Coenzyme Q-binding protein COQ10 homolog B, mitochondrial

Overview
NameCoenzyme Q-binding protein COQ10 homolog B, mitochondrial
Smed IDSMED30018134
Length (bp)1041
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (SMED30018134) t-SNE clustered cells

Violin plots show distribution of expression levels for Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (SMED30018134) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (SMED30018134) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coenzyme Q-binding protein COQ10 homolog B, mitochondrial (SMED30018134) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018134

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
secretory cellSMED30018134h1SMcG0009728 Contig19678newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
secretory cellSMED30018134h1SMcG0009728 Contig19678uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 157.918 bits (398), Expect = 8.903e-46
Identity = 70/163 (42.94%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +M+ VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   76 FAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 238          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 156.762 bits (395), Expect = 1.060e-45
Identity = 70/163 (42.94%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +M+ VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   44 FAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 206          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 156.762 bits (395), Expect = 1.292e-45
Identity = 70/163 (42.94%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +M+ VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   59 FAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 221          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Match: COQ10B (coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819])

HSP 1 Score: 152.14 bits (383), Expect = 9.304e-44
Identity = 72/163 (44.17%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
             ++   +K  +Y E+RI+GYS  +M++VVS VE+Y  FVP+CKKS +IS+     K  L +GFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   67 ITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Match: COQ10B (coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819])

HSP 1 Score: 151.369 bits (381), Expect = 9.634e-44
Identity = 72/162 (44.44%), Postives = 109/162 (67.28%), Query Frame = 3
Query:  471 SSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            ++   +K  +Y E+RI+GYS  +M++VVS VE+Y  FVP+CKKS +IS+     K  L +GFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   40 TAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 201          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Celegans
Match: R144.13 (pep chromosome:WBcel235:III:5023264:5024064:1 gene:WBGene00044648.1 transcript:R144.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R144.13)

HSP 1 Score: 147.902 bits (372), Expect = 2.266e-43
Identity = 70/161 (43.48%), Postives = 104/161 (64.60%), Query Frame = 3
Query:  495 MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIG-SGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSY 974
            M Y EKR+IG+S+++MF VVS V +Y+ FVP+C+ S +  +  ++  A L +GFPPL+  Y S V +I+P++V S+     ++F  L TT+ F  G P +  S  L + + FEF+S  +SR+A LFFD +V+TMV AFL+R+E  YGP   P   P +L Y
Sbjct:    1 MAYSEKRLIGFSRDEMFKVVSDVSDYHNFVPWCRSSTVTHEHESSQIATLEIGFPPLSEKYSSRVIHIKPSVVHSVVIENDNLFRTLDTTFRFGKGKPSVERSCTLHYDLVFEFESAFHSRIAHLFFDKVVKTMVSAFLHRAEKLYGPPEFPHSPPQVLQY 161          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Fly
Match: CG9410 (gene:FBgn0033086 transcript:FBtr0086115)

HSP 1 Score: 150.599 bits (379), Expect = 8.832e-44
Identity = 72/156 (46.15%), Postives = 102/156 (65.38%), Query Frame = 3
Query:  477 NYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSI 944
            ++  K   Y +K ++GYS   M++VVS V  Y++FVPY K+S + S+    FKADLIVGFPPLN +Y S VT + P++V+S      +FN L+  W F+ GL +IPNS +L+F ++FEFKS L+S VA +FFD I + M  AF+     + GP SI
Sbjct:   42 DFRKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAFIQEVRRRSGPPSI 197          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Fly
Match: CG9410 (gene:FBgn0033086 transcript:FBtr0086116)

HSP 1 Score: 150.984 bits (380), Expect = 1.383e-43
Identity = 72/157 (45.86%), Postives = 103/157 (65.61%), Query Frame = 3
Query:  474 SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSI 944
            +++  K   Y +K ++GYS   M++VVS V  Y++FVPY K+S + S+    FKADLIVGFPPLN +Y S VT + P++V+S      +FN L+  W F+ GL +IPNS +L+F ++FEFKS L+S VA +FFD I + M  AF+     + GP SI
Sbjct:   76 NDFRKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAFIQEVRRRSGPPSI 232          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Zebrafish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 152.525 bits (384), Expect = 5.265e-44
Identity = 73/158 (46.20%), Postives = 107/158 (67.72%), Query Frame = 3
Query:  483 FSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F+K  +Y E+RIIGYS  +M+ VV+KVE+Y  FVP+CKKS +I +     KA L VGFPP+  +Y S V+ + P++V++  S   +FN L T W F  GLP  P +  L+F+I+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP++
Sbjct:   72 FNKRKEYSERRIIGYSMQEMYEVVAKVEDYLLFVPWCKKSDVIFRRSGFCKAKLTVGFPPVVENYTSLVSTVRPHLVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRASKLYGPETQIPRE 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Zebrafish
Match: COQ10A (si:dkey-190g6.2 [Source:ZFIN;Acc:ZDB-GENE-090312-30])

HSP 1 Score: 147.132 bits (370), Expect = 8.409e-42
Identity = 66/156 (42.31%), Postives = 104/156 (66.67%), Query Frame = 3
Query:  489 KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSS-IPKQ 953
            K  +Y E+RI+GYS  +M+ VV+ V++Y  FVP+CKKS  I +     KA L VGFPP+   Y S ++++ P++V+++ S   +FN L T W F  G+P  P +  ++FS++FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP++
Sbjct:   85 KRKEYSERRILGYSMQEMYEVVANVDDYKHFVPWCKKSQTIMKRAGHAKAQLEVGFPPVVERYTSMISHVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSVSFEFRSLLHSQLATVFFDEVVKQMVAAFERRAGKLYGPETRIPRE 240          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Zebrafish
Match: si:ch73-141c7.1 (si:ch73-141c7.1 [Source:NCBI gene;Acc:393762])

HSP 1 Score: 127.872 bits (320), Expect = 1.006e-34
Identity = 65/158 (41.14%), Postives = 95/158 (60.13%), Query Frame = 3
Query:  489 KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPM 962
            + M+Y E R I YS  QM++VV+ VE+Y QFVP+CKKS +        +A L +GFPP+   Y S VT I  + V+++ +  S+FN L T W F  G      S  +EF + FEFKS L+S++A +FFD +V+ MV AF  R++  YG     +Q+ +
Sbjct:   74 RRMEYSESRSINYSPEQMYDVVANVEQYQQFVPWCKKSKVTRGRNGDMRAQLEIGFPPIVERYTSEVTVIPNHQVRAVCTDGSLFNHLETLWRFTPGAA--GQSCNVEFFVTFEFKSLLHSQLATMFFDEVVKQMVNAFETRAKKLYGTGVHRQQASL 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Zebrafish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 106.301 bits (264), Expect = 6.878e-27
Identity = 57/158 (36.08%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  483 FSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F+K  +Y E+RIIGYS  +M+ VV+KVE+Y  FVP+                                     P++V++  S   +FN L T W F  GLP  P +  L+F+I+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP++
Sbjct:   72 FNKRKEYSERRIIGYSMQEMYEVVAKVEDYLLFVPW-----------------------------------FRPHLVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRASKLYGPETQIPRE 194          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Xenopus
Match: coq10a (coenzyme Q10A [Source:NCBI gene;Acc:780028])

HSP 1 Score: 149.828 bits (377), Expect = 9.876e-43
Identity = 71/163 (43.56%), Postives = 108/163 (66.26%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSS-IPKQ 953
            F+    +K  +Y E+RI+GYS  +M+ VVS VEEY  FVP+CKKS +IS+     KA L VGFPP+   Y S +T + P++V+++ +   +FN L + W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP++
Sbjct:   76 FTGPLTNKRKEYSERRIMGYSMQEMYEVVSNVEEYKLFVPWCKKSTVISKRTGYAKAQLEVGFPPILERYTSILTLVRPHLVKAVCTDGRLFNHLESIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATVFFDEVVKQMVAAFERRAGKMYGPETPIPRE 238          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Xenopus
Match: mkx (mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539])

HSP 1 Score: 125.561 bits (314), Expect = 9.582e-34
Identity = 60/154 (38.96%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  486 SKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIP 947
            SK ++Y E +++GYS  QM+++V+ V  Y  FVP+C  S ++S      +A+L VGFPP+   YVS ++ I  + V+++ S   +F+ L T W F  GL   P++  L+F ++FEFKS L+S++A +FFD +V+ MV AF  ++   YG   +P
Sbjct:   63 SKRIEYSESKVLGYSIEQMYDIVADVANYKIFVPWCNCSKVLSCKKGVTRAELEVGFPPVVERYVSEISVIPRHQVRAVCSDGRLFSHLETVWRFSPGLSGRPDTCTLDFYVSFEFKSLLHSQLANVFFDEVVKQMVCAFEKQAARIYGRQVVP 216          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Xenopus
Match: mkx (mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539])

HSP 1 Score: 125.561 bits (314), Expect = 1.147e-33
Identity = 60/154 (38.96%), Postives = 97/154 (62.99%), Query Frame = 3
Query:  486 SKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIP 947
            SK ++Y E +++GYS  QM+++V+ V  Y  FVP+C  S ++S      +A+L VGFPP+   YVS ++ I  + V+++ S   +F+ L T W F  GL   P++  L+F ++FEFKS L+S++A +FFD +V+ MV AF  ++   YG   +P
Sbjct:   77 SKRIEYSESKVLGYSIEQMYDIVADVANYKIFVPWCNCSKVLSCKKGVTRAELEVGFPPVVERYVSEISVIPRHQVRAVCSDGRLFSHLETVWRFSPGLSGRPDTCTLDFYVSFEFKSLLHSQLANVFFDEVVKQMVCAFEKQAARIYGRQVVP 230          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 157.918 bits (398), Expect = 6.602e-46
Identity = 71/163 (43.56%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +MF VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   78 FAAPFTNKRKAYSERRIMGYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 240          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 156.377 bits (394), Expect = 9.150e-46
Identity = 71/163 (43.56%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +MF VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   46 FAAPFTNKRKAYSERRIMGYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 208          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Match: Coq10b (coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126])

HSP 1 Score: 153.295 bits (386), Expect = 3.353e-44
Identity = 74/163 (45.40%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
             S+   +K  +Y E+RI+GYS  +M++VVS +E+Y  FVP+CKKS IIS+     K  L VGFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   71 ISAPLVNKRKEYSERRILGYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 233          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Match: Coq10a (coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847])

HSP 1 Score: 149.828 bits (377), Expect = 1.102e-42
Identity = 71/173 (41.04%), Postives = 111/173 (64.16%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIG----------YSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+G          YS  +MF VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   78 FAAPFTNKRKAYSERRIMGSSASDSSCCRYSMQEMFEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVLERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPSYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 250          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Match: Coq10b (coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126])

HSP 1 Score: 139.428 bits (350), Expect = 1.383e-39
Identity = 68/148 (45.95%), Postives = 99/148 (66.89%), Query Frame = 3
Query:  513 RIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            R + YS  +M++VVS +E+Y  FVP+CKKS IIS+     K  L VGFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   36 RDVRYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 183          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Match: sp|Q96MF6|CQ10A_HUMAN (Coenzyme Q-binding protein COQ10 homolog A, mitochondrial OS=Homo sapiens OX=9606 GN=COQ10A PE=2 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 4.275e-45
Identity = 70/163 (42.94%), Postives = 111/163 (68.10%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            F++ + +K   Y E+RI+GYS  +M+ VVS V+EY +FVP+CKKS ++S      KA L VGFPP+   Y S V+ ++P+MV+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+  K+GP ++IP++
Sbjct:   76 FAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRE 238          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Match: sp|Q3THF9|CQ10B_MOUSE (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Mus musculus OX=10090 GN=Coq10b PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.973e-43
Identity = 74/163 (45.40%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
             S+   +K  +Y E+RI+GYS  +M++VVS +E+Y  FVP+CKKS IIS+     K  L VGFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   69 ISAPLVNKRKEYSERRILGYSMQEMYDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 231          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9H8M1|CQ10B_HUMAN (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Homo sapiens OX=9606 GN=COQ10B PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 4.468e-43
Identity = 72/163 (44.17%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
             ++   +K  +Y E+RI+GYS  +M++VVS VE+Y  FVP+CKKS +IS+     K  L +GFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   67 ITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5RD79|CQ10B_PONAB (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Pongo abelii OX=9601 GN=COQ10B PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 5.355e-43
Identity = 72/163 (44.17%), Postives = 109/163 (66.87%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
             ++   +K  +Y E+RI+GYS  +M++VVS VE+Y  FVP+CKKS +IS+     K  L +GFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   67 ITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5I0I9|CQ10B_RAT (Coenzyme Q-binding protein COQ10 homolog B, mitochondrial OS=Rattus norvegicus OX=10116 GN=Coq10b PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 9.138e-43
Identity = 72/156 (46.15%), Postives = 106/156 (67.95%), Query Frame = 3
Query:  489 KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            K  +Y E+RIIGYS  +M++VVS +E+Y  FVP+CKKS I+S+     K  L +GFPP+   Y S VT ++P++V++  +   +FN L T W F  GLP  P +  L+FSI+FEF+S L+S++A LFFD +V+ MV AF  R+   YGP ++IP++
Sbjct:   76 KRKEYSERRIIGYSMQEMYDVVSGMEDYKHFVPWCKKSDILSRRSGYCKTRLEIGFPPVLERYTSIVTLVKPHLVKASCTDGKLFNHLETVWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRE 231          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Match: A0A0L8GK14 (Polyketide_cyc domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22032191mg PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.169e-47
Identity = 80/174 (45.98%), Postives = 120/174 (68.97%), Query Frame = 3
Query:  456 KKRLFS-SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSY 974
            K+ LF+  N+ ++  +Y E+R++GYS  Q+F VV+ VE Y +FVP+C K+ I  +L N FKA L +GFPPL   Y S VT  +P++V+S  +   +FN L TTW FR GLP   N+ +L+F++AFEF+S L+S+++ LFFD +V+ MV++FL R++  YGP  I  Q+P I+ Y
Sbjct:   36 KRELFTLPNFNNRRKEYSERRLLGYSMEQIFTVVADVERYPEFVPWCTKAVIFHRLPNHFKAKLQIGFPPLIEQYTSVVTLAKPHLVKSECTNGKLFNLLETTWRFRPGLPNNENTCVLDFAVAFEFRSALHSQLSTLFFDEVVKQMVKSFLKRTKSIYGPECIKSQNPKIIKY 209          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Match: A0A1I7XAI7 (Polyketide_cyc domain-containing protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 3.760e-47
Identity = 79/165 (47.88%), Postives = 113/165 (68.48%), Query Frame = 3
Query:  480 YFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSY 974
            Y +K M Y EKR+IG+S++QMF+VV  V +Y+ FVP+C++S +  +  N+  A+L +GFPPL  SY S V ++ P++V S+    S+F  L TT+ F  GLP+ P S IL + + FEFKS L+SR+A LFFD++V+TMV AFL R+E  +G  SIP   P I+ Y
Sbjct:   11 YNNKEMAYSEKRLIGFSRDQMFDVVLNVADYHLFVPWCRRSIVSHEHMNSQIAELEIGFPPLLESYTSRVIHVRPSVVHSVCLDESLFRTLDTTFRFGKGLPDNPLSCILHYDLTFEFKSSLHSRIAHLFFDNVVKTMVNAFLQRAEHTHGKPSIPHSPPEIIQY 175          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Match: W2SZH9 (Polyketide cyclase/dehydrase OS=Necator americanus OX=51031 GN=NECAME_04065 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.077e-47
Identity = 85/186 (45.70%), Postives = 125/186 (67.20%), Query Frame = 3
Query:  426 ILTRL-SNFFIKKRLFSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 980
            I+TR  +N+ + KRLFSS    + + Y EKR IG+S+ QMF+VV+ V +Y+ F+P+C++S I+ +  N+  A+L +GFPPL  SY S +T + P++V S+  G S+FN L TT+ F  G P+   S +L + + FEFKS L+S +A LFFD +V+TMVEAFL R+E  +G  S P  SP +L Y +
Sbjct:    5 IVTRTPANYALFKRLFSS----QELAYSEKRAIGFSREQMFDVVADVGQYHLFIPWCRRSDILEKHENSRIAELEIGFPPLLESYRSRITLLRPSVVHSVVIGDSIFNTLETTFRFAKGEPDNELSCVLHYDLVFEFKSALHSGMAHLFFDRVVKTMVEAFLRRAEQLHGKPSTPHASPEVLRYKK 186          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Match: A0A0P4WJT9 (Polyketide_cyc domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.336e-46
Identity = 75/164 (45.73%), Postives = 115/164 (70.12%), Query Frame = 3
Query:  486 SKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYS 977
             K  +Y E+R++GYS NQMF+VVS+VE+Y++FVPYCKKS +  +     KADL+VGFPP+  SY S+VT  +P++V+++ +   +FN L+T W F  G+   PN+  L+FS++FEF+S ++S++A +FFD +V   V +FL  +E +YG +SI  + P IL  S
Sbjct:   66 GKKKEYSERRVLGYSMNQMFDVVSQVEDYHKFVPYCKKSLVTVRRPGFLKADLVVGFPPVVESYTSSVTLAKPHLVRAVCTEGKLFNHLLTIWKFSPGIRGQPNTCTLDFSVSFEFRSAIHSQLAHVFFDEMVRKNVNSFLREAEKRYGKASIVARPPRILHAS 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Match: A0A074ZLG2 (Polyketide_cyc domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08115 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 3.582e-46
Identity = 82/177 (46.33%), Postives = 112/177 (63.28%), Query Frame = 3
Query:  453 IKKRLFSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLG-NTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 980
            I+  L   N   KSM YKE+R++GYS+ QMFN+ + V +Y +FVP+C +S ++ +         L VGFPPL+ SY S VT   P  V+S+   S +F  LI  WHF  GL    N+ ++EFS+ FEFKS LY+++A LFFD +V  MV AF+ R+   +GP+SIP Q P IL YSR
Sbjct:   23 IRMFLTLGNSQDKSMSYKERRLLGYSQQQMFNIAADVGKYREFVPWCNESVVVRKTASGAVIVQLGVGFPPLSESYTSTVTLQHPAHVKSVAHSSHMFEYLINQWHFWPGLVANENTCMVEFSVDFEFKSALYAKIAGLFFDQVVAMMVNAFITRARTLHGPASIPPQKPDILEYSR 199          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 154.451 bits (389), Expect = 4.994e-45
Identity = 72/161 (44.72%), Postives = 109/161 (67.70%), Query Frame = 3
Query:  474 SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            ++ F+K  +Y E+RIIGYS  +M+ VV+KVE+Y  FVP+CK+S ++ +     KA L VGFPP+  +Y S +T + P+MV++  S   +FN L T W F  GLP  P +  L+F+I+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP++
Sbjct:   56 ADSFNKRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGPETQIPRE 216          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 153.295 bits (386), Expect = 3.755e-44
Identity = 72/159 (45.28%), Postives = 107/159 (67.30%), Query Frame = 3
Query:  474 SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIP 947
            ++ F+K  +Y E+RIIGYS  +M+ VV+KVE+Y  FVP+CK+S ++ +     KA L VGFPP+  +Y S +T + P+MV++  S   +FN L T W F  GLP  P +  L+F+I+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP
Sbjct:   69 ADSFNKRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGPETQIP 227          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 153.295 bits (386), Expect = 4.311e-44
Identity = 72/159 (45.28%), Postives = 107/159 (67.30%), Query Frame = 3
Query:  474 SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIP 947
            ++ F+K  +Y E+RIIGYS  +M+ VV+KVE+Y  FVP+CK+S ++ +     KA L VGFPP+  +Y S +T + P+MV++  S   +FN L T W F  GLP  P +  L+F+I+FEF+S L+S++A +FFD +V+ MV AF  R+   YGP + IP
Sbjct:   69 ADSFNKRKEYSERRIIGYSMQEMYEVVAKVEDYLHFVPWCKRSDVVFRRSGFCKAKLTVGFPPVVENYTSLITTVRPHMVKASCSDGKLFNHLETVWRFSPGLPGYPRTCTLDFAISFEFRSLLHSQLATVFFDEVVKQMVSAFERRACKLYGPETQIP 227          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 148.673 bits (374), Expect = 5.659e-43
Identity = 69/157 (43.95%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  486 SKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSS-IPKQ 953
            +K  QY E+RI+GYS  +M++VV+ V++Y  FVP+CKKS  I +     KA L +GFPP+   Y S +T + P++V+++ S   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+ MV AF NR+   YGP + IP++
Sbjct:   45 NKRKQYSERRIMGYSMQEMYDVVANVDDYKLFVPWCKKSETIMKRAGHAKAQLEIGFPPVVERYTSMITNVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSILHSQLATVFFDEVVKQMVAAFENRAGKLYGPETRIPRE 201          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Match: COQ10A (coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515])

HSP 1 Score: 149.058 bits (375), Expect = 6.564e-43
Identity = 69/157 (43.95%), Postives = 106/157 (67.52%), Query Frame = 3
Query:  486 SKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSS-IPKQ 953
            +K  QY E+RI+GYS  +M++VV+ V++Y  FVP+CKKS  I +     KA L +GFPP+   Y S +T + P++V+++ S   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+ MV AF NR+   YGP + IP++
Sbjct:   66 NKRKQYSERRIMGYSMQEMYDVVANVDDYKLFVPWCKKSETIMKRAGHAKAQLEIGFPPVVERYTSMITNVRPHLVKAVCSDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSILHSQLATVFFDEVVKQMVAAFENRAGKLYGPETRIPRE 222          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001448.1 (pep scaffold:Pmarinus_7.0:GL476436:271081:272492:-1 gene:ENSPMAG00000001303.1 transcript:ENSPMAT00000001448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 2.340e-45
Identity = 77/179 (43.02%), Postives = 110/179 (61.45%), Query Frame = 3
Query:  420 SFILTRLSNFF-----IKKRLFSSN--YFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP 935
            S +L R +N       +  R F S   +  K   Y E+ ++GYSK QM+ +V+ VE Y +FVP+CK+S +  +     +ADL VGFPPL  SY S VT +EP++V++  +   +FN L T W F  G P  P S  +EFSI+FEF+S L+S++A +FFD +V+ MV AFL R+   YGP
Sbjct:   16 SPVLMRKTNICPVMSPVPARTFLSKLPFGDKRKDYAERHLVGYSKEQMYAIVANVESYREFVPWCKRSRVTFRRPGFMRADLQVGFPPLVESYSSTVTLVEPHIVRATCTDGRLFNHLETEWRFGRGAPGHPESCTIEFSISFEFRSLLHSQMASMFFDEVVKQMVTAFLRRAAKMYGP 194          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Sea Lamprey
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:550442])

HSP 1 Score: 144.821 bits (364), Expect = 2.662e-42
Identity = 70/163 (42.94%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  468 FSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYG-PSSIPKQ 953
             +S + +K  +Y E+RI+GYS  +M+ VV+ VE+Y  FVP+ KKS ++ Q  +  KA L VGFPP+   Y S+VT +EP++V++I +   +FN L T W F  G+P I  S  L+FS +FEF+S L+S++A +FFD +V+ MV AF  R    +G  + IP++
Sbjct:   35 LTSPFANKRKEYSERRILGYSMQEMYGVVANVEDYKTFVPWVKKSLVVFQRSSHIKAQLEVGFPPMIERYTSSVTLVEPHLVKAICTDGRIFNHLETVWRFSPGIPGIQRSCTLDFSTSFEFRSLLHSQLAGMFFDEVVKQMVGAFERRVCKLHGVETPIPRE 197          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Yeast
Match: COQ10 (Coenzyme Q (ubiquinone) binding protein; functions in the delivery of Q6 to its proper location for electron transport during respiration; START domain protein with homologs in bacteria and eukaryotes; respiratory growth defect of the null mutant is functionally complemented by human COQ10A [Source:SGD;Acc:S000005368])

HSP 1 Score: 66.2402 bits (160), Expect = 2.357e-13
Identity = 44/164 (26.83%), Postives = 86/164 (52.44%), Query Frame = 3
Query:  444 NFFIKKRLFSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQ---LGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGS---SVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRS 917
            NFF    L  +N+  +  +Y  ++ I    + ++  VS+V +Y +F+PYC  SF+  +         A L VGF   +  ++ NVT  + +   ++ + +   ++F+ LI+ W      P  PN++++E  + F+FKS +Y+ V+ +F   + E ++ AF  R+
Sbjct:   30 NFF---GLSGTNHTIREQRYVLRKAINAPPSTVYAAVSEVAQYKEFIPYCVDSFVDKRNPVDNKPLIAGLRVGFKQYDEEFICNVTCKDTDHTYTVVAETISHNLFHLLISKWTIMPH-PNRPNAAMVELLLRFKFKSRIYNSVSLIFAKTVTELVMNAFAKRA 189          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Nematostella
Match: EDO42929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZZ7])

HSP 1 Score: 137.502 bits (345), Expect = 8.843e-40
Identity = 63/143 (44.06%), Postives = 92/143 (64.34%), Query Frame = 3
Query:  519 IGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPL-NVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSI 944
            +GYS   M+NVV+ V++Y  FVP+C+ S    +    FKA L VGFPPL +  Y S VT + PN+V+S  +   +FN ++T W F  GL + PN+  L+F + FEFKS L+SR++ +FFD +V+ MV AF +R  + YGP  +
Sbjct:    1 MGYSMEDMYNVVADVDDYKHFVPWCRDSTTFRRRPGCFKAKLCVGFPPLLSEKYTSTVTIVPPNLVKSECTDGEMFNYMLTVWKFGPGLKDNPNTCTLDFFVEFEFKSLLHSRLSTMFFDEVVKKMVRAFEDRCAYLYGPQRL 143          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Medaka
Match: coq10b (coenzyme Q10B [Source:NCBI gene;Acc:101164043])

HSP 1 Score: 141.739 bits (356), Expect = 5.411e-40
Identity = 69/161 (42.86%), Postives = 105/161 (65.22%), Query Frame = 3
Query:  474 SNYFSKSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGP-SSIPKQ 953
            ++ FSK  +Y E+RIIGYS  +++ VV+ VE Y  FVP+C KS ++       KA L VGFPP+  +Y S VT + P++V++  S   +FN L T W F  GLP  P +  ++FSI+FEF+S L+S++A +FFD +V+ MV AF  R+   +G  ++IP++
Sbjct:   69 TDSFSKRREYSERRIIGYSMQEIYEVVAGVENYRLFVPWCTKSEVVFSRSGFCKAKLTVGFPPVVENYTSLVTTVRPHLVKASCSEGKLFNHLETVWRFSPGLPGYPRTCTVDFSISFEFRSLLHSQLAHVFFDEVVKQMVSAFERRASKIHGAETAIPRE 229          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Medaka
Match: si:dkey-190g6.2 (coenzyme Q-binding protein COQ10 homolog A, mitochondrial [Source:NCBI gene;Acc:101155688])

HSP 1 Score: 140.969 bits (354), Expect = 1.691e-39
Identity = 68/165 (41.21%), Postives = 106/165 (64.24%), Query Frame = 3
Query:  471 SSNYFS---KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSS-IPKQ 953
            S N+ S   K  +Y E+RI+GYS  +M++VV+ V++Y  FVP+CKKS  I +     KA L VGF P+   Y S +T + P++V+++ +   +FN L T W F  G+P  P +  ++FSI+FEF+S L+S++A +FFD +V+  V AF  R+   YGP + IP++
Sbjct:   76 SRNFISLTNKRKEYSERRILGYSMQEMYDVVANVDDYKLFVPWCKKSQTIMKRAGHSKAQLEVGFSPVIERYTSMITCVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRASKLYGPETRIPRE 240          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Medaka
Match: si:ch73-141c7.1 (coenzyme Q-binding protein COQ10 homolog, mitochondrial [Source:NCBI gene;Acc:101164311])

HSP 1 Score: 134.035 bits (336), Expect = 4.665e-37
Identity = 64/161 (39.75%), Postives = 103/161 (63.98%), Query Frame = 3
Query:  489 KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSE--FKYGPSSIPKQSPMI 965
            + ++Y E R + Y+  QM+NVV+ VE+Y  FVP+CKKS +I       +A+L +GFPP+   Y S+VT+     V++I +  S+FN L T W F  G  + PNS +++F ++FEFKS L+S++A +F D +V+ MV AF +R+   ++   S+I ++ P I
Sbjct:   71 RRVEYTESRTLEYTPEQMYNVVANVEKYQYFVPWCKKSRVIKGRNGNVQAELEIGFPPITERYTSDVTFDPNRQVRAICTEGSLFNHLETIWRFSPGAKDQPNSCLVDFLVSFEFKSLLHSQLASMFLDEVVKQMVGAFESRAAALYRNHTSAIIRRQPAI 231          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Medaka
Match: si:dkey-190g6.2 (coenzyme Q-binding protein COQ10 homolog A, mitochondrial [Source:NCBI gene;Acc:101155688])

HSP 1 Score: 100.523 bits (249), Expect = 2.195e-24
Identity = 47/121 (38.84%), Postives = 75/121 (61.98%), Query Frame = 3
Query:  471 SSNYFS---KSMQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIA 824
            S N+ S   K  +Y E+RI+GYS  +M++VV+ V++Y  FVP+CKKS  I +     KA L VGF P+   Y S +T + P++V+++ +   +FN L T W F  G+P  P +  ++FS++
Sbjct:   76 SRNFISLTNKRKEYSERRILGYSMQEMYDVVANVDDYKLFVPWCKKSQTIMKRAGHSKAQLEVGFSPVIERYTSMITCVRPHLVKAVCTDGKLFNHLETIWRFSPGIPGYPRTCTVDFSVS 196          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Planmine SMEST
Match: SMESG000052094.1 (SMESG000052094.1)

HSP 1 Score: 327.791 bits (839), Expect = 6.186e-114
Identity = 161/162 (99.38%), Postives = 161/162 (99.38%), Query Frame = 3
Query:  495 MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 980
            MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKS IISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR
Sbjct:    1 MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSLIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 162          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Planmine SMEST
Match: SMESG000020570.1 (SMESG000020570.1)

HSP 1 Score: 212.616 bits (540), Expect = 4.467e-68
Identity = 104/186 (55.91%), Postives = 137/186 (73.66%), Query Frame = 3
Query:  429 LTRLSNFFIKKRLFSSNYFSKS--MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 980
            ++R + F+ K+ LF    F K   M+Y EKRIIGYS +QMF VVS VE+YYQFVPYCKKS I ++   TFKA+++VGFPPL  +YVS +T  +PN+V S+ SG  +FNEL+T W FR GL EIP S IL+FS++FEF+  L+S+ A++FFDHIV  MV+AFL R+E  YGP S+ KQ P I+SY +
Sbjct:   10 VSRFNLFYSKRCLFKDGIFGKGKRMKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 195          
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Planmine SMEST
Match: SMESG000020570.1 (SMESG000020570.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.208e-65
Identity = 97/162 (59.88%), Postives = 125/162 (77.16%), Query Frame = 3
Query:  495 MQYKEKRIIGYSKNQMFNVVSKVEEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMVQSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAKLFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR 980
            M+Y EKRIIGYS +QMF VVS VE+YYQFVPYCKKS I ++   TFKA+++VGFPPL  +YVS +T  +PN+V S+ SG  +FNEL+T W FR GL EIP S IL+FS++FEF+  L+S+ A++FFDHIV  MV+AFL R+E  YGP S+ KQ P I+SY +
Sbjct:    1 MKYSEKRIIGYSMDQMFEVVSDVEKYYQFVPYCKKSDIFNKSYRTFKANIVVGFPPLKEAYVSTITVSKPNLVHSVASGGILFNELLTIWKFRPGLLEIPKSCILDFSVSFEFRHALHSQFAEIFFDHIVIMMVDAFLKRAEDIYGPGSLEKQPPKIISYEK 162          
The following BLAST results are available for this feature:
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COQ10A8.903e-4642.94coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A1.060e-4542.94coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A1.292e-4542.94coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10B9.304e-4444.17coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819][more]
COQ10B9.634e-4444.44coenzyme Q10B [Source:HGNC Symbol;Acc:HGNC:25819][more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R144.132.266e-4343.48pep chromosome:WBcel235:III:5023264:5024064:1 gene... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG94108.832e-4446.15gene:FBgn0033086 transcript:FBtr0086115[more]
CG94101.383e-4345.86gene:FBgn0033086 transcript:FBtr0086116[more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
coq10b5.265e-4446.20coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
COQ10A8.409e-4242.31si:dkey-190g6.2 [Source:ZFIN;Acc:ZDB-GENE-090312-3... [more]
si:ch73-141c7.11.006e-3441.14si:ch73-141c7.1 [Source:NCBI gene;Acc:393762][more]
coq10b6.878e-2736.08coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
coq10a9.876e-4343.56coenzyme Q10A [Source:NCBI gene;Acc:780028][more]
mkx9.582e-3438.96mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539... [more]
mkx1.147e-3338.96mohawk homeobox [Source:Xenbase;Acc:XB-GENE-853539... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Coq10a6.602e-4643.56coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10a9.150e-4643.56coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10b3.353e-4445.40coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126][more]
Coq10a1.102e-4241.04coenzyme Q10A [Source:MGI Symbol;Acc:MGI:2684847][more]
Coq10b1.383e-3945.95coenzyme Q10B [Source:MGI Symbol;Acc:MGI:1915126][more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96MF6|CQ10A_HUMAN4.275e-4542.94Coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
sp|Q3THF9|CQ10B_MOUSE1.973e-4345.40Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q9H8M1|CQ10B_HUMAN4.468e-4344.17Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q5RD79|CQ10B_PONAB5.355e-4344.17Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
sp|Q5I0I9|CQ10B_RAT9.138e-4346.15Coenzyme Q-binding protein COQ10 homolog B, mitoch... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GK142.169e-4745.98Polyketide_cyc domain-containing protein OS=Octopu... [more]
A0A1I7XAI73.760e-4747.88Polyketide_cyc domain-containing protein OS=Hetero... [more]
W2SZH97.077e-4745.70Polyketide cyclase/dehydrase OS=Necator americanus... [more]
A0A0P4WJT93.336e-4645.73Polyketide_cyc domain-containing protein OS=Scylla... [more]
A0A074ZLG23.582e-4646.33Polyketide_cyc domain-containing protein OS=Opisth... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b4.994e-4544.72coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
coq10b3.755e-4445.28coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
coq10b4.311e-4445.28coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
COQ10A5.659e-4343.95coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
COQ10A6.564e-4343.95coenzyme Q10A [Source:HGNC Symbol;Acc:HGNC:26515][more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001448.12.340e-4543.02pep scaffold:Pmarinus_7.0:GL476436:271081:272492:-... [more]
coq10b2.662e-4242.94coenzyme Q10B [Source:NCBI gene;Acc:550442][more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COQ102.357e-1326.83Coenzyme Q (ubiquinone) binding protein; functions... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO429298.843e-4044.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
coq10b5.411e-4042.86coenzyme Q10B [Source:NCBI gene;Acc:101164043][more]
si:dkey-190g6.21.691e-3941.21coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
si:ch73-141c7.14.665e-3739.75coenzyme Q-binding protein COQ10 homolog, mitochon... [more]
si:dkey-190g6.22.195e-2438.84coenzyme Q-binding protein COQ10 homolog A, mitoch... [more]
back to top
BLAST of Coenzyme Q-binding protein COQ10 homolog B, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052094.16.186e-11499.38SMESG000052094.1[more]
SMESG000020570.14.467e-6855.91SMESG000020570.1[more]
SMESG000020570.11.208e-6559.88SMESG000020570.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018134 ID=SMED30018134|Name=Coenzyme Q-binding protein COQ10 homolog B, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1041bp
AGATTTTTTAGTAAATCTTTGATTTATCTGGGCAATATCAGCTGACTGGG
GTTTTACTCACAACAGTTGGTAATTAAACTTCTTGTTCTGTTTCTGTTGA
GTTACCACTATGGGGAAAACCGTTAGTCAAGAGTCTGAAACTTTGTTTTA
CTCAAACACAACAATGTGAATTTAAATAAATGATTTTTGGTTTTAAAAAA
TATATTTTTTACTATTACGTCATGATAAAATTGTATTGATTAATATAAAA
TCAACTTATATAATTTAAAGAAATAAAATTAGATTCTTAATATGTAAACA
GTTTTTATTAAAGACACTTTGATTCCAAAAATAAAAATTTGTTTTAAAAA
CATTTATAATGCATTCTATATAATTTGAATTTTAAGTTTTATAATATATT
TTATTTTAACCTTATGTCGTCATTTATTTTAACGAGACTATCTAATTTTT
TTATTAAAAAAAGATTATTTTCAAGCAATTATTTTTCTAAATCTATGCAA
TATAAAGAAAAACGAATTATAGGGTATTCAAAGAATCAAATGTTTAATGT
TGTTTCAAAAGTTGAAGAATATTATCAATTCGTGCCTTATTGCAAAAAGT
CTTTTATAATAAGCCAATTAGGAAATACATTCAAAGCAGATTTAATTGTC
GGATTTCCACCGTTGAATGTTTCATACGTATCTAATGTCACATATATTGA
ACCGAATATGGTCCAATCCATAGGTTCTGGAAGCTCGGTTTTCAACGAAC
TGATAACAACGTGGCATTTTCGTAATGGTCTGCCAGAAATACCAAATTCC
AGCATTCTTGAATTCTCTATTGCCTTCGAATTTAAATCTTATCTTTACTC
CAGAGTTGCAAAATTGTTTTTTGATCACATTGTCGAAACGATGGTGGAAG
CCTTTCTCAATCGGTCAGAATTCAAATATGGTCCCAGCAGCATTCCGAAA
CAATCTCCAATGATTTTGTCTTATTCTAGATGAATCAATTTTTTGTTTCA
CAACTGTCTTTCATATTTGAACGAATAAATTTTTTGGCTTC
back to top

protein sequence of SMED30018134-orf-1

>SMED30018134-orf-1 ID=SMED30018134-orf-1|Name=SMED30018134-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
MSSFILTRLSNFFIKKRLFSSNYFSKSMQYKEKRIIGYSKNQMFNVVSKV
EEYYQFVPYCKKSFIISQLGNTFKADLIVGFPPLNVSYVSNVTYIEPNMV
QSIGSGSSVFNELITTWHFRNGLPEIPNSSILEFSIAFEFKSYLYSRVAK
LFFDHIVETMVEAFLNRSEFKYGPSSIPKQSPMILSYSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000105secretory cell
Vocabulary: INTERPRO
TermDefinition
IPR005031COQ10_START
IPR023393START-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006744ubiquinone biosynthetic process
GO:0045333cellular respiration
Vocabulary: molecular function
TermDefinition
GO:0048039ubiquinone binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005031Coenzyme Q-binding protein COQ10, START domainPFAMPF03364Polyketide_cyccoord: 36..164
e-value: 3.2E-18
score: 66.2
IPR023393START-like domain superfamilyGENE3DG3DSA:3.30.530.20coord: 28..173
e-value: 9.6E-38
score: 131.3
NoneNo IPR availablePANTHERPTHR12901SPERM PROTEIN HOMOLOGcoord: 20..182
NoneNo IPR availableCDDcd07813COQ10p_likecoord: 30..167
e-value: 2.04122E-46
score: 147.233
NoneNo IPR availableSUPERFAMILYSSF55961Bet v1-likecoord: 28..171