Innexin

Overview
NameInnexin
Smed IDSMED30018116
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30018116) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30018116) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30018116) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30018116) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018116

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018116SMESG000000709.1 SmedASXL_008791SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30018116SMESG000000709.1 dd_Smed_v6_15922_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018116SMESG000000709.1 dd_Smed_v4_15922_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 124.02 bits (310), Expect = 1.466e-31
Identity = 89/358 (24.86%), Postives = 173/358 (48.32%), Query Frame = 2
Query:  116 GKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSN-HNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDN 1186
            G   + ++D  D   Y       F  + +  AK     PI CWVP +++ A+++YT   CW+E TY+L           D   R  +YYQWV   L   +L   IP  +W    + H+   + S++Q+    + ++   +   +  +    ++    + +  D     ++K +  N + + Y+ IK + L  +++ ++++  F+  +++ +GF ++R++  G +W+ +G FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F   +   +  +++ +W  I F    H +FI K+L           R+  K F++ FL  +GVF +  +  H  +    +++  LW N
Sbjct:   12 GLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRW-ANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR---ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHN 365          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 124.02 bits (310), Expect = 1.466e-31
Identity = 89/358 (24.86%), Postives = 173/358 (48.32%), Query Frame = 2
Query:  116 GKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSN-HNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDN 1186
            G   + ++D  D   Y       F  + +  AK     PI CWVP +++ A+++YT   CW+E TY+L           D   R  +YYQWV   L   +L   IP  +W    + H+   + S++Q+    + ++   +   +  +    ++    + +  D     ++K +  N + + Y+ IK + L  +++ ++++  F+  +++ +GF ++R++  G +W+ +G FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F   +   +  +++ +W  I F    H +FI K+L           R+  K F++ FL  +GVF +  +  H  +    +++  LW N
Sbjct:   12 GLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRW-ANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR---ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHN 365          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 123.635 bits (309), Expect = 3.865e-31
Identity = 89/358 (24.86%), Postives = 173/358 (48.32%), Query Frame = 2
Query:  116 GKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSN-HNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDN 1186
            G   + ++D  D   Y       F  + +  AK     PI CWVP +++ A+++YT   CW+E TY+L           D   R  +YYQWV   L   +L   IP  +W    + H+   + S++Q+    + ++   +   +  +    ++    + +  D     ++K +  N + + Y+ IK + L  +++ ++++  F+  +++ +GF ++R++  G +W+ +G FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F   +   +  +++ +W  I F    H +FI K+L           R+  K F++ FL  +GVF +  +  H  +    +++  LW N
Sbjct:   12 GLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRW-ANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLR---ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHN 365          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 121.324 bits (303), Expect = 2.052e-30
Identity = 90/347 (25.94%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  194 STLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWET----YSNHNISYLASIS----QINSHLKS--LNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFI--FKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQSI 1198
            + L  AK     PI CWVP  ++ A ++YT   CW++ TY++  + ++   +Y   +R   YYQWV   L   +L   +P  LW      +S  N+  L  ++     ++S +K+  +    +++  +V +       HS + F++              + + YI IK +    +++  +L+   +  N + +GF L++++    +W+ TG+FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F  L   I+   N MYW  I+F  S    F+ K+L  +     +        + F N FL+++GVF++  +  H  E    +++  LW ++ ++
Sbjct:   38 ALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNV 384          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 120.939 bits (302), Expect = 6.039e-30
Identity = 90/347 (25.94%), Postives = 169/347 (48.70%), Query Frame = 2
Query:  194 STLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWET----YSNHNISYLASIS----QINSHLKS--LNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFI--FKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQSI 1198
            + L  AK     PI CWVP  ++ A ++YT   CW++ TY++  + ++   +Y   +R   YYQWV   L   +L   +P  LW      +S  N+  L  ++     ++S +K+  +    +++  +V +       HS + F++              + + YI IK +    +++  +L+   +  N + +GF L++++    +W+ TG+FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F  L   I+   N MYW  I+F  S    F+ K+L  +     +        + F N FL+++GVF++  +  H  E    +++  LW ++ ++
Sbjct:   90 ALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNV 436          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.796e-28
Identity = 96/359 (26.74%), Postives = 170/359 (47.35%), Query Frame = 2
Query:  134 NEDVTDL--YLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAF-----DNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNW 1189
            ++D+ D   Y Y    +T F  + L  AK     PI CWVP  ++   ++YT   CW++ TYFL     +  +  +  +R   YYQWV   L   +L   +P  +W   S  +  ++ S+ Q+    + L+   +N AL  +    +E  H + +       KL             +   YI +K +  + I+  I+L+  F+   S  +G +++ ++  G +W+ +G FP +T C   +K  G+ +   VQCVL  N+FNEKIF+ + F   +       ++ YW +I    S    F+ K+L  I   +  +  +  + F+  FL+++GVFL+  +  H  E    ++ K LW+N+
Sbjct:   20 DDDIIDKLNYYYTTAIITVF--AILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKM-VDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.850e-28
Identity = 91/350 (26.00%), Postives = 173/350 (49.43%), Query Frame = 2
Query:  194 STLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWET----YSNHNISYLASIS----QINSHLKS--LNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIF-----KVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQSI 1198
            + L  AK     PI CWVP  ++ A ++YT   CW++ TY++  + ++   +Y   +R   YYQWV   L   +L   +P  LW      +S  N+  L  ++     ++S +K+  +    +++  +V +       HS + F++              + + YI IK +    +++  +L+   +  N + +GF L++++    +W+ TG+FP +T C   ++  G+ +   VQCVL  N+FNEKIF+ + F  L   I+   N MYW  I+F  S    F+ K+L  +       + + ++ +K   F N FL+++GVF++  +  H  E    +++  LW ++ ++
Sbjct:  158 ALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRK---FTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNV 504          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.160e-19
Identity = 87/360 (24.17%), Postives = 161/360 (44.72%), Query Frame = 2
Query:  137 EDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWET-YSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEI--SHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKT-KTFINTFLKRNGVFLIYFLYDH----VDEEALQKILKCLWDNWQ 1192
            +D  D   Y          S +   K      I CW+P E+   +++Y    C+I+ T+F+  R  +   + D       YYQWV I L   +    +P ++W + Y    + + + IS+  + L+S +   +   ++ +V    +I  + S+ ++      +  K   +   +++  +         +  I L        +  +GF    ++Y G +WQ++G+FP +T C  ++++  + +   VQCVL  N+FNEKI++ I F  +  LI   IN +   + L   S+   +I   L     V N    K    +F N  LK++GV L+ F+ DH    V +E  +++ K   +N Q
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEA-LRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGN-ETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLS--GPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQ 376          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 7.459e-19
Identity = 86/350 (24.57%), Postives = 161/350 (46.00%), Query Frame = 2
Query:  113 IGKFAQNNE--DVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQ-------NYYQWVSIFLIGLSLFMKIPQFLWETYSNH---NISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXX-XXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKK--TKTFINTFLKRNGVFL 1117
            + KF ++ E  D+ D + Y+        S+ +  A      PI CWVP +++  +++Y    C+I+GTYFL   +     +  T+            YYQW+ I L+  +    +P  +W T++      I  LA++S+ +  +KS     Q  A       FK+++    +   P+  +      + K L    L+  I  +  I+  + ++T F+   S  +G++  +++  G +W+ TGIFP +T C  +I +    +  ++QCV+  N+  EK++V   F LL   +L   ++ YW+ I    S    FI+ +L    + +    R       F++  L  +GVF+
Sbjct:    9 VRKFQRSAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNF---RNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFI 355          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61787|INX16_CAEEL (Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=inx-16 PE=3 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.226e-18
Identity = 88/374 (23.53%), Postives = 172/374 (45.99%), Query Frame = 2
Query:   77 LQIVMDINDFIQIGKFAQNNEDVTDLYLYKIVPLTFFIS-STLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLW---ETYSNHNISYLASISQINS-HLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGI--SRKKTKTFINTFLKRNGVFLIYFLYDHV----DEEALQKI 1165
            + ++ +I  + Q      +N+D +   L  +V  +  I+ S L  AK+   +P+ CW P +++  ++ +  + C+IE TYF+  + +          R   YYQWV   L+  +LF  +P+  W    +YS   I+ + + ++ N   L+  +  L+ +A+ +  +  ++  H    FN  +  KL    +                  I++  +L+  F+      +G+ +  ++  G  WQ +G FP +++C + ++E G+ +  ++QCVL  N+FNEKIF+ + F     L+    + + W +  F S++   FI   L      + GI  S +K        L+ +GV  +  L  +      EE ++KI
Sbjct:    1 MSMLGNIKTYAQTVTSLSDNDDTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPNQFAGGWESFAESYCFIENTYFVPMQDSNLPAAETREGREMIYYQWVPFLLVIQALFFCVPRAFWIIYPSYSGLTIADMITAARQNGKQLEGADEALEQVAM-INWRTEQQKGHGSRIFNCYLVMKLLILLN------------------IVLQFFLLNSFLNTAYTFWGWGIFWDMVNGRHWQESGHFPRVSFCDINVRELGNIHHWSLQCVLMVNMFNEKIFIFLWFWFAFLLVATAGDFVIWVWRRFDSNSKLGFILDLLN-----QEGIDHSPQKASELYKNVLRDDGVLFLRLLDSNSGRLNSEELMKKI 350          
BLAST of Innexin vs. TrEMBL
Match: A0A075A080 (Innexin OS=Opisthorchis viverrini OX=6198 GN=inx PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.711e-35
Identity = 98/376 (26.06%), Postives = 193/376 (51.33%), Query Frame = 2
Query:  107 IQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSR-YNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSL-NPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQS 1195
            +  GKF + ++D +D + +   PL   I + +  A+     PI CWVP E++ A +EY  + CW+  TYF+ +R  NV  +L D  DR  +YYQWV   L+  +    +P  +W  ++  +  +L+SI ++   ++ + +P  +   +  V +  ++   ++ ++      K +                N L+  Y++ K + ++ ++   + + + +  N   +G +L+R++  G  WQ +G FP IT C   +++  + +   VQCVLP N+FNEKIF+ + F  ++   + T + +YWS+      N   FI K L     +  G  +K+T  F++++L+++GVF++  +  +  E    +I++ LW  ++S
Sbjct:   14 LDAGKF-RRDDDFSDRFSHTFTPLLLVIFTLVISARQYIGKPIACWVPTEFTRAQEEYAESVCWVTSTYFIPTREVNVPVNLADREDRKIHYYQWVPFILMIQAFLFNLPCIVWRLFNWQSGIHLSSIMEVACEIEMIKDPETRKSNVTYVARHIEDALTTQREYRSGCGVKCRHFLARSCCLWFGKRYGNYLICLYLITKSLYILNVVGQFFFMNRILGTNYTFYGIDLLRDIAEGIVWQESGNFPRITLCDFEVRKLANVHRHTVQCVLPINMFNEKIFIFLWFWFILVAAVNTSSFLYWSYKSSFQGNRVHFIRKFLKLRDALEPG-DKKRTAAFVDSYLRQDGVFILRLVGLNAGELVASEIVERLWSLYKS 387          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LLY4 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 8.077e-35
Identity = 98/376 (26.06%), Postives = 193/376 (51.33%), Query Frame = 2
Query:  107 IQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSR-YNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSL-NPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQS 1195
            +  GKF + ++D +D + +   PL   I + +  A+     PI CWVP E++ A +EY  + CW+  TYF+ +R  NV  +L D  DR  +YYQWV   L+  +    +P  +W  ++  +  +L+SI ++   ++ + +P  +   +  V +  ++   ++ ++      K +                N L+  Y++ K + ++ ++   + + + +  N   +G +L+R++  G  WQ +G FP IT C   +++  + +   VQCVLP N+FNEKIF+ + F  ++   + T + +YWS+      N   FI K L     +  G  +K+T  F++++L+++GVF++  +  +  E    +I++ LW  ++S
Sbjct:   14 LDAGKF-RRDDDFSDRFSHTFTPLLLVIFTLVISARQYIGKPIACWVPTEFTRAQEEYAESVCWVTSTYFIPTREVNVPVNLADREDRKIHYYQWVPFILMIQAFLFNLPCIVWRLFNWQSGIHLSSIMEVACEIEMIKDPETRKSNVTYVARHIEDALTTQREYRSGCGVKCRHFLARSCCLWFGKRYGNYLICLYLITKSLYILNVVGQFFFMNRILGTNYTFYGIDLLRDIAEGIVWQESGNFPRITLCDFEVRKLANVHRHTVQCVLPINMFNEKIFIFLWFWFILVAAVNTSSFLYWSYKSSFQGNRVHFIRKFLKLRDALEPG-DKKRTAAFVDSYLRQDGVFILRLVGLNAGELVASEIVERLWSLYKS 387          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RPY2 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 3.939e-32
Identity = 93/376 (24.73%), Postives = 191/376 (50.80%), Query Frame = 2
Query:  107 IQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSR-YNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSL-NPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQS 1195
            +  GKF + ++D +D + +    L   I + +  A+     PI CWVP E++ A +EY  + CW+  TYF+ +   +V   + D  DR  +YYQWV   L+  +    +P  +W  ++  +  +L+SI ++   ++ + +P  +   +  V +  ++   ++ ++    A + +                N L+  Y++ K + ++ ++   + + + +  N   +G +L+R++  G  WQ +G FP IT C   +++  + +   VQCVLP N+FNEKIF+ + F  ++   +   + +YWS+      N   FI K L     +  G  +K+T  F++++L+++GVF++  +  +  E    +I++ LW+ ++S
Sbjct:   14 LDAGKF-RRDDDFSDRFSHTFTTLLLVIFTLVISARQYIGKPIACWVPTEFTRAQEEYAESVCWVTSTYFIPTNDVSVPVKIADREDRKIHYYQWVPFILMLQAFLFNLPCIVWRLFNWQSGIHLSSIMEVACEIEMIKDPETRKSNVTYVARHVEDALTAQREYRSGCAVRCRHCLAKSCCLWFGKRYGNYLICLYLITKSLYILNVVGQFFFMNRILGTNYTFYGLDLLRDLAEGYMWQESGNFPRITLCDFEVRKLANTHRHTVQCVLPINMFNEKIFIFLWFWFILVAAVNISSFLYWSYKSSFHGNRVHFIRKFLKLRDALEPG-DKKRTFAFVDSYLRQDGVFILRLVAQNAGELVASEIVERLWNMYKS 387          
BLAST of Innexin vs. TrEMBL
Match: A0A158R819 (Innexin OS=Taenia asiatica OX=60517 GN=inx PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 7.743e-32
Identity = 96/384 (25.00%), Postives = 190/384 (49.48%), Query Frame = 2
Query:   89 MDINDFIQIGKFA------QNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRY-NVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSL-NPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWD 1183
            MD + F  + KF       + ++D  D + +    L   I + +  A+     PI CWVP E++ A +EY  + CW+  TYFL ++   V     +  +R   YYQWV   L+  +    +P  +W  ++  +  +L+SI +++  ++ + +P  +   +  V +  ++   S+ ++ D      ++A              N L+  Y++ K + +  ++   +L+ + +  N   +G +L+R++  G  W+ +G FP IT C   I++  + +   VQCVLP N+FNEKIF+ + F  ++   +   + +YWS+     SN   FI K L     +  G  +K++  F++++L+++GVF++  +  +  E    +I++ LW 
Sbjct:    1 MDTHFFAGLTKFKLDAGKHRRDDDFADRFSHNFTTLLLVIFTLVVSARQYIGKPIACWVPTEFTRAQEEYAESVCWVTSTYFLPTKQKTVPESTQEREERKILYYQWVPFVLMIQAFLFNLPCIIWRLFNWQSGIHLSSIMEVSCDIEMIRDPDSRKSNITYVARHIEDALTSQREYRDGCGVNCRQAMARSCCFWFGKRYGNYLICLYLITKALYIFNVVGQFFLMNRILGTNYTFYGLDLIRDIAEGYLWEESGNFPRITLCDFEIRKLANSHRYTVQCVLPINMFNEKIFIFLWFWFILVSAVSISSFLYWSYKSSFRSNRIHFIRKFLKLRDSLEPG-EKKRSYAFVDSYLRQDGVFILRLVAQNAGELVASEIVEKLWQ 383          
BLAST of Innexin vs. TrEMBL
Match: A0A4Z2DYV9 (Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.728e-31
Identity = 97/371 (26.15%), Postives = 191/371 (51.48%), Query Frame = 2
Query:  107 IQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSR-YNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSL-NPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLW 1180
            +  GKF + ++D +D + +    L   I + +  A+     PI CWVP E++ A +EY  + CW+  TYF+ ++  NV  ++ +  +R  +YYQWV   L+  +    +P  +W  ++  +  +L+SI ++   ++ + +P  +   +  V +  ++   S+ ++    + + K                N L+  Y++ K + +  ++   +L+ K +  N   +G +L+R++  G  WQ +G FP IT C   +++  +++   VQCVLP N+FNEKIF+ + F  ++   + T + +YWS+         +FI K L     +  G  +KKT TF++T+L+++GVF++     +  E    +I++ LW
Sbjct:   14 LDAGKF-RRDDDFSDRFSHTFTSLLLIIFTLIISARQYIGKPIACWVPTEFTRAQEEYAESVCWVTSTYFIPTQEVNVPENISERENRKIHYYQWVPFILMIQAFMFNLPCLIWRLFNWQSGIHLSSIMEVACEIEMIKDPETRKSNITYVARHIEDALTSQREYRSGCSVRFKHCLARSCCLWFGKRYGNYLICLYLITKSLYIFNVVGQFFLMNKILGTNYTFYGLDLLRDISEGYVWQESGNFPRITLCDFEVRKVANKHRHTVQCVLPINMFNEKIFIFLWFWFILVAAVNTSSFLYWSYKSSFRGTRIQFIRKFLKLRGALEPG-DKKKTLTFVDTYLRQDGVFILRLTAQNAGELVASEIVERLW 382          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000000709.1 (SMESG000000709.1)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 363/364 (99.73%), Postives = 363/364 (99.73%), Query Frame = 2
Query:   89 MDINDFIQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLW 1180
            MDINDFIQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNKLLIFYILIKFICLIFIIIAIYLITKFIRVNSI FGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGILFLLLIALILLTINIMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLW
Sbjct:    1 MDINDFIQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNKLLIFYILIKFICLIFIIIAIYLITKFIRVNSINFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGILFLLLIALILLTINIMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLW 364          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000000713.1 (SMESG000000713.1)

HSP 1 Score: 121.324 bits (303), Expect = 1.146e-30
Identity = 91/344 (26.45%), Postives = 175/344 (50.87%), Query Frame = 2
Query:  182 FFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSN-------HNISYLASISQINS-HLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNW 1189
            F + + +   KD  F  +VC +PK W  A++EY++A CW + TYF+        +  +       YYQ+V +F++ L++ + IP+ +W+ +         H I   +++SQ  + + + +   ++N     +    + IS  +++ N   + K    F  + +    + + +I L    I +  I   ++  +I F  ++  N     +W  TG FP++TWC++ IK++ D Y+RN+QC LP N  ++K+F+ I   L++ ++L+  NI YW   +F  S    FI   L +   + N     KT++F++ F+  +G+FL++ L         QKI + LW+++
Sbjct:    2 FLLFAIILTTKDYIFQNLVCVIPKLWIRAHEEYSKAMCWADSTYFMNINNKSPANNQELDKLKIKYYQYVPLFIVCLAVGLIIPRNVWKLFCGPLGIDIIHTIEIFSTLSQYGTKNQRKIIIYIEN----KICSKSQIISREDSRANFVKSNKRNGRFLPHIVFYIVLKLFYIGLAIGEIFLIQIFLGMK--NIYFPIQMFLNSSRNIEWSTTGNFPIVTWCRILIKDNRDNYARNIQCTLPWNTVHDKLFIIIWMSLVVGIVLMCFNISYWIIEIFCPSQQKLFIRNLLIYTKDLLNKKVSVKTESFVHNFIGYDGLFLLHNLQKINKPIYFQKIFENLWNSF 339          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000048827.1 (SMESG000048827.1)

HSP 1 Score: 110.538 bits (275), Expect = 3.169e-26
Identity = 101/391 (25.83%), Postives = 185/391 (47.31%), Query Frame = 2
Query:  101 DFIQIGKFA----QNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWET---YSNHNISYLASISQINSHLK-SLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-------------------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGIS---RKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWD 1183
            +F ++G++     ++++D+ D   YK+  L  F   +L   +     PI CW+P+E++  ++EY+   CWI  TYF      + + + D   R   YYQW  I L        +P  +W++   YS +N+  L S+++     + S         +D+ +Q  K++  S T+    I T   K+F                     N L+  Y  +K + +  +I  +YL+ K    +   FG  ++ ++  G +WQ +G FP +T+C +  K+ G  Y   VQCVLP N+F EKI++ + F  +I +I+ + ++ +W   +       + I K+L F    +N I    +  T+ F+  +L+ +GVFL++ L     E     ++  LW+
Sbjct:   42 NFNKLGRWGSRHLRSDDDMADRLNYKVSSLLMFGFISLIGLRQYVGKPIQCWIPQEFTRGWEEYSENYCWIASTYFAPVSEKLPSKV-DRQKRLIGYYQWAPIILALQGFLFYMPYLIWKSCSFYSIYNLPKLISVTEDTLDTEASKTIVFAARYIDLCIQRQKKLKRSSTQ---CIKTACYKSFSCTKPKNCVVSLHFHIGRMYGNFLVSLYYFVKILYIFNLIGQLYLMEKIFGSSKSFFGMRILIDLIRGMEWQRSGNFPRVTFCDIETKKLGKNYLYTVQCVLPMNIFLEKIYLFLWFWHVILVIITSTSLFWWFVRIGTLKRRLKTIRKYLQF----QNAIGDTDKSTTRKFVTKYLQIDGVFLVHMLALSDGEIVAAGMVGELWN 424          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000035987.1 (SMESG000035987.1)

HSP 1 Score: 110.153 bits (274), Expect = 4.497e-26
Identity = 89/371 (23.99%), Postives = 173/371 (46.63%), Query Frame = 2
Query:  113 IGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKS-RYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETY---SNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFD-----------NNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLW 1180
            +GKF + ++D +D + +    +     S +   +     PI CWVP E++ + +EY  + CW+  TYF+   + ++  +     ++   YYQWV   L+  ++    P  +W      S  NIS +  I+     +K       NL  D + +   +    + ++ +    + +                N L+  Y + K + ++ +I   +L+ +F+  N   +G +L+  + +G++W  +G FP +T C   I++  +++   VQCVLP N+FNEKIF+ + F  +   I+   + ++W+           FI K L     ++    RKK   FI+ FL+++GVF++  L  +  +    +I + LW
Sbjct:   16 VGKF-RRDDDQSDRFNHFFTTILLVCFSLVVSTRQYVGKPIACWVPTEFTSSQEEYAESICWVSSTYFINPYQGSIPENTQQREEKKILYYQWVPFILMLQAILFNFPCCVWRLLNWQSGLNISAIIDIAGDTEMIKDYEQRKANL--DFITRHIDDTLRIQREYRNGCTVQCRHCLAQHFCMWFGRRYGNYLVCVYTICKSLYILNVIGQFFLMNRFLGTNYTFYGLDLIYQLSIGNEWTESGNFPRVTMCDFNIRKLANQHRYTVQCVLPINLFNEKIFIFLWFWFVFIAIITVHSFIHWTSKSVCRIQRYNFIRKFLVLKDALQEAGDRKKLYAFIDLFLQQDGVFILRLLALNCGDLIAAEITEYLW 383          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000024134.1 (SMESG000024134.1)

HSP 1 Score: 109.383 bits (272), Expect = 4.664e-26
Identity = 89/366 (24.32%), Postives = 165/366 (45.08%), Query Frame = 2
Query:  110 QIGKFAQNN----EDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIVCWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQWVSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNLALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIKEDGDEYSRNVQCVLPHNVFNEKIFVGXXXXXXXXXXXXXXXXMYWSFILFASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDHVDEEALQKILKCLWDNWQS 1195
            ++G+   N     +D +D   Y+   +   +  +LT     F  PI CW+P+E+S  ++EY+ + CWI GTY +  R      L D  D   +YYQW SI L   +L   IP  +W      +   L  I Q+      + P     ++  +     +   S+  +      K K+ F N   +   I + ++  I   + +         +   +G +++ ++  G  W  +G FP +T+C    K+ G  +   +QCVLP N+F EKIF+ + F  +I   +  +++  W   L       RFI  +L  +   +N     K + FI  +L+ +G+F+++ +  +V +     ++  LW+ ++S
Sbjct:    3 KLGRIGSNRIRLVDDFSDRINYQFSSILIIVLISLTGVWQYFGKPIQCWIPQEFSTGWEEYSESYCWISGTYPVNRRL---PELTDKQDVQISYYQWTSIVLAVQALLFFIPCMMWRLLILQSGFNLQRIMQVAVDANVIIPDHLQKSIKFIAIHMDKCLKSKKIYGTGYKAKFKRLFCNLLFVYIIIKVLYLLNIIGQLYLMQRFIGTSYS--FYGIQVLYDLMTGIGWPQSGNFPRVTFCDFTAKKLGKNHIYTIQCVLPFNMFLEKIFIFLWFWNVIIGCITAVSLFCWLNKLMTRKLKFRFIGDYLKLMGLAKNSEESWK-ENFIFDYLRTDGLFIMHLISINVGDIVAADVVCELWNLYRS 362          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.466e-3124.86Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.466e-3124.86Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-13.865e-3124.86Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-72.052e-3025.94Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-76.039e-3025.94Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.796e-2826.74Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL3.850e-2826.00Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL2.160e-1924.17Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23027|INX5_CAEEL7.459e-1924.57Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|O61787|INX16_CAEEL2.226e-1823.53Innexin-16 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A0803.711e-3526.06Innexin OS=Opisthorchis viverrini OX=6198 GN=inx P... [more]
A0A4S2LLY48.077e-3526.06Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A4E0RPY23.939e-3224.73Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A158R8197.743e-3225.00Innexin OS=Taenia asiatica OX=60517 GN=inx PE=3 SV... [more]
A0A4Z2DYV91.728e-3126.15Innexin OS=Schistosoma japonicum OX=6182 GN=inx PE... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000709.10.000e+099.73SMESG000000709.1[more]
SMESG000000713.11.146e-3026.45SMESG000000713.1[more]
SMESG000048827.13.169e-2625.83SMESG000048827.1[more]
SMESG000035987.14.497e-2623.99SMESG000035987.1[more]
SMESG000024134.14.664e-2624.32SMESG000024134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018116 ID=SMED30018116|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
TCTATTTGGCTAATGAATGAGAAATTATTTTCAGAAACTATAATGGTTAT
TTTGTTTTGCTATACTCACTAATTATTTGCAAATTGTCATGGATATAAAC
GACTTTATACAAATAGGCAAATTTGCTCAGAATAATGAAGATGTAACAGA
TTTGTATTTATATAAAATTGTCCCATTGACATTTTTTATTTCATCTACAC
TCACTCTTGCAAAAGATATTTTCTTTGATCCGATTGTTTGTTGGGTGCCA
AAGGAATGGAGCATAGCATATGATGAGTATACCCGAGCGGCGTGCTGGAT
CGAGGGCACTTACTTCCTAAAGTCAAGATATAATGTATCAACACATTTGT
ACGATACAACTGATAGAACGCAAAATTATTATCAATGGGTTTCGATATTT
CTCATTGGACTCAGTCTTTTTATGAAAATACCTCAATTTCTATGGGAAAC
TTATAGCAACCACAACATATCATATCTAGCATCAATTTCACAAATAAATA
GTCACCTCAAATCCCTTAATCCGACCCTCCAAAATCTGGCACTAGACGTT
GTCGTCCAAATGTTCAAAGAAATATCCCACTCGGAAACCAAGTTCAACGA
TCCAATCGCTACAAAGCTGAAAAAAGCATTTGATAATAATAAATTATTAA
TTTTTTATATTTTGATCAAATTTATTTGTCTAATTTTCATTATCATTGCA
ATTTATTTGATTACAAAATTTATAAGGGTAAACAGTATAACTTTTGGTTT
TGAATTAGTGAGGAACGTCTATTTAGGTTCGAAATGGCAAAACACTGGCA
TATTCCCAGTGATTACATGGTGCAAGGTGGCCATTAAAGAAGATGGTGAC
GAATACTCACGCAATGTTCAGTGCGTTTTACCACACAATGTATTTAATGA
GAAAATCTTTGTGGGAATATTGTTTCTTCTTTTGATTGCTCTTATATTAT
TGACGATAAACATCATGTATTGGTCATTTATATTGTTCGCGTCATCCAAT
CACGCGAGATTTATTCATAAACATTTATACTTTATTTTTAAAGTTCGCAA
TGGAATTTCCCGAAAGAAAACAAAAACCTTTATCAATACATTTTTAAAAA
GAAATGGAGTATTTTTAATATATTTTCTTTATGACCACGTTGATGAAGAA
GCTTTACAAAAAATATTAAAATGTCTTTGGGATAACTGGCAATCAATAGA
AAAAGAAAAAGAAGAGAAGACTCTTTTATGAAAATTTTGTATTTTTTCCA
GATCGGAAG
back to top

protein sequence of SMED30018116-orf-1

>SMED30018116-orf-1 ID=SMED30018116-orf-1|Name=SMED30018116-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MDINDFIQIGKFAQNNEDVTDLYLYKIVPLTFFISSTLTLAKDIFFDPIV
CWVPKEWSIAYDEYTRAACWIEGTYFLKSRYNVSTHLYDTTDRTQNYYQW
VSIFLIGLSLFMKIPQFLWETYSNHNISYLASISQINSHLKSLNPTLQNL
ALDVVVQMFKEISHSETKFNDPIATKLKKAFDNNKLLIFYILIKFICLIF
IIIAIYLITKFIRVNSITFGFELVRNVYLGSKWQNTGIFPVITWCKVAIK
EDGDEYSRNVQCVLPHNVFNEKIFVGILFLLLIALILLTINIMYWSFILF
ASSNHARFIHKHLYFIFKVRNGISRKKTKTFINTFLKRNGVFLIYFLYDH
VDEEALQKILKCLWDNWQSIEKEKEEKTLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport