++H C
Sbjct:  473 DREQETPLHCAAWHGYSPVARALCEAGCDVNARNREGESPLLTASARGFRDIVECLLEHGADMDSTDKDGHIALHLAVRRCQIEVVKCLLSHHC 566          
BLAST of SMED30018138 vs. Ensembl Cavefish
Match: krit1 (KRIT1 ankyrin repeat containing [Source:NCBI gene;Acc:103026196])

HSP 1 Score: 63.929 bits (154), Expect = 3.068e-10
Identity = 33/96 (34.38%), Postives = 54/96 (56.25%), Query Frame = 3
Query:  222 EREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDH-HCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            ER+ VD + P+H + C G T ++  L+D    ++  D D W PIH+AC    +E  KLL++  +C+ +  + +   P+  A   G +EIV LL+ H
Sbjct:  281 ERQWVD-DFPLHRSACEGDTELLSKLLDSGFSVKQLDSDHWAPIHYACWHGKVEATKLLLEKGNCNPNLLNGQLSSPLHFAAGGGHSEIVELLLKH 375          
BLAST of SMED30018138 vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 58.5362 bits (140), Expect = 1.597e-9
Identity = 28/97 (28.87%), Postives = 47/97 (48.45%), Query Frame = 3
Query:  225 REDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            R D     P+HIA  AG   IV+ LI +   + + + +G  P+H+A  +   EI  LL+++  D +A D     P+  A   G   ++ LL+    +
Sbjct:   35 RTDQASWTPLHIAASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSAS 131          

HSP 2 Score: 50.447 bits (119), Expect = 1.021e-6
Identity = 30/119 (25.21%), Postives = 52/119 (43.70%), Query Frame = 3
Query:  165 AVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            A  +G EE+ R    K   L   + +G  P+H A       I  LL++   D  A D     P+H A  + +  +++LL+      +  DS+    + +AC   + E   LL+ H  ++
Sbjct:   47 AASAGREEIVRSLISKGAQLNSVNQNGCTPLHYAASKNQYEIALLLLENGADPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEERVEAAKLLVEHGASI 165          
BLAST of SMED30018138 vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 62.003 bits (149), Expect = 1.692e-9
Identity = 32/99 (32.32%), Postives = 52/99 (52.53%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIAC-----CAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +  EDVDG   + +A        GH  +V LLIDR  +++ CD D   P+  A  E  +++V LL++   D+D  D+  + P+  A  +G   +VN L+
Sbjct:  697 VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL 795          

HSP 2 Score: 59.3066 bits (142), Expect = 1.010e-8
Identity = 28/103 (27.18%), Postives = 54/103 (52.43%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            +E  D +G   +H++C  GH  +V+LLI  H D+ +CD +    +  A  +   ++V+ LID    +D   ++    + IA   G  ++V +L+ H  + ++A
Sbjct:  966 VETSDTEGRTALHVSCWQGHVEMVRLLISYHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSGTHVDHTCNQGATALGIAAQEGHIDVVRILLEHGADPNHA 1068          

HSP 3 Score: 59.3066 bits (142), Expect = 1.168e-8
Identity = 26/105 (24.76%), Postives = 55/105 (52.38%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI------NHRCN 515
            ++  D DG   ++I        + +  ++   ++E  D +G   +H +C +  +E+V+LLI +H D+++CD++ +  +  A   G +++V  LI      +H CN
Sbjct:  933 IDYNDADGRPTLYILALENQLAMAEYFLENGANVETSDTEGRTALHVSCWQGHVEMVRLLISYHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSGTHVDHTCN 1037          
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.776e-11
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
             G  PIH+A   GH  +V+LL+       A +  G  P+H A     +E+VK L+     +     ++Q P+ IA  +G+ EIV LL+  R +  NAP+
Sbjct:  409 SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL-QRGSDPNAPT 506          

HSP 2 Score: 65.0846 bits (157), Expect = 3.271e-11
Identity = 34/102 (33.33%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  213 EFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            E L+RE ++D     GN  +HIA  AG T IV++L++   +I A   +G+ P++ A  E  +EIVK L+D+  +          P+ +A   G  ++V LL+
Sbjct:   61 ELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL 162          

HSP 3 Score: 62.3882 bits (150), Expect = 2.057e-10
Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            P+H+A   GH  + KLL+DR  +  A   +G+ P+H AC +  I++++LL+ H   I         PI +A  +G   +V LL+ +  + SNA
Sbjct:  347 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGAS-SNA 438          

HSP 4 Score: 57.7658 bits (138), Expect = 5.463e-9
Identity = 26/92 (28.26%), Postives = 43/92 (46.74%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC 512
             G  P+H+A   GH  +V LL+ RH  I      G   +H A  E  + + ++L  H  D++        P+ +A   G  ++VN L+ +R 
Sbjct:  640 QGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA 731          

HSP 5 Score: 55.4546 bits (132), Expect = 3.142e-8
Identity = 25/89 (28.09%), Postives = 45/89 (50.56%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            ++G  P+HIAC      +++LL+     I      G  PIH A     + +V+LL+ +    +A + + + P+ +A   GQ E+V  L+
Sbjct:  375 LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 463          

HSP 6 Score: 50.8322 bits (120), Expect = 7.946e-7
Identity = 27/116 (23.28%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV*IDLCNV 584
            +G  P+H+A    H  +  LL+D+     +   +G+ P+H A  +  +E+ K+L++   + +    +   P+ +A   G  ++V LL+    ++S A      A       D  NV
Sbjct:  574 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNV 689          

HSP 7 Score: 48.521 bits (114), Expect = 4.557e-6
Identity = 27/100 (27.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            +G   +H+A   GH  +V  L+ R  +I+     G   +H A      +IV++L++   +I+A       P+ +A      EIV  L+++  N S A  D
Sbjct:   42 NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATED 141          

HSP 8 Score: 48.521 bits (114), Expect = 4.964e-6
Identity = 33/124 (26.61%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER------EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            A +SG E++      E  LER      +  +G  P+H+A    H   V+LL+ R   ++    D   P+H A       + KLL+D   + +A       P+ IAC   + +++ LL+ H  ++
Sbjct:  285 AARSGHEKVI-----EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASI 403          

HSP 9 Score: 48.1358 bits (113), Expect = 6.308e-6
Identity = 26/102 (25.49%), Postives = 48/102 (47.06%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFC 542
            +G  P+H+A   G+  +VKLL+DR   I+    DG  P+H A      +++++L++    I A       P+ +A        V LL+  +  + +   D+ 
Sbjct:  244 NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL 345          
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.898e-11
Identity = 33/99 (33.33%), Postives = 51/99 (51.52%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
             G  PIH+A   GH  +V+LL+       A +  G  P+H A     +E+VK L+     +     ++Q P+ IA  +G+ EIV LL+  R +  NAP+
Sbjct:  402 SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL-QRGSDPNAPT 499          

HSP 2 Score: 65.0846 bits (157), Expect = 3.292e-11
Identity = 34/102 (33.33%), Postives = 56/102 (54.90%), Query Frame = 3
Query:  213 EFLERE-DVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            E L+RE ++D     GN  +HIA  AG T IV++L++   +I A   +G+ P++ A  E  +EIVK L+D+  +          P+ +A   G  ++V LL+
Sbjct:   62 ELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL 163          

HSP 3 Score: 62.3882 bits (150), Expect = 1.970e-10
Identity = 31/93 (33.33%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            P+H+A   GH  + KLL+DR  +  A   +G+ P+H AC +  I++++LL+ H   I         PI +A  +G   +V LL+ +  + SNA
Sbjct:  340 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGAS-SNA 431          

HSP 4 Score: 57.7658 bits (138), Expect = 5.431e-9
Identity = 26/92 (28.26%), Postives = 43/92 (46.74%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC 512
             G  P+H+A   GH  +V LL+ RH  I      G   +H A  E  + + ++L  H  D++        P+ +A   G  ++VN L+ +R 
Sbjct:  635 QGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA 726          

HSP 5 Score: 55.4546 bits (132), Expect = 2.921e-8
Identity = 25/89 (28.09%), Postives = 45/89 (50.56%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            ++G  P+HIAC      +++LL+     I      G  PIH A     + +V+LL+ +    +A + + + P+ +A   GQ E+V  L+
Sbjct:  368 LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 456          

HSP 6 Score: 50.8322 bits (120), Expect = 7.665e-7
Identity = 27/116 (23.28%), Postives = 53/116 (45.69%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV*IDLCNV 584
            +G  P+H+A    H  +  LL+D+     +   +G+ P+H A  +  +E+ K+L++   + +    +   P+ +A   G  ++V LL+    ++S A      A       D  NV
Sbjct:  569 NGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNV 684          

HSP 7 Score: 48.521 bits (114), Expect = 4.181e-6
Identity = 33/124 (26.61%), Postives = 57/124 (45.97%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER------EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            A +SG E++      E  LER      +  +G  P+H+A    H   V+LL+ R   ++    D   P+H A       + KLL+D   + +A       P+ IAC   + +++ LL+ H  ++
Sbjct:  278 AARSGHEKVI-----EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASI 396          

HSP 8 Score: 48.521 bits (114), Expect = 4.920e-6
Identity = 27/100 (27.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            +G   +H+A   GH  +V  L+ R  +I+     G   +H A      +IV++L++   +I+A       P+ +A      EIV  L+++  N S A  D
Sbjct:   43 NGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATED 142          

HSP 9 Score: 47.7506 bits (112), Expect = 6.697e-6
Identity = 26/102 (25.49%), Postives = 48/102 (47.06%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFC 542
            +G  P+H+A   G+  +VKLL+DR   I+    DG  P+H A      +++++L++    I A       P+ +A        V LL+  +  + +   D+ 
Sbjct:  237 NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL 338          
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 4.572e-11
Identity = 36/94 (38.30%), Postives = 51/94 (54.26%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            R IH A   GHT +VK+L+    D+   D  G+ P+H A     I +VKLL+D   DID  +S     + +AC  GQ  +VN LI+   N++ A
Sbjct:  173 RAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQA 266          

HSP 2 Score: 53.9138 bits (128), Expect = 9.747e-8
Identity = 30/92 (32.61%), Postives = 44/92 (47.83%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
             D  G   +H A   GH+ +V  L+ +  +I A D    R IH A      E+VK+L+ H  D+   D K   P+  A   GQ  +V LL++
Sbjct:  134 SDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLD 225          
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.876e-10
Identity = 25/96 (26.04%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSN 524
             G  P+H+    GH  +  LL+ R+ D+      G  P+H A  E  + + ++L+ H   ++A       P+ +AC  G  ++VN L+ H  ++++
Sbjct:  278 QGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNS 373          

HSP 2 Score: 57.7658 bits (138), Expect = 6.350e-9
Identity = 33/117 (28.21%), Postives = 55/117 (47.01%), Query Frame = 3
Query:  186 ELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
            EL  +Y     +E     G  P+H++   G+  IV +L+       A +  G   +H A      E+V+ L+ +   +DA   + Q P+ IA  +G+ EIV LL+ H  +   A S+
Sbjct:   32 ELLLKYGAS--IEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN 146          

HSP 3 Score: 56.9954 bits (136), Expect = 1.108e-8
Identity = 28/114 (24.56%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEF-LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            A ++G  E+ R   +    ++ +  +   P+HIA   G   IV+LL+      +A   +G+ P+H A  E   ++  +L++H   +     K   P+ +A   G+ E+ +LL+ 
Sbjct:   88 AARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ 201          

HSP 4 Score: 56.9954 bits (136), Expect = 1.249e-8
Identity = 27/97 (27.84%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  231 DVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            +V G   +H+A  AG T +V+ L+     ++A   +   P+H A     +EIV+LL+ H    DA  S    P+ +A   G  ++  +L+ H  +++
Sbjct:   78 NVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLA 174          

HSP 5 Score: 53.5286 bits (127), Expect = 1.348e-7
Identity = 25/89 (28.09%), Postives = 46/89 (51.69%), Query Frame = 3
Query:  234 VDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            ++G  P+HIAC      +++LL+     IEA    G  P+H +    ++ IV +L+      +A + + +  + +A   GQTE+V  L+
Sbjct:   13 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL 101          
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008869.1 (pep scaffold:Pmarinus_7.0:GL480434:154475:170912:1 gene:ENSPMAG00000008027.1 transcript:ENSPMAT00000008869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.774e-10
Identity = 31/110 (28.18%), Postives = 52/110 (47.27%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            L RR  + +  ER    G   +  A C GHT  V +L+ R  ++   D +G   +  AC +  + +V+ L+ H   ++  D   + P+ +A   G  E+V  L+ H  NM
Sbjct:  240 LLRRGAEPDAPERR---GRTALMAAACEGHTNTVDVLLSRGANVSVADHEGLSALSWACLKGRLAVVQTLLAHGAPVNHADRSGRTPLGLAAFHGDAEVVQFLLEHGANM 346          

HSP 2 Score: 49.2914 bits (116), Expect = 2.039e-6
Identity = 26/99 (26.26%), Postives = 44/99 (44.44%), Query Frame = 3
Query:  231 DVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNA 527
            D +G   +  AC  G   +V+ L+     +   D  G  P+  A    D E+V+ L++H  +++  D    RP+D A     T +V  L+    N+  A
Sbjct:  284 DHEGLSALSWACLKGRLAVVQTLLAHGAPVNHADRSGRTPLGLAAFHGDAEVVQFLLEHGANMEHVDESGMRPLDRAIGCRNTAVVLALLKKGANLGPA 382          
BLAST of SMED30018138 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 63.5438 bits (153), Expect = 1.361e-10
Identity = 30/98 (30.61%), Postives = 50/98 (51.02%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            ED   N P+H+A   GH  +VK L+ R   I+A +   W P+  A     +E+  +L+D    +D  D     P+ +A   G  E+V LL++ + N++
Sbjct:  313 EDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANIT 410          
BLAST of SMED30018138 vs. Ensembl Nematostella
Match: EDO34034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQH2])

HSP 1 Score: 59.6918 bits (143), Expect = 1.453e-10
Identity = 35/112 (31.25%), Postives = 58/112 (51.79%), Query Frame = 3
Query:  183 EELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHAC--GEADIEIVKLLIDHHCDIDACDSKNQRPIDIACC-VGQTEIVNLLINHR 509
            +EL  +Y +    E  D DG   +H A   GH  + K+L+    ++ A   DGW P+H AC  G+  +E   LL+ +  +I+A  +  Q P+ +A   +G T  + LL+ +R
Sbjct:   14 KELLAKYPR--LHEGCDADGYSALHRASYEGHVDVAKVLLTYGANVMATTHDGWHPLHSACRWGKG-VEAASLLLQNGANINALTNGKQTPLHLAALGIGGTATLKLLLFNR 122          
BLAST of SMED30018138 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 60.077 bits (144), Expect = 6.157e-10
Identity = 32/104 (30.77%), Postives = 60/104 (57.69%), Query Frame = 3
Query:  153 LFRNAVKSGS-EELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIA 461
            +F +AV SG  +E+ +   K   +  ++VDG   +H AC   +  +VK+L+D+   ++  D +GW  +H A     +EI K LI++  D+ A +++ + P+D+A
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA 155          
BLAST of SMED30018138 vs. Ensembl Nematostella
Match: EDO30889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZG9])

HSP 1 Score: 56.6102 bits (135), Expect = 7.430e-10
Identity = 26/83 (31.33%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  240 GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIV 488
            GN P+H A  AG   I KLLID+  D+ A + +   P+H +      E+ +LL+D   D    D++ + P+++A   G+ +++
Sbjct:   28 GNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVI 110          

HSP 2 Score: 53.5286 bits (127), Expect = 8.370e-9
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  282 GIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            G   +L+ R  D++A D  G  P+H A      +I KLLID   D++A + ++Q P+ ++  VG +E+  LL++
Sbjct:    9 GTADVLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLD 82          
BLAST of SMED30018138 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 51.6026 bits (122), Expect = 2.477e-8
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  285 IVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            +VK  I +  D  A D  GW P+H AC    +E+VK+L+ +  D++A  +   RP+  A   G  E++ LL+ +
Sbjct:    2 VVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTY 75          

HSP 2 Score: 45.8246 bits (107), Expect = 2.785e-6
Identity = 22/63 (34.92%), Postives = 35/63 (55.56%), Query Frame = 3
Query:  228 EDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCD 416
            +D  G  P+H AC  G   +VK+L+    D+ A   DG RP+H A     +E+++LL+ +  D
Sbjct:   16 KDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          
BLAST of SMED30018138 vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 70.0922 bits (170), Expect = 5.318e-12
Identity = 42/127 (33.07%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPS 533
              +A +SG +E+ +    K   L   D    +PIH A   GH  +VKLL+ R  D    D  G+ P+H A     IEIVK L+    +ID  ++     + +AC +GQ  +   L+NH  N+ N P+
Sbjct:  144 LHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANV-NQPN 269          

HSP 2 Score: 51.9878 bits (123), Expect = 2.135e-6
Identity = 26/85 (30.59%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  249 PIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLIN 503
            P+H+A     T   + L+    ++   D  G   +HHA      E+VKLL++   ++ A D K ++PI  A  +G  E+V LL++
Sbjct:  110 PLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLS 194          
BLAST of SMED30018138 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 7.707e-11
Identity = 33/102 (32.35%), Postives = 53/102 (51.96%), Query Frame = 3
Query:  252 IHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC--NMSNAPSDFCRAW 551
            +H+A   GH  + KL++D+  +  A   +G+ P+H AC +  + +++LL+ H   I A       PI +A  +G   IV+ LINH    N +N  S  C  W
Sbjct:  347 LHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTNVVSCSCFFW 448          

HSP 2 Score: 59.3066 bits (142), Expect = 5.878e-9
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            L  R    +F+ R D+    P+H+A   G++ +VKLL+DR   IEA   DG  P+H        ++V++L+D    I +       P+ +A        V LL+ H   + +  +D+  A 
Sbjct:  230 LLNRAAAVDFMARNDIT---PLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTAL 347          

HSP 3 Score: 50.447 bits (119), Expect = 3.775e-6
Identity = 36/144 (25.00%), Postives = 67/144 (46.53%), Query Frame = 3
Query:  120 IFT*LMNR----DFHLFRN-------AVKSGSEELFRRYF-KEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            + T L+NR    DF + RN       A K G+  + +    +   +E +  DG  P+H    +GH  +V++L+DR   I +   +G  P+H A     +  V+LL+ H   +D   +     + +A   G  ++  L+++ + N
Sbjct:  226 VATLLLNRAAAVDF-MARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKAN 368          
BLAST of SMED30018138 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.283e-10
Identity = 38/120 (31.67%), Postives = 60/120 (50.00%), Query Frame = 3
Query:  165 AVKSGSEELFRRYFKEEFLER-EDVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINH 506
            A K G ++L      EE L+R   VD     GN  +HIA  AG   +VKLL+ R  D+ A   +G+ P++ A  E  +E+V+  +++  +          P+ IA   G   +V+LL+ H
Sbjct:   27 AAKEGHKDLV-----EELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH 141          

HSP 2 Score: 56.225 bits (134), Expect = 5.735e-8
Identity = 25/83 (30.12%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  252 IHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            +H+A   GH  + K+L+D+  +  A   +G+ P+H AC +  +++++LL+ +   I A       PI +A  +G   IV LL+
Sbjct:  317 LHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLL 399          

HSP 3 Score: 55.4546 bits (132), Expect = 9.448e-8
Identity = 36/124 (29.03%), Postives = 56/124 (45.16%), Query Frame = 3
Query:  180 SEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            S  L  R    +F  R   +G  P+H+A   G+T +V LL+DR   I+A   DG  P+H A        V+LL++    I A       P+ ++      E V LL+ H+  + +   D+  A 
Sbjct:  197 STLLLNRGAAVDFTAR---NGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTAL 317          

HSP 4 Score: 50.0618 bits (118), Expect = 4.381e-6
Identity = 28/93 (30.11%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  237 DGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCN 515
            DG  P+H A  +GH   V+LL++R   I A   +G  P+H +     IE VKLL+ H   +D         + +A   G   +  +L++ + N
Sbjct:  246 DGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKAN 338          
BLAST of SMED30018138 vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 2.726e-9
Identity = 30/96 (31.25%), Postives = 52/96 (54.17%), Query Frame = 3
Query:  252 IHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC--NMSNAPS 533
            +H+A   GH  + K+++D+  +  A   +G+ P+H AC +  +++++LL+ H   I A       PI +A  +G   IV+ LIN+    N SN  S
Sbjct:  347 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTSNVVS 442          

HSP 2 Score: 57.7658 bits (138), Expect = 2.150e-8
Identity = 32/118 (27.12%), Postives = 58/118 (49.15%), Query Frame = 3
Query:  162 NAVKSGSEELFRRYFKEEFLEREDVD-----GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLI 500
            NA+   S+E       E   +  +VD     GN  +HIA  AG T +VK L+    ++ A   +G+ P++ A  E  +++V+LL+++             P+ +A   G  ++V+LL+
Sbjct:   52 NALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLL 169          

HSP 3 Score: 53.1434 bits (126), Expect = 6.466e-7
Identity = 31/121 (25.62%), Postives = 58/121 (47.93%), Query Frame = 3
Query:  189 LFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAW 551
            L  R    +F  R D+    P+H+A   G++ +V+LL++R   I+A   DG  P+H A      ++V++L++    I +       P+ +A        V LL++H   + +  +D+  A 
Sbjct:  230 LLNRGAAVDFKARNDIT---PLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTAL 347          

HSP 4 Score: 51.2174 bits (121), Expect = 2.451e-6
Identity = 26/75 (34.67%), Postives = 39/75 (52.00%), Query Frame = 3
Query:  312 CDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSD 536
             DI  C+ +G   +H A  E  +E+V  LI    ++DA   K    + IA   GQTE+V  L+++  N+ NA S 
Sbjct:   41 VDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANV-NAQSQ 114          
BLAST of SMED30018138 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 60.4622 bits (145), Expect = 4.395e-9
Identity = 35/110 (31.82%), Postives = 60/110 (54.55%), Query Frame = 3
Query:  210 EEFLEREDVD------GNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            E+ L+R DVD      G+  +  A   GH  ++KLL+  + D+EA D DG R +HHA    +  ++++L     D++A + + Q P+ IA   G  ++V  L++  C+ S
Sbjct:  449 EDILKRPDVDVNGQCAGHTAMQAASQNGHVDVLKLLLKHNVDLEAEDKDGDRAVHHAAFGDEGSVIEVLQRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPS 558          
BLAST of SMED30018138 vs. Planmine SMEST
Match: SMESG000017276.1 (SMESG000017276.1)

HSP 1 Score: 276.174 bits (705), Expect = 2.944e-90
Identity = 135/143 (94.41%), Postives = 136/143 (95.10%), Query Frame = 3
Query:  135 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV 563
            MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDI+ACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACD KNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDF      NV
Sbjct:    1 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIDACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDRKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFVEPGAQNV 143          
BLAST of SMED30018138 vs. Planmine SMEST
Match: SMESG000017276.1 (SMESG000017276.1)

HSP 1 Score: 254.603 bits (649), Expect = 1.789e-81
Identity = 134/176 (76.14%), Postives = 135/176 (76.70%), Query Frame = 3
Query:  135 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGW---------------------------------RPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV 563
            MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDI+ACDW GW                                 RPIHHACGEADIEIVKLLIDHHCDIDACD KNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDF      NV
Sbjct:    1 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIDACDWAGWRPIHHACSEAHIEIVKLLIDRHCDIDACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDRKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFVEPGAQNV 176          
BLAST of SMED30018138 vs. Planmine SMEST
Match: SMESG000017276.1 (SMESG000017276.1)

HSP 1 Score: 236.884 bits (603), Expect = 8.553e-75
Identity = 125/169 (73.96%), Postives = 127/169 (75.15%), Query Frame = 3
Query:  156 FRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGW---------------------------------RPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV 563
             +NAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDI+ACDW GW                                 RPIHHACGEADIEIVKLLIDHHCDIDACD KNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDF      NV
Sbjct:    1 MKNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIDACDWAGWRPIHHACSEAHIEIVKLLIDRHCDIDACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDRKNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFVEPGAQNV 169          
BLAST of SMED30018138 vs. Planmine SMEST
Match: SMESG000010485.1 (SMESG000010485.1)

HSP 1 Score: 150.984 bits (380), Expect = 6.956e-41
Identity = 72/128 (56.25%), Postives = 91/128 (71.09%), Query Frame = 3
Query:  135 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            M  ++ LF NA++SGS ELF RYF  EF ERED +G RPIH AC  GH+G VKLL++ +CDIEA   + WRPIHHAC +   E  KLLI+H+CDI+A D  NQRPI +AC  G +E + LL+ H CN+
Sbjct:    1 MEIEYELFINAIRSGSAELFDRYFNAEFTEREDANGWRPIHHACIHGHSGAVKLLLEHNCDIEALYKNNWRPIHHACYQGHSEAAKLLIEHNCDIEALDGLNQRPIHLACIQGHSETIKLLLEHNCNI 128          

HSP 2 Score: 105.145 bits (261), Expect = 9.612e-25
Identity = 54/101 (53.47%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNMS 521
            +E  D    RPIH AC  GH+  +KLLI+ +CDIEA D D WRPIH AC +   E VKLLI+H+CDI+A D + QRPI  AC  G  EIV LLI  +C+++
Sbjct:  161 IEAFDDRNQRPIHHACYQGHSEAIKLLIEHNCDIEALDIDNWRPIHLACYQGHSEAVKLLIEHNCDIEALDKRKQRPIHWACENGNIEIVKLLIERKCDIT 261          

HSP 3 Score: 103.605 bits (257), Expect = 3.032e-24
Identity = 53/100 (53.00%), Postives = 68/100 (68.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D+   RPIH+AC  GH+  VKLLI+ +CDIEA D    RPIHHAC +   E +KLLI+H+CDI+A D  N RPI +AC  G +E V LLI H C++
Sbjct:  128 IEALDIWNQRPIHLACYQGHSEAVKLLIEYNCDIEAFDDRNQRPIHHACYQGHSEAIKLLIEHNCDIEALDIDNWRPIHLACYQGHSEAVKLLIEHNCDI 227          

HSP 4 Score: 97.4413 bits (241), Expect = 4.874e-22
Identity = 50/99 (50.51%), Postives = 68/99 (68.69%), Query Frame = 3
Query:  228 EDVDG--NRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            E +DG   RPIH+AC  GH+  +KLL++ +C+IEA D    RPIH AC +   E VKLLI+++CDI+A D +NQRPI  AC  G +E + LLI H C++
Sbjct:   96 EALDGLNQRPIHLACIQGHSETIKLLLEHNCNIEALDIWNQRPIHLACYQGHSEAVKLLIEYNCDIEAFDDRNQRPIHHACYQGHSEAIKLLIEHNCDI 194          

HSP 5 Score: 85.5001 bits (210), Expect = 4.637e-18
Identity = 47/93 (50.54%), Postives = 59/93 (63.44%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLL 497
            +E  D+D  RPIH+AC  GH+  VKLLI+ +CDIEA D    RPIH AC   +IEIVKLLI+  CDI A D     P+DIA      ++V +L
Sbjct:  194 IEALDIDNWRPIHLACYQGHSEAVKLLIEHNCDIEALDKRKQRPIHWACENGNIEIVKLLIERKCDITARDKCEMSPLDIAVKNENKKLVEIL 286          
BLAST of SMED30018138 vs. Planmine SMEST
Match: SMESG000017277.1 (SMESG000017277.1)

HSP 1 Score: 159.458 bits (402), Expect = 9.557e-41
Identity = 79/128 (61.72%), Postives = 94/128 (73.44%), Query Frame = 3
Query:  135 MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            M+ +F LF NA+KSGS ELFRRYFKEEFLER+D D  RPIH AC  GH  IVKLLI+  CDIEA D D WRPIH AC +   E VKLLI++ CDI+A D + QRPI +AC  G +E V LLI H+C++
Sbjct:    1 MDEEFKLFINAIKSGSAELFRRYFKEEFLERKDSDLRRPIHHACITGHAEIVKLLIEHKCDIEALDKDNWRPIHLACYQGHSEAVKLLIENKCDIEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDI 128          

HSP 2 Score: 109.768 bits (273), Expect = 1.418e-24
Identity = 55/100 (55.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIHIAC  GH+  VKLLI+  CDIEA DW   RPIH AC +   E VKLLI+H CDI+A D + QRPI +AC  G +E V LLI H+C++
Sbjct:  194 IEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDI 293          

HSP 3 Score: 105.145 bits (261), Expect = 3.428e-23
Identity = 54/100 (54.00%), Postives = 68/100 (68.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH+AC  GH+G VKLLI+  CDIEA D    RPIHHAC +   E VKLLI++ CDI+A D  NQRPI +AC  G +E V LLI ++C++
Sbjct:  359 IEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDI 458          

HSP 4 Score: 104.76 bits (260), Expect = 4.305e-23
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH++C  GH+  VKLLI+  CDIEA D   WRPIH +C +   E VKLLI+H+CDI+A D +N+RPI IAC  G +E V LLI ++C++
Sbjct:  128 IEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDI 227          

HSP 5 Score: 102.064 bits (253), Expect = 3.772e-22
Identity = 50/91 (54.95%), Postives = 65/91 (71.43%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            RPIH++C  GH+  VKLLI+ +CDIEA DW   RPIH AC +   E VKLLI++ CDI+A D  N+RPI +AC  G +E V LLI H+C++
Sbjct:  170 RPIHLSCIQGHSEAVKLLIEHNCDIEALDWRNRRPIHIACYQGHSEAVKLLIENKCDIEALDWWNRRPIHLACDQGHSEAVKLLIEHKCDI 260          

HSP 6 Score: 101.293 bits (251), Expect = 5.350e-22
Identity = 52/98 (53.06%), Postives = 66/98 (67.35%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRC 512
            +E  D    RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC +   E VKLLI++ CDI+A D +NQRPI +AC  G++E V LLI ++C
Sbjct:  458 IEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKC 555          

HSP 7 Score: 101.293 bits (251), Expect = 6.774e-22
Identity = 50/91 (54.95%), Postives = 63/91 (69.23%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC +   E VKLLI+H CDI+A D + QRPI +AC  G +E V LLI ++C++
Sbjct:  236 RPIHLACDQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDI 326          

HSP 8 Score: 100.908 bits (250), Expect = 7.589e-22
Identity = 52/100 (52.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC +   E VKLLI++ CDI+A D +NQRPI +AC  G +E V LLI ++C++
Sbjct:  425 IEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDIEALDDRNQRPIHLACDQGHSEAVKLLIENKCDI 524          

HSP 9 Score: 98.9821 bits (245), Expect = 2.912e-21
Identity = 55/127 (43.31%), Postives = 72/127 (56.69%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM------SNAPSDFCRAWRTNV*IDLCN 581
            +E  D    RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC     E VKLLI++ C I+A D +NQRPI +AC  G ++   LLI H+C +       N+P +F   +     I + N
Sbjct:  491 IEALDDRNQRPIHLACDQGHSEAVKLLIENKCDIEALDERNQRPIHLACYYGRSEAVKLLIENKCYIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKILN 617          

HSP 10 Score: 98.9821 bits (245), Expect = 3.437e-21
Identity = 52/100 (52.00%), Postives = 66/100 (66.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH AC  GH+  VKLLI+  CDIEA D    RPIH AC +   E VKLLI++ CDI+A D +NQRPI +AC  G +E V LLI ++C++
Sbjct:  392 IEALDEQKRRPIHHACIQGHSEAVKLLIENKCDIEALDKWNQRPIHLACYQGHSEAVKLLIENKCDIEALDERNQRPIHLACDQGHSEAVKLLIENKCDI 491          

HSP 11 Score: 97.4413 bits (241), Expect = 1.059e-20
Identity = 50/100 (50.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH +C +   E VKLLI++ CDI+A D +N RPI ++C  G +E V LLI H C++
Sbjct:   95 IEALDKQKQRPIHLACDQGHSEAVKLLIEHKCDIEALDKWNQRPIHLSCIQGHSEAVKLLIENKCDIEALDKRNWRPIHLSCIQGHSEAVKLLIEHNCDI 194          

HSP 12 Score: 97.0561 bits (240), Expect = 1.196e-20
Identity = 50/100 (50.00%), Postives = 65/100 (65.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC +   E VKLLI++ CDI+  D  N+RPI +AC  G +E V LLI ++C++
Sbjct:  260 IEALDKQKQRPIHLACYQGHSEAVKLLIEHKCDIEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDI 359          

HSP 13 Score: 95.1301 bits (235), Expect = 5.636e-20
Identity = 50/100 (50.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  219 LEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            +E  D    RPIH+AC  GH+  VKLLI+  CDIE  D    RPIH AC +   E VKLLI++ CDI+A D  NQRPI +AC  G +  V LLI ++C++
Sbjct:  293 IEALDKQKQRPIHLACYQGHSEAVKLLIENKCDIEVLDEWNRRPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDI 392          

HSP 14 Score: 91.2781 bits (225), Expect = 9.026e-19
Identity = 47/91 (51.65%), Postives = 61/91 (67.03%), Query Frame = 3
Query:  246 RPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDSKNQRPIDIACCVGQTEIVNLLINHRCNM 518
            RPIH+AC  GH+  VKLLI+  CDIEA D    RPIH AC +     VKLLI++ CDI+A D + +RPI  AC  G +E V LLI ++C++
Sbjct:  335 RPIHLACDQGHSEAVKLLIENKCDIEALDKWNQRPIHLACDQGHSGAVKLLIENKCDIEALDEQKRRPIHHACIQGHSEAVKLLIENKCDI 425          

HSP 15 Score: 51.2174 bits (121), Expect = 2.390e-6
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  216 FLEREDVDGNRPIHIACCAGHTGIVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLL 398
            ++E  D    RPIH+AC  GH+   KLLI+  C+I+A D  G  P+  A    + EI+K+L
Sbjct:  556 YIEALDKRNQRPIHLACYYGHSKAFKLLIEHKCEIDARDESGNSPMEFAMKFGNTEIIKIL 616          
The following BLAST results are available for this feature:
BLAST of SMED30018138 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD501.616e-1033.33ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:H... [more]
ANKRD501.930e-1033.33ankyrin repeat domain 50 [Source:HGNC Symbol;Acc:H... [more]
ANK32.155e-1031.07ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.235e-931.07ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
MIB12.774e-932.73mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C46H3.28.568e-1129.03pep chromosome:WBcel235:X:1211770:1230758:-1 gene:... [more]
unc-442.099e-932.98AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.099e-932.98AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.104e-932.98AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.104e-932.98AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30018138 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.534e-934.07gene:FBgn0261788 transcript:FBtr0334062[more]
Ank22.457e-934.07gene:FBgn0261788 transcript:FBtr0303119[more]
Ank22.786e-934.07gene:FBgn0261788 transcript:FBtr0303118[more]
Ank22.801e-934.07gene:FBgn0261788 transcript:FBtr0303122[more]
Ank22.805e-934.07gene:FBgn0261788 transcript:FBtr0344222[more]
back to top
BLAST of SMED30018138 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd52a1.728e-1129.92ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a1.797e-1129.92ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
BX511162.12.699e-1130.00ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX511162.11.005e-1030.00ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
BX511162.11.135e-1030.00ankyrin 2a, neuronal [Source:NCBI gene;Acc:568926][more]
back to top
BLAST of SMED30018138 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankef11.223e-1032.46ankyrin repeat and EF-hand domain containing 1 [So... [more]
ankef11.394e-1032.46ankyrin repeat and EF-hand domain containing 1 [So... [more]
pan36.084e-1025.20poly(A) specific ribonuclease subunit PAN3 [Source... [more]
senp16.399e-1027.21SUMO specific peptidase 1 [Source:Xenbase;Acc:XB-G... [more]
dapk17.956e-1037.23death associated protein kinase 1 [Source:NCBI gen... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd501.317e-1033.33ankyrin repeat domain 50 [Source:MGI Symbol;Acc:MG... [more]
Ank32.528e-1030.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank34.313e-1030.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank36.857e-1030.10ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank11.101e-927.55ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of SMED30018138 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q502K3|ANR52_DANRE1.322e-1029.92Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q5UPG5|YL093_MIMIV2.510e-1032.11Putative ankyrin repeat protein L93 OS=Acanthamoeb... [more]
sp|Q9ULJ7|ANR50_HUMAN9.270e-1033.33Ankyrin repeat domain-containing protein 50 OS=Hom... [more]
sp|Q5ZLC8|ANR52_CHICK2.284e-932.03Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|A1X157|CTTB2_ECHTE4.021e-929.66Cortactin-binding protein 2 OS=Echinops telfairi O... [more]
back to top
BLAST of SMED30018138 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7T0Y03.513e-1446.15ANK_REP_REGION domain-containing protein OS=Amphim... [more]
A0A1X7VDC46.731e-1442.31ANK_REP_REGION domain-containing protein OS=Amphim... [more]
A0A1X7T5X69.821e-1444.23Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A1V5NP541.977e-1333.01Phosphocholine transferase AnkX OS=bacterium ADurb... [more]
A0A1X7T6C22.026e-1343.27ANK_REP_REGION domain-containing protein OS=Amphim... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000048191.12.295e-1230.40pep primary_assembly:Astyanax_mexicanus-2.0:15:310... [more]
dapk12.138e-1033.01death-associated protein kinase 1 [Source:ZFIN;Acc... [more]
krit13.068e-1034.38KRIT1 ankyrin repeat containing [Source:NCBI gene;... [more]
psmd101.597e-928.87proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ANKRD501.692e-932.32ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.776e-1133.33pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.898e-1133.33pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000003991.14.572e-1138.30pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007449.11.876e-1026.04pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000008869.12.774e-1028.18pep scaffold:Pmarinus_7.0:GL480434:154475:170912:1... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30018138 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387021.361e-1030.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340341.453e-1031.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436906.157e-1030.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308897.430e-1031.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341612.477e-833.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30018138 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd52a5.318e-1233.07serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000039903.17.707e-1132.35pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000006308.21.283e-1031.67pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ENSORLT00000040233.12.726e-931.25pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
mib14.395e-931.82mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
back to top
BLAST of SMED30018138 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017276.12.944e-9094.41SMESG000017276.1[more]
SMESG000017276.11.789e-8176.14SMESG000017276.1[more]
SMESG000017276.18.553e-7573.96SMESG000017276.1[more]
SMESG000010485.16.956e-4156.25SMESG000010485.1[more]
SMESG000017277.19.557e-4161.72SMESG000017277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018138 ID=SMED30018138|Name=SMED30018138|organism=Schmidtea mediterranea sexual|type=transcript|length=1873bp
ATTTATTATAATTTACGAAACAATATTAAATTGAAATTAATTAATTTACT
TTTTATAATGGTTGAAATTTTATTTTAAATGTTTATAAGCAAAATTTGTA
ATCAATTCTCATTGGATAAATATTTACATAATTGATGAATCGGGATTTCC
ATTTATTTAGGAACGCAGTCAAATCTGGATCAGAAGAATTATTCCGCAGA
TATTTCAAGGAGGAATTTTTGGAGCGAGAGGATGTCGATGGGAATCGTCC
GATTCATATCGCATGCTGTGCTGGACACACTGGAATCGTAAAATTACTGA
TTGACCGCCATTGTGATATTGAAGCATGTGATTGGGATGGCTGGAGACCA
ATTCATCATGCATGCGGTGAAGCTGATATCGAAATTGTAAAACTACTGAT
CGATCACCATTGTGATATCGATGCGTGTGATTCGAAAAATCAGAGACCAA
TCGATATAGCATGCTGTGTAGGCCAGACTGAAATTGTTAATCTGTTGATT
AATCACCGTTGTAATATGAGCAATGCTCCTTCTGATTTTTGTAGAGCCTG
GCGCACAAATGTATAAATCGATTTGTGTAATGTTTTATTTTGATTAAGTA
TCAAAATTATACAAAACATTCGTAATATATTTAATGAGAAGCAATCTAGC
AACTGTATTTTATTGTAAATAAGCTTTTTTGTTACTTTTGTCTTCAATCT
TTCACAGAAATTCATTTTTATAGATATCATTTGTATTTATTTCTAGCATT
TGCTAAATTAAATTTCATTCCCACAAGCTTAGTTTCAGGTCGGCGTCGGC
ACTTTGTGTTTATGGAATTCATTGCTGAAAACTCACGTTTGCAATCGGCA
CTGAATGCTTGAAAGTCCTCACAATGTCAAATAGAAAGGAAAGGTTAAAG
AATTCAAGGTTGATTTCAAAAGACTTCAATGTAGGGCTAAAAGTCTTGAA
CAGTTCTAGTTTTAGATCTTGATATTCATTCCATATTTTATCTATCGATG
AGTTTATCCACCGTAAATTTTGAATACTTCTTGGAAAGCTTAATTGAAGT
TTTCTTTCGGAAATCAAAATCGAGTTCTGAATTTATTTTTCTAAAGAAAT
ATCTCTTCTTTCTTCCGAAAGACTTTTTCAAGGGTATTTTATAAGGTTCG
AGCTTTTCATTCCGCGAATTCAAACGCGTAACTTTTGCCTTTATAATTTG
GGGAAGTCTAATAAATATTTTCATTGTTGATAATTATCAAGAACGGAATT
ATTTGCAATCATAATGTTCAAAATCATTGAAACTTTGCGCATTTATAAAA
TAAACAATTTAAATATTTATATTTTACTCTCTATTTATCTAAACAAACTT
TACGTTGCTTAATGAATTCCTTTCTGTAAGTTTTGGCGGGTCATCAATTT
GGATTTGTCAAGGTCATTTAAACATTTCCCTCTGCTCTCGGTTGTCATTA
TTAGTGACCGCTCACAAATGCCCTCTCTGACCCCCCCCCATTTATGTTCC
ATTCACATTAATAACTTTGCATGAGAAAATGATTTCATCGAAATGAAATA
TCGCATTGCAAAAACATACAAAATTAAAACAAAAAATGACATTCCTTGCA
ACAATTTGCAGTCAGATTAATTTTGACTAAATTTTACGCTCGAATGATTT
TACAATTAGCTTATAAACGTAAAATAAAATTTTCTTATTTAAAAATAATT
TTTGCATTTTGCTCATTTTTAAATAAAATTTAAACGTAATTATTTCTCTC
CATTATCCTAAATACTTGTTTAAATGCACAGAGCAATGAATGCATTTATT
AATATCCAGGGAGGCCCCCATATGACAATTATCCATCATTTGCGGTTGCC
TACAAAGTAATTTCATTGAAAAA
back to top

protein sequence of SMED30018138-orf-1

>SMED30018138-orf-1 ID=SMED30018138-orf-1|Name=SMED30018138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MNRDFHLFRNAVKSGSEELFRRYFKEEFLEREDVDGNRPIHIACCAGHTG
IVKLLIDRHCDIEACDWDGWRPIHHACGEADIEIVKLLIDHHCDIDACDS
KNQRPIDIACCVGQTEIVNLLINHRCNMSNAPSDFCRAWRTNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017124SH3 domain binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005938cell cortex
GO:0008021synaptic vesicle
GO:0042995cell projection
GO:0043197dendritic spine
Vocabulary: biological process
TermDefinition
GO:0007420brain development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 68..97
e-value: 6.2E-4
score: 29.1
coord: 101..130
e-value: 6.8
score: 15.6
coord: 35..64
e-value: 1.7E-4
score: 31.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 68..100
score: 11.06
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 35..67
score: 11.247
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..136
e-value: 2.1E-32
score: 114.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 4..130
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 51..127
e-value: 1.3E-13
score: 51.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 35..133
score: 26.125
NoneNo IPR availablePANTHERPTHR24171FAMILY NOT NAMEDcoord: 66..124
coord: 32..107