Mucolipin-3

Overview
NameMucolipin-3
Smed IDSMED30018109
Length (bp)2129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mucolipin-3 (SMED30018109) t-SNE clustered cells

Violin plots show distribution of expression levels for Mucolipin-3 (SMED30018109) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mucolipin-3 (SMED30018109) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mucolipin-3 (SMED30018109) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018109

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30018109SMESG000068926.1 Contig1864GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30018109SMESG000015161.1 Contig1864GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30018109SMESG000015161.1 dd_Smed_v4_5888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mucolipin-3 vs. Ensembl Human
Match: MCOLN1 (mucolipin 1 [Source:HGNC Symbol;Acc:HGNC:13356])

HSP 1 Score: 227.639 bits (579), Expect = 4.442e-65
Identity = 144/452 (31.86%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS------SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQT---NTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISN-KRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +RR L+Y FM+P +K++AKG  P K++L ++K++V+TVQ+I+F  +N   V+F E +  +F+HLFLL +           +   FA Y  ++ + A  +A++ Y  L + ++G Y Y        +N   + LC  YY    + P+N T+  D  + T CI++ P        +  L+  ++   + +N ++ F+ L+   I+F L++I L+S   ++IPDC+ F + I F+N  H+G++ ++L+ +     C  P +   GD  N+   + D + +   S+S +LC RS++R +    +   F   + G  IS  +R  F +  Y+L+   D+L I G+I+K+ +     + K   +  VC+  LG    L ++ ++RY TF+   +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT
Sbjct:   41 LRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDG--------ADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTL-LESSSSYKNLTLKFHKLVNVTIHFRLKTINLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGD--NSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGI-----EAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVT 476          
BLAST of Mucolipin-3 vs. Ensembl Human
Match: MCOLN3 (mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358])

HSP 1 Score: 221.861 bits (564), Expect = 2.662e-63
Identity = 144/449 (32.07%), Postives = 246/449 (54.79%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY--GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKP-FPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +++MRR L++ FMNP EK+ A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  +    +          +A+Y   + +    +A+  Y +L   ++G + Y    + +  M +C  +Y+  +I P N T+  D  I T C  ++P  P    T          N  N +++F+ L+  E+ F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD +IS   C    +      NT  + + D   +    VSLILC RS+IR  +  ++  NFFL     ++S + +  F +  Y++I   DIL I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F+ K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFR+      CLFSL+NGDDM+ T
Sbjct:   35 EDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAE-------NKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKMEIQA-----KSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFAT 463          
BLAST of Mucolipin-3 vs. Ensembl Human
Match: MCOLN2 (mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357])

HSP 1 Score: 216.083 bits (549), Expect = 2.418e-61
Identity = 138/448 (30.80%), Postives = 244/448 (54.46%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS--SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTP-QILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +E +R +L+++FM+P EK++A+  +P K+ L I+K++++T Q++ F  +N   V+F E +  +FKHLFL  +  + E   Y  S     +Y  ++ + +  +A+  Y++L +  +G  GYG    N+  + +C  +Y+   + PSN T   DN +   C++L          LS    ++ N+  F + F  L++ EI+F L+ I L++    ++PDC+ F   IIF+N  H+G++ +  D +     C    I  S       + V D   +     SLILC RSI+   +  K+  NFFL +    + +  +  F +  Y+L+   D++ I GSI+K+ +       K   N  +C+ FLG    L ++ ++RY  +++  ++LI T++A+   +LRF  C+ ++Y+ ++  GWI+LGPYH KF    +   CLFSL+NGDDM+ T
Sbjct:   10 EECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDED-DYSCS-----VYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDL------QDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQKNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIGSILKMEIKA-----KNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFAT 440          
BLAST of Mucolipin-3 vs. Ensembl Human
Match: MCOLN2 (mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357])

HSP 1 Score: 216.853 bits (551), Expect = 2.693e-61
Identity = 139/459 (30.28%), Postives = 247/459 (53.81%), Query Frame = 3
Query:   72 NEEVHEFTEDQER-MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS--SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTP-QILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            N   H  +E +E  +R +L+++FM+P EK++A+  +P K+ L I+K++++T Q++ F  +N   V+F E +  +FKHLFL  +  + E           ++Y  ++ + +  +A+  Y++L +  +G  GYG    N+  + +C  +Y+   + PSN T   DN +   C++L          LS    ++ N+  F + F  L++ EI+F L+ I L++    ++PDC+ F   IIF+N  H+G++ +  D +     C    I  S       + V D   +     SLILC RSI+   +  K+  NFFL +    + +  +  F +  Y+L+   D++ I GSI+K+ +       K   N  +C+ FLG    L ++ ++RY  +++  ++LI T++A+   +LRF  C+ ++Y+ ++  GWI+LGPYH KF    +   CLFSL+NGDDM+ T
Sbjct:   27 NAMAHRDSEMKEECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDE------DDYSCSVYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDL------QDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQKNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFINGWYVLVIISDLMTIIGSILKMEIKA-----KNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFAT 468          
BLAST of Mucolipin-3 vs. Ensembl Human
Match: MCOLN3 (mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358])

HSP 1 Score: 181.8 bits (460), Expect = 3.505e-49
Identity = 112/344 (32.56%), Postives = 185/344 (53.78%), Query Frame = 3
Query:  417 NYYKLNEEAIGPYGY--GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKP-FPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
             Y +L   ++G + Y    + +  M +C  +Y+  +I P N T+  D  I T C  ++P  P    T          N  N +++F+ L+  E+ F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD +IS   C    +      NT  + + D   +    VSLILC RS+IR  +  ++  NFFL     ++S + +  F +  Y++I   DIL I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F+ K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFR+      CLFSL+NGDDM+ T
Sbjct:   76 QYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAE-------NKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKMEIQA-----KSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFAT 407          
BLAST of Mucolipin-3 vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.43 bits (485), Expect = 3.098e-52
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 3
Query:   42 TITMQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLC------------ITYYEISDISPSNATYKFD----------NHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEI-PCTPQILPS-GDYINTIL-KVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            TI  Q  +E  +  H   E  ER+RR+L++ FMNP EKW+ +  LP K++L ++K++ +T+Q+I+F+E     V F E + T  +H FL  W    + L YPP+ G +++Y         S+ + +YY +  ++   + Y   + P  +L             +    IS+++ +N TY FD          N   T   ++    +     L+     FL  +   I+       +  F LR+I       D+ P+C++  + I F+N+ H GQV V L   +S +  C  +I+   G   +T+L    D   L    +SLILCCR++I+ +    K  ++F   +   I+   +  F ++ Y++I   D LII G++ K+++     D+      ++ + FLG+G  L Y+ +LRYF F+ + +IL+ T+K ++  ++RF  C+I+LY  F + GW+I+GPY +KFRT   S   LFSL+NGDDM+ T
Sbjct:   28 TINFQEIME--DLPHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAVRDILATRGITFLPEDALKIS-----TVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGTVAKISIEFQDFDNSL---FTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFAT 507          
BLAST of Mucolipin-3 vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.43 bits (485), Expect = 3.098e-52
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 3
Query:   42 TITMQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLC------------ITYYEISDISPSNATYKFD----------NHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEI-PCTPQILPS-GDYINTIL-KVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            TI  Q  +E  +  H   E  ER+RR+L++ FMNP EKW+ +  LP K++L ++K++ +T+Q+I+F+E     V F E + T  +H FL  W    + L YPP+ G +++Y         S+ + +YY +  ++   + Y   + P  +L             +    IS+++ +N TY FD          N   T   ++    +     L+     FL  +   I+       +  F LR+I       D+ P+C++  + I F+N+ H GQV V L   +S +  C  +I+   G   +T+L    D   L    +SLILCCR++I+ +    K  ++F   +   I+   +  F ++ Y++I   D LII G++ K+++     D+      ++ + FLG+G  L Y+ +LRYF F+ + +IL+ T+K ++  ++RF  C+I+LY  F + GW+I+GPY +KFRT   S   LFSL+NGDDM+ T
Sbjct:   28 TINFQEIME--DLPHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAVRDILATRGITFLPEDALKIS-----TVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGTVAKISIEFQDFDNSL---FTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFAT 507          
BLAST of Mucolipin-3 vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.43 bits (485), Expect = 4.565e-52
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 3
Query:   42 TITMQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLC------------ITYYEISDISPSNATYKFD----------NHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEI-PCTPQILPS-GDYINTIL-KVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            TI  Q  +E  +  H   E  ER+RR+L++ FMNP EKW+ +  LP K++L ++K++ +T+Q+I+F+E     V F E + T  +H FL  W    + L YPP+ G +++Y         S+ + +YY +  ++   + Y   + P  +L             +    IS+++ +N TY FD          N   T   ++    +     L+     FL  +   I+       +  F LR+I       D+ P+C++  + I F+N+ H GQV V L   +S +  C  +I+   G   +T+L    D   L    +SLILCCR++I+ +    K  ++F   +   I+   +  F ++ Y++I   D LII G++ K+++     D+      ++ + FLG+G  L Y+ +LRYF F+ + +IL+ T+K ++  ++RF  C+I+LY  F + GW+I+GPY +KFRT   S   LFSL+NGDDM+ T
Sbjct:   50 TINFQEIME--DLPHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAVRDILATRGITFLPEDALKIS-----TVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGTVAKISIEFQDFDNSL---FTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFAT 529          
BLAST of Mucolipin-3 vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 4.796e-52
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 3
Query:   42 TITMQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLC------------ITYYEISDISPSNATYKFD----------NHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEI-PCTPQILPS-GDYINTIL-KVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            TI  Q  +E  +  H   E  ER+RR+L++ FMNP EKW+ +  LP K++L ++K++ +T+Q+I+F+E     V F E + T  +H FL  W    + L YPP+ G +++Y         S+ + +YY +  ++   + Y   + P  +L             +    IS+++ +N TY FD          N   T   ++    +     L+     FL  +   I+       +  F LR+I       D+ P+C++  + I F+N+ H GQV V L   +S +  C  +I+   G   +T+L    D   L    +SLILCCR++I+ +    K  ++F   +   I+   +  F ++ Y++I   D LII G++ K+++     D+      ++ + FLG+G  L Y+ +LRYF F+ + +IL+ T+K ++  ++RF  C+I+LY  F + GW+I+GPY +KFRT   S   LFSL+NGDDM+ T
Sbjct:   28 TINFQEIME--DLPHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAVRDILATRGITFLPEDALKIS-----TVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGTVAKISIEFQDFDNSL---FTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFAT 507          
BLAST of Mucolipin-3 vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 4.796e-52
Identity = 149/490 (30.41%), Postives = 253/490 (51.63%), Query Frame = 3
Query:   42 TITMQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLC------------ITYYEISDISPSNATYKFD----------NHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEI-PCTPQILPS-GDYINTIL-KVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            TI  Q  +E  +  H   E  ER+RR+L++ FMNP EKW+ +  LP K++L ++K++ +T+Q+I+F+E     V F E + T  +H FL  W    + L YPP+ G +++Y         S+ + +YY +  ++   + Y   + P  +L             +    IS+++ +N TY FD          N   T   ++    +     L+     FL  +   I+       +  F LR+I       D+ P+C++  + I F+N+ H GQV V L   +S +  C  +I+   G   +T+L    D   L    +SLILCCR++I+ +    K  ++F   +   I+   +  F ++ Y++I   D LII G++ K+++     D+      ++ + FLG+G  L Y+ +LRYF F+ + +IL+ T+K ++  ++RF  C+I+LY  F + GW+I+GPY +KFRT   S   LFSL+NGDDM+ T
Sbjct:   28 TINFQEIME--DLPHHERETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAVRDILATRGITFLPEDALKIS-----TVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLDFLNLWYVMIVVNDALIIIGTVAKISIEFQDFDNSL---FTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFAT 507          
BLAST of Mucolipin-3 vs. Ensembl Fly
Match: Trpml (gene:FBgn0262516 transcript:FBtr0074952)

HSP 1 Score: 286.189 bits (731), Expect = 1.410e-86
Identity = 167/476 (35.08%), Postives = 268/476 (56.30%), Query Frame = 3
Query:   48 TMQSCIETNEEVHEF------TEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELD-KIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC--TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGS--VKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            T    ++  EE  EF      +  +ERMRR L++ FMNP EKWQAK   P K ++ I+K+ ++T+Q+ +F+ +    +++   ++ +F HLFL  W SS E   YPP+ GPFA+Y   EFF    YA+  Y  ++  +IGPY Y + N   P + LC+  Y    I   N +Y FD HI+  C  L P  N T  G    V+ +L   +  +NF  L+ A++ F ++++  K+       PDCF+FDI I FNN +H+GQ++++LD E + + C      +   ++ + +  V++   L   ++S  LC R++ R Y       NFF  + G ++S + R  F +  Y++I   D+L+I GS +K  + G   V D         C+ FLGIG  L +  +LRY  F++  +++I T+K A+  +LRF + ++++Y  F   GW+ILGPYH+KFR+  ++  CLF+L+NGDDM+ T
Sbjct:   68 TAPPSVDGREEQPEFPGSSAASYQEERMRRKLQFFFMNPIEKWQAKRKFPYKFVVQIVKIFLVTMQLCLFAHSRYNHINYTGDNRFAFSHLFLRGWDSSREVESYPPAVGPFALYLKSEFFDTVQYAVNGYANVSR-SIGPYDYPTPNNTMPPLKLCLQNYREGTIFGFNESYIFDPHIDEVCERLPP--NVTTIG----VENYLRQRDVEVNFASLVSAQLTFKIKTVNFKANGGPLSAPDCFRFDISITFNNRDHDGQMLLSLDAEATRLKCHGATDFISDANFDSMLRSVLNIFVLLTCALSFALCTRALWRAYLLRCTTVNFFRSQFGKELSFDGRLEFVNFWYIMIIFNDVLLIIGSALKEQIEGRYLVVD-----QWDTCSLFLGIGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKILRFLIAALLIYAGFVFCGWLILGPYHMKFRSLATTSECLFALINGDDMFAT 531          
BLAST of Mucolipin-3 vs. Ensembl Fly
Match: CG42638 (gene:FBgn0261361 transcript:FBtr0302283)

HSP 1 Score: 286.189 bits (731), Expect = 1.410e-86
Identity = 167/476 (35.08%), Postives = 268/476 (56.30%), Query Frame = 3
Query:   48 TMQSCIETNEEVHEF------TEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELD-KIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC--TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGS--VKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            T    ++  EE  EF      +  +ERMRR L++ FMNP EKWQAK   P K ++ I+K+ ++T+Q+ +F+ +    +++   ++ +F HLFL  W SS E   YPP+ GPFA+Y   EFF    YA+  Y  ++  +IGPY Y + N   P + LC+  Y    I   N +Y FD HI+  C  L P  N T  G    V+ +L   +  +NF  L+ A++ F ++++  K+       PDCF+FDI I FNN +H+GQ++++LD E + + C      +   ++ + +  V++   L   ++S  LC R++ R Y       NFF  + G ++S + R  F +  Y++I   D+L+I GS +K  + G   V D         C+ FLGIG  L +  +LRY  F++  +++I T+K A+  +LRF + ++++Y  F   GW+ILGPYH+KFR+  ++  CLF+L+NGDDM+ T
Sbjct:   68 TAPPSVDGREEQPEFPGSSAASYQEERMRRKLQFFFMNPIEKWQAKRKFPYKFVVQIVKIFLVTMQLCLFAHSRYNHINYTGDNRFAFSHLFLRGWDSSREVESYPPAVGPFALYLKSEFFDTVQYAVNGYANVSR-SIGPYDYPTPNNTMPPLKLCLQNYREGTIFGFNESYIFDPHIDEVCERLPP--NVTTIG----VENYLRQRDVEVNFASLVSAQLTFKIKTVNFKANGGPLSAPDCFRFDISITFNNRDHDGQMLLSLDAEATRLKCHGATDFISDANFDSMLRSVLNIFVLLTCALSFALCTRALWRAYLLRCTTVNFFRSQFGKELSFDGRLEFVNFWYIMIIFNDVLLIIGSALKEQIEGRYLVVD-----QWDTCSLFLGIGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKILRFLIAALLIYAGFVFCGWLILGPYHMKFRSLATTSECLFALINGDDMFAT 531          
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Match: mcoln1a (mucolipin 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2704])

HSP 1 Score: 248.44 bits (633), Expect = 4.813e-73
Identity = 182/520 (35.00%), Postives = 286/520 (55.00%), Query Frame = 3
Query:   99 DQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYG---SSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPF--PNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC-TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQES 1637
            ++E +RR L+Y FM+P EK+QAKG  P K+IL I+K++++T Q+++F  +N   V F E +  SFKHLFL ++  S + L         A+Y   + +    YA+E Y  L +  +G Y Y      N   + LC  YY+   I P+N T+  D  + T CI + P   P    TG  Y         NF++ F+ LI   I F L++I L++   ++IPDC+ F I I+ +N  H+G+V ++LD + S   C  P +  SG   +    + D         SL+LC RSIIR      +   +F   +   +    R  F +  Y+L+   D+L I GSIIK+ +     + K   +   C   LG    L ++ ++RY TF++K +ILI T++AA   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+  S   CLFSL+NGDDM+VT S + ESS ++++FSQ+++Y F  LFI++VL+L + +I  AY  ++HQ      + +   FI  C ++
Sbjct:   53 EEEELRRKLKYFFMSPCEKYQAKGRKPFKLILQILKIVIVTAQLVLFGLSNEMAVMFKEENTASFKHLFLKDYADSDDAL---------AVYTQSDVYDHMFYAVEQYLSLADTTVGQYAYVYGVGVNGSALSLCQQYYKKGRIDPANDTFIIDPLVVTDCIGVNPLSTPTAAGTGRDY--------RNFTLKFHKLINVTIQFQLKAINLQTIIHNEIPDCYTFLITILLDNKAHSGKVRISLDNKASIKECRDPSV--SGHPDSNARVLFDLAVALVCVFSLLLCGRSIIRGIILQNEFVKYFKTSLKRHVCWGDRMEFINGWYILLIISDLLTITGSIIKIGI-----ELKNLSSYDECGILLGTSTLLVWVGVIRYLTFFQKYNILIVTLQAAFPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSSVSECLFSLINGDDMFVTFSGMQESSMLVWVFSQVYLYTFISLFIYMVLSLFIALITGAYETIKHQTQEPIHITDLHAFIAECTDT 548          
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Match: mcoln1b (mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1])

HSP 1 Score: 236.113 bits (601), Expect = 1.248e-68
Identity = 170/527 (32.26%), Postives = 290/527 (55.03%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKP---EMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC-TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKS 1661
            +++E +RR L+Y FM+P +K+ AKG  P K+ L ++K+I++TVQ+++F  +N   V+F E +  SFKHLFL ++           S  P  ++   +      YA++ Y  L++ ++G Y Y     P    + LC  Y++   I P N T+  D H+ T C  + P      +  S  V++     N ++NF  L+   I F L++I +++   ++IPDC+ F I I+F+N  H+G+V ++L  E     C  P +   GD    +    D L      +SL+LC RSI++      ++  +F   +G  +S   R  F +  Y+L+   D+L I  S IK+ +     + K   +  VC+  +G    L ++ ++RYF+F++K +ILI T++AA   ++RF  C+  +YM +   GWI+LGPYH KFR+  +   CLFSL+NGDDM+ T S + +S  ++++FSQ+++Y F  LFI++VL+L + +I  AY+ +  Q  +  Q+     FI  C ++  S  ++S
Sbjct:   49 DEEEALRRKLKYFFMSPCDKYHAKGRKPYKLALQLLKIIIVTVQLVMFGLSNQMVVAFKEENTDSFKHLFLRDYVED--------SQEPLCLHTQKQVHEHIRYAIDQYLILSQTSVGRYAYVPGVGPNSSALYLCQRYFKKGTIDPVNDTFDIDPHVITDCFGVNP------SDPSSPVQDLY--PNITLNFQKLVNVTIEFQLKAINIQTIINNEIPDCYTFSITILFDNKAHSGKVKLSLLNEAFIKECRDPNVSGHGDSYARV--AFDVLVAVVCGLSLVLCGRSILKGIMLQHELVCYFRVSLGRSVSLGDRLEFINGWYLLLIISDVLTIIASFIKIAI-----ETKNLSSYDVCSILMGTSTLLVWVGVIRYFSFFQKYNILIVTLRAAFPNVIRFCCCAAAIYMGYCFCGWIVLGPYHAKFRSLSTVSECLFSLINGDDMFATFSEVEQSGTLVWVFSQIYLYTFISLFIYMVLSLFIALITGAYDTITQQTQDVPQVSELHRFIAECTDTPTSGNFRS 552          
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Match: mcoln3a (mucolipin 3a [Source:ZFIN;Acc:ZDB-GENE-121116-4])

HSP 1 Score: 224.557 bits (571), Expect = 1.682e-64
Identity = 141/449 (31.40%), Postives = 241/449 (53.67%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSN--KPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            E  E +RR L+Y FM+P +K+  +G +P KM+L I+K++++TVQ++ F  +N   V+F E +  +FKH FL N         Y  S+  +A+Y   E      Y +  Y +L    IG       +     + LC   Y  + + PSN T++ D H+ T C+ + P    T   L        N+ N +++F  L+   I   +++I +++    ++PDC+ F I I+F+N  H+GQ+ ++L   +    C    +   +    ++ V D L + F  +SLILC RS+   +    + + F   +    +S ++R  F +  Y+LI   D L I GSI+K+ +       K+  +  VC+  LG    L ++ ++RY +F++K  ILI T+KAA   ++RFS+C++++Y+++   GWI+LGP+H  FRTF     CLFS++NGD++Y T
Sbjct:   18 ECVESLRRKLKYFFMSPCQKYSTRGRIPWKMMLQILKIVIITVQLVSFGLSNEMMVTFKEENLIAFKHFFLKN---------YKDSNKHYALYTKHEVHDHILYTIRRYLQLQNLTIGNQALEMIDGLATPLSLCQQLYRHARVVPSNETFEIDPHVETECVSVYPLSPITTDSLE-------NSLNLTLDFQRLLAVNIYLKIKAINIQTVRHQELPDCYDFSINIMFDNRAHSGQIKISLSSGVQINVCKDWNISGSNSHFALIVVFDCLIICFCLLSLILCTRSVHTGFLLQTEYRRFMSSQHSKSVSWSERLEFINGWYILIIISDALTIAGSILKICI-----QSKELTSYDVCSILLGTATMLVWIGVMRYLSFFQKYYILILTLKAALPNVIRFSICAVMIYLSYCFCGWIVLGPHHENFRTFSRVAGCLFSMINGDEIYST 445          
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Match: MCOLN3 (mucolipin 3b [Source:NCBI gene;Acc:100001113])

HSP 1 Score: 218.779 bits (556), Expect = 2.966e-62
Identity = 174/559 (31.13%), Postives = 303/559 (54.20%), Query Frame = 3
Query:  105 ERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCI--TYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINTILKVV-DFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTRE 1769
            E  RR L+Y FMNP +K++A+   P K+ L I+K+ V+TVQ++ F  +N   V F E +  +F+HLFL N+  S        ++  +AIY   + ++  ++ ++ +  L    +G + Y         LCI   +Y    ISP+N T+  D+ ++  C  + P    T + L           NF+++F  L+   +NFTL++I L++ E  ++PDC+ F+I I F+N  H+G+++V LD E+    C+   +      N  + V+ D + +   S SL+LC RS+       K+   F L      +S ++R  F +  Y+LI   D+L I GS++K+     V   K   +  +C+  LG G  L ++ +LRY  + +K +ILI T++ A   ++RF+ C+ ++Y+ +   GWI+LGPYH KFRT  +    LFSL+NGDDM+ T   + + S ++++FS+L++Y F  LFI++VL+L +T+I + Y+ ++HQ L+ + + +   F+  C++   S  +        S+ K  S + S       CCC  + +++ E
Sbjct:   30 EAFRRKLKYFFMNPCDKYKARQRKPWKLFLQIVKIAVVTVQLVSFGLSNQMVVQFKEENLLTFRHLFLKNYSES--------NTNTYAIYTQLDVYTHITHIVQQFLMLPSITVGNHEYEQEGDVYTPLCICQQFYHNGSISPANETFDIDSRVDQECSLIYPQDPFTESPL-----------NFTLHFERLLSVTVNFTLKAINLETVEYHELPDCYVFNIMIQFDNKAHSGRILVDLDNEVHIYECSDWSMTGASARNMYMMVLFDAVVILILSTSLLLCIRSVKAGVLLQKEYSEFSLRRYRKCVSLSERLEFINGWYLLIIVSDVLTISGSVLKI-----VIQLKAVASYDLCSILLGTGTMLVWIGVLRYMGYLKKYNILIITLRVALPNVIRFTCCAAMIYLGYCFCGWIVLGPYHTKFRTLNTVSESLFSLINGDDMFATFKNMQQKSFVVWLFSRLYLYTFVSLFIYMVLSLFITLITDTYDTIKHQQLDGEPVSDLQAFVLQCKDLPDSGEF--------SVEKTNSIS-STGGGKLMCCCSHRSSDSDE 555          
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Match: MCOLN3 (mucolipin 3b [Source:NCBI gene;Acc:100001113])

HSP 1 Score: 218.009 bits (554), Expect = 1.156e-61
Identity = 175/560 (31.25%), Postives = 304/560 (54.29%), Query Frame = 3
Query:  105 ERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCIT--YYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINTILKVV-DFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREI 1772
            E  RR L+Y FMNP +K++A+   P K+ L I+K+ V+TVQ++ F  +N   V F E +  +F+HLFL N+  S        ++  +AIY   + ++  ++ ++ +  L    +G + Y         LCI   +Y    ISP+N T+  D+ ++  C  + P    T + L           NF+++F  L+   +NFTL++I L++ E  ++PDC+ F+I I F+N  H+G+++V LD E+    C+   +      N  + V+ D + +   S SL+LC RS+       K+   F L      +S ++R  F +  Y+LI   D+L I GS++K+     V   K   +  +C+  LG G  L ++ +LRY  + +K +ILI T++ A   ++RF+ C+ ++Y+ +   GWI+LGPYH KFRT  +    LFSL+NGDDM+ T   + + S ++++FS+L++Y F  LFI++VL+L +T+I + Y+ ++HQ L+ + + +   F+  C++   S  +        S+ K  S + S       CCC  + ++T+ I
Sbjct:   30 EAFRRKLKYFFMNPCDKYKARQRKPWKLFLQIVKIAVVTVQLVSFGLSNQMVVQFKEENLLTFRHLFLKNYSES--------NTNTYAIYTQLDVYTHITHIVQQFLMLPSITVGNHEYEQEGDVYTPLCICQQFYHNGSISPANETFDIDSRVDQECSLIYPQDPFTESPL-----------NFTLHFERLLSVTVNFTLKAINLETVEYHELPDCYVFNIMIQFDNKAHSGRILVDLDNEVHIYECSDWSMTGASARNMYMMVLFDAVVILILSTSLLLCIRSVKAGVLLQKEYSEFSLRRYRKCVSLSERLEFINGWYLLIIVSDVLTISGSVLKI-----VIQLKAVASYDLCSILLGTGTMLVWIGVLRYMGYLKKYNILIITLRVALPNVIRFTCCAAMIYLGYCFCGWIVLGPYHTKFRTLNTVSESLFSLINGDDMFATFKNMQQKSFVVWLFSRLYLYTFVSLFIYMVLSLFITLITDTYDTIKHQQLDGEPVSDLQAFVLQCKDLPDSGEF--------SVEKTNSIS-STGGGKLMCCCSHRYSHTQMI 556          
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:NCBI gene;Acc:496811])

HSP 1 Score: 244.588 bits (623), Expect = 1.358e-71
Identity = 187/572 (32.69%), Postives = 307/572 (53.67%), Query Frame = 3
Query:   87 EFTEDQE-RMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSS-NKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPF-PNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQ---DLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREIQI 1778
            EF   +E ++RR L+Y FM+P +K++AKG  P K+ L ++K++ +TVQ+I+F  +N   V F E +  +FKHLFL ++    E          +A+Y  ++ +    YA+E Y+ L+ +    Y Y    N+  + +C  YY    I P+N T+  D  + T C+ L P  P+Q     SY        +NF+I F+ LI   + F L++I +++   ++IPDC+ F I I+F+N  H+G+V + LD E     C  P +   GD  N      D L +    +S ILC RSI+R      +   F  +  G+ IS + R  F +  Y+L+   D+L + G+++K+ +     + K   +  VC+  LG    L ++ ++RY +F++K +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFRT      CLFSL+NGDDM+VT S +  SS +++ FSQL++Y F  LFI++VL+L + +I  AY  ++ Q   D +    +  + +I  C++S              S  K RSAN +      FCCC    +   ++ +
Sbjct:   36 EFPSPEEVQLRRRLKYFFMSPCDKFRAKGRKPYKLGLQLLKIMFVTVQLILFGLSNQMVVQFKEENTEAFKHLFLKDYTDDAEK--------TYAVYTQEDVYEHLYYAVEQYFSLSNQTTARYAYTRPFNQSALSVCQQYYRKGHIDPANDTFNIDPQVITNCLFLDPAEPSQ-----SY--------KNFTIKFHKLINLTVQFQLKAINIQTIINNEIPDCYTFTITILFDNKAHSGKVKIQLDNEAKIKECKDPSVYGRGD--NHSRLAFDVLVILSCILSFILCARSIVRGLLLQHEFAQFVHYRHGLTISLSDRLEFVNGWYLLLIISDVLTVSGTVMKIGI-----ESKTFASYDVCSILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRVALPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRTLSMVSECLFSLINGDDMFVTFSEMQNSSYLVWAFSQLYLYTFISLFIYMVLSLFIALITGAYETIKCQNSSDFSGSNDNALYQYIAECKDS-------------PSSGKFRSANSTS--CSMFCCCTQPTHCDEDVAV 564          
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:NCBI gene;Acc:496811])

HSP 1 Score: 243.432 bits (620), Expect = 2.630e-71
Identity = 185/560 (33.04%), Postives = 302/560 (53.93%), Query Frame = 3
Query:   87 EFTEDQE-RMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSS-NKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPF-PNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQ---DLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            EF   +E ++RR L+Y FM+P +K++AKG  P K+ L ++K++ +TVQ+I+F  +N   V F E +  +FKHLFL ++    E          +A+Y  ++ +    YA+E Y+ L+ +    Y Y    N+  + +C  YY    I P+N T+  D  + T C+ L P  P+Q+              +NF+I F+ LI   + F L++I +++   ++IPDC+ F I I+F+N  H+G+V + LD E     C  P +   GD  N      D L +    +S ILC RSI+R      +   F  +  G+ IS + R  F +  Y+L+   D+L + G+++K+ +     + K   +  VC+  LG    L ++ ++RY +F++K +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFRT      CLFSL+NGDDM+VT S +  SS +++ FSQL++Y F  LFI++VL+L + +I  AY  ++ Q   D +    +  + +I  C++S              S  K RSAN +      FCCC
Sbjct:   30 EFPSPEEVQLRRRLKYFFMSPCDKFRAKGRKPYKLGLQLLKIMFVTVQLILFGLSNQMVVQFKEENTEAFKHLFLKDYTDDAEK--------TYAVYTQEDVYEHLYYAVEQYFSLSNQTTARYAYTRPFNQSALSVCQQYYRKGHIDPANDTFNIDPQVITNCLFLDPAEPSQSY-------------KNFTIKFHKLINLTVQFQLKAINIQTIINNEIPDCYTFTITILFDNKAHSGKVKIQLDNEAKIKECKDPSVYGRGD--NHSRLAFDVLVILSCILSFILCARSIVRGLLLQHEFAQFVHYRHGLTISLSDRLEFVNGWYLLLIISDVLTVSGTVMKIGI-----ESKTFASYDVCSILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRVALPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRTLSMVSECLFSLINGDDMFVTFSEMQNSSYLVWAFSQLYLYTFISLFIYMVLSLFIALITGAYETIKCQNSSDFSGSNDNALYQYIAECKDS-------------PSSGKFRSANSTS--CSMFCCC 546          
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 231.876 bits (590), Expect = 3.357e-67
Identity = 144/464 (31.03%), Postives = 254/464 (54.74%), Query Frame = 3
Query:   54 QSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPE--MDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNK-RRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            + C  T+E + E     +++RR L++ FMNP EK++A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  ++   +          +AIY  ++  +  ++ ++ Y +L   ++G + Y S+ K +  M LC  YY+   I P N T++ D  I+T C  + P     +T  S +        N +++F  L+  EI F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD ++    C    +      NT  + + D   +     S+ LC RS+++     K+  NFF       +S+  R  F +  Y++I   D+L I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F++K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+ T
Sbjct:   28 KQCPMTDELLME-----DQLRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDGHD--------DTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDP-----STLCSNDTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQKNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNGWYIMIIISDVLSIIGSILKMEIQA-----KSLTSYDVCSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTT 468          
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 231.106 bits (588), Expect = 3.524e-67
Identity = 140/448 (31.25%), Postives = 248/448 (55.36%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPE--MDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNK-RRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            ++++RR L++ FMNP EK++A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  ++   +          +AIY  ++  +  ++ ++ Y +L   ++G + Y S+ K +  M LC  YY+   I P N T++ D  I+T C  + P     +T  S +        N +++F  L+  EI F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD ++    C    +      NT  + + D   +     S+ LC RS+++     K+  NFF       +S+  R  F +  Y++I   D+L I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F++K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+ T
Sbjct:   21 EDQLRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDGHD--------DTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDP-----STLCSNDTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQKNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNGWYIMIIISDVLSIIGSILKMEIQA-----KSLTSYDVCSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTT 450          
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 231.876 bits (590), Expect = 3.561e-67
Identity = 144/464 (31.03%), Postives = 254/464 (54.74%), Query Frame = 3
Query:   54 QSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPE--MDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNK-RRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            + C  T+E + E     +++RR L++ FMNP EK++A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  ++   +          +AIY  ++  +  ++ ++ Y +L   ++G + Y S+ K +  M LC  YY+   I P N T++ D  I+T C  + P     +T  S +        N +++F  L+  EI F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD ++    C    +      NT  + + D   +     S+ LC RS+++     K+  NFF       +S+  R  F +  Y++I   D+L I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F++K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+ T
Sbjct:   23 KQCPMTDELLME-----DQLRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDGHD--------DTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDP-----STLCSNDTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQKNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNGWYIMIIISDVLSIIGSILKMEIQA-----KSLTSYDVCSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTT 463          
BLAST of Mucolipin-3 vs. Ensembl Mouse
Match: Mcoln1 (mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498])

HSP 1 Score: 237.269 bits (604), Expect = 8.862e-69
Identity = 179/563 (31.79%), Postives = 302/563 (53.64%), Query Frame = 3
Query:   99 DQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS------SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNN----ENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISN-KRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXX---XQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            ++E +RR L+Y FM+P +K++AKG  P K++L ++K++V+TVQ+I+F  +N   V+F E +  +F+HLFLL +           S   FA Y  ++ + A  YA++ Y  L E ++G Y Y        +N   + LC  YY    + P+N T+  D  + T CI++ P     +   S ++ +FL+     +N ++ F+ LI   I+F L++I L+S   ++IPDC+ F I I F+N  H+G++ + L+ +     C  P +   GD  N+   + D + +   S+S +LC RS++R +    +   F     G +IS  +R  F +  Y+L+   D+L I G+++K+ +     + K   +  VC+  LG    L ++ ++RY TF+ K +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT + +        +    SQL++Y F  LFI++VL+L + +I  AY+ ++H      +      +I  CQ+S  S  ++         R   SA         FCCC
Sbjct:   37 EEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDG--------SDDTFAAYTQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFDIDPRVVTDCIQVDPPDRPPDI-PSEDL-DFLDGSASYKNLTLKFHKLINVTIHFQLKTINLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSVSRHGD--NSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVTSDVLTISGTVMKIGI-----EAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAYIEQCQDSPTSGKFR---------RGSGSA------CSLFCCC 567          
BLAST of Mucolipin-3 vs. Ensembl Mouse
Match: Mcoln3 (mucolipin 3 [Source:MGI Symbol;Acc:MGI:1890500])

HSP 1 Score: 235.728 bits (600), Expect = 1.685e-68
Identity = 141/448 (31.47%), Postives = 244/448 (54.46%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY--GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +++MRR L++ FMNP EK+ A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  +    +          +A+Y   E +    +A+  Y +L   ++G + Y    + +  M +C  +Y    I P N T+  D  + T C  ++P    ++ G         N  N S++F+ L+  E+ F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD +IS   C    +      NT  + + D   +     SL+LC RS+IR  +  ++  NFFL     ++S + +  F +  Y++I   DIL I GS++K+ +       K   +  VC+  LG    L +L ++RY  F+ K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFR+      CLFSL+NGDDM+ T
Sbjct:   35 EDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSEVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPEVETECFLVEP-DEASHLGTPGE-----NKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQKNTHYMMIFDAFVILTCLASLVLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFINGWYIMIIISDILTIVGSVLKMEIQA-----KSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAAMIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFST 463          
BLAST of Mucolipin-3 vs. Ensembl Mouse
Match: Mcoln2 (mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529])

HSP 1 Score: 207.994 bits (528), Expect = 2.046e-58
Identity = 138/448 (30.80%), Postives = 240/448 (53.57%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSS--NKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +E +R +L+++FM+P EK++A+  +P K+ L I+K++++T Q++ F  +N   V+F E +  +FKHLFL  + S  +   Y  S     IY  +  + +  +A++ Y  L   ++   GYG S  N+  + +C  +Y+   +  SN T   D+ I T CI L          L+   +++     F ++F  L++ +I+F L+ I L++    +IPDC+ F   I F+N  H+G++ + L+ E +   C    +      +T  L V D   +     SLILC RSI+   +  K+  NFFL +    +    +  F +  Y+L+   D++ I GSI+K+ +       KK  N  VC+  LG      ++ ++RY  +++  ++LI T++A+   +LRF  C+ ++Y+ ++  GWI+LGPYH KF        CLFSL+NGDDM+ T
Sbjct:   10 EECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGF-SGVDEDDYSCS-----IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETLNIDSDIETDCIHLDL------QVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREIPDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMICLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIGSILKMEIKA-----KKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFAT 440          
BLAST of Mucolipin-3 vs. Ensembl Mouse
Match: Mcoln2 (mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529])

HSP 1 Score: 207.608 bits (527), Expect = 3.959e-58
Identity = 138/448 (30.80%), Postives = 240/448 (53.57%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSS--NKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +E +R +L+++FM+P EK++A+  +P K+ L I+K++++T Q++ F  +N   V+F E +  +FKHLFL  + S  +   Y  S     IY  +  + +  +A++ Y  L   ++   GYG S  N+  + +C  +Y+   +  SN T   D+ I T CI L          L+   +++     F ++F  L++ +I+F L+ I L++    +IPDC+ F   I F+N  H+G++ + L+ E +   C    +      +T  L V D   +     SLILC RSI+   +  K+  NFFL +    +    +  F +  Y+L+   D++ I GSI+K+ +       KK  N  VC+  LG      ++ ++RY  +++  ++LI T++A+   +LRF  C+ ++Y+ ++  GWI+LGPYH KF        CLFSL+NGDDM+ T
Sbjct:   38 EECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGF-SGVDEDDYSCS-----IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETLNIDSDIETDCIHLDL------QVLTTEPEDWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREIPDCYLFQNTITFDNTAHSGKIKIYLNSEANIEECKNMNISGSTQRSTHYLLVFDVFVIMICLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNGWYVLVTISDLMTIIGSILKMEIKA-----KKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFAT 468          
BLAST of Mucolipin-3 vs. Ensembl Mouse
Match: Mcoln1 (mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498])

HSP 1 Score: 48.9062 bits (115), Expect = 1.491e-6
Identity = 20/31 (64.52%), Postives = 24/31 (77.42%), Query Frame = 3
Query: 1344 LGPYHLKFRTFISSVACLFSLMNGDDMYVTL 1436
            LGPYH+KFR+      CLFSL+NGDDM+VT 
Sbjct:    1 LGPYHVKFRSLSMVSECLFSLINGDDMFVTF 31          
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Match: sp|Q99J21|MCLN1_MOUSE (Mucolipin-1 OS=Mus musculus OX=10090 GN=Mcoln1 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 6.199e-68
Identity = 179/563 (31.79%), Postives = 302/563 (53.64%), Query Frame = 3
Query:   99 DQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS------SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNN----ENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISN-KRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXX---XQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            ++E +RR L+Y FM+P +K++AKG  P K++L ++K++V+TVQ+I+F  +N   V+F E +  +F+HLFLL +           S   FA Y  ++ + A  YA++ Y  L E ++G Y Y        +N   + LC  YY    + P+N T+  D  + T CI++ P     +   S ++ +FL+     +N ++ F+ LI   I+F L++I L+S   ++IPDC+ F I I F+N  H+G++ + L+ +     C  P +   GD  N+   + D + +   S+S +LC RS++R +    +   F     G +IS  +R  F +  Y+L+   D+L I G+++K+ +     + K   +  VC+  LG    L ++ ++RY TF+ K +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT + +        +    SQL++Y F  LFI++VL+L + +I  AY+ ++H      +      +I  CQ+S  S  ++         R   SA         FCCC
Sbjct:   37 EEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDG--------SDDTFAAYTQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFDIDPRVVTDCIQVDPPDRPPDI-PSEDL-DFLDGSASYKNLTLKFHKLINVTIHFQLKTINLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTHIQECKHPSVSRHGD--NSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNGWYILLVTSDVLTISGTVMKIGI-----EAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGHSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGTGTEKSELQAYIEQCQDSPTSGKFR---------RGSGSA------CSLFCCC 567          
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Match: sp|Q8R4F0|MCLN3_MOUSE (Mucolipin-3 OS=Mus musculus OX=10090 GN=Mcoln3 PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.178e-67
Identity = 141/448 (31.47%), Postives = 244/448 (54.46%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY--GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +++MRR L++ FMNP EK+ A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  +    +          +A+Y   E +    +A+  Y +L   ++G + Y    + +  M +C  +Y    I P N T+  D  + T C  ++P    ++ G         N  N S++F+ L+  E+ F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD +IS   C    +      NT  + + D   +     SL+LC RS+IR  +  ++  NFFL     ++S + +  F +  Y++I   DIL I GS++K+ +       K   +  VC+  LG    L +L ++RY  F+ K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFR+      CLFSL+NGDDM+ T
Sbjct:   35 EDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSEVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPEVETECFLVEP-DEASHLGTPGE-----NKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQKNTHYMMIFDAFVILTCLASLVLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFINGWYIMIIISDILTIVGSVLKMEIQA-----KSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAAMIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFST 463          
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Match: sp|Q9GZU1|MCLN1_HUMAN (Mucolipin-1 OS=Homo sapiens OX=9606 GN=MCOLN1 PE=1 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 2.133e-64
Identity = 144/452 (31.86%), Postives = 252/452 (55.75%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS------SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQT---NTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISN-KRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +RR L+Y FM+P +K++AKG  P K++L ++K++V+TVQ+I+F  +N   V+F E +  +F+HLFLL +           +   FA Y  ++ + A  +A++ Y  L + ++G Y Y        +N   + LC  YY    + P+N T+  D  + T CI++ P        +  L+  ++   + +N ++ F+ L+   I+F L++I L+S   ++IPDC+ F + I F+N  H+G++ ++L+ +     C  P +   GD  N+   + D + +   S+S +LC RS++R +    +   F   + G  IS  +R  F +  Y+L+   D+L I G+I+K+ +     + K   +  VC+  LG    L ++ ++RY TF+   +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT
Sbjct:   41 LRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDG--------ADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTL-LESSSSYKNLTLKFHKLVNVTIHFRLKTINLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGD--NSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGI-----EAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVT 476          
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Match: sp|Q60HE8|MCLN1_MACFA (Mucolipin-1 OS=Macaca fascicularis OX=9541 GN=MCOLN1 PE=2 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 5.588e-63
Identity = 143/454 (31.50%), Postives = 248/454 (54.63%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS------SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQT-----NTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISN-KRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +RR L+Y FM+P +K++AKG  P K++L ++K++V+TVQ+I+F  +N   V+F E +  +F+HLFLL +           +   FA Y  ++ + A  +A++ Y  L + ++G Y Y        +N   + LC  YY    + P+N T+  D  + T CI++ P          +  L      +   +N ++ F+ L+   I+F L++I L+S   ++IPDC+ F + I F+N  H+G++ ++L+ +     C  P +   GD  N+   + D + +   S+S +LC RS++R +    +   F   +    IS  +R  F +  Y+L+   D+L I G+I+K+ +     + K   +  VC+  LG    L ++ ++RY TF+   +ILI T++ A   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT
Sbjct:   41 LRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDG--------ADDTFAAYTQEQLYQAIFHAVDQYLALPDVSLGRYAYVHGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPSPSDDLALLEGSSSY---KNLTLKFHKLVNVTIHFRLKTINLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFRHGD--NSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVRFMWRQRRRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGI-----EAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVT 476          
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Match: sp|Q8TDD5|MCLN3_HUMAN (Mucolipin-3 OS=Homo sapiens OX=9606 GN=MCOLN3 PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 1.278e-62
Identity = 144/449 (32.07%), Postives = 246/449 (54.79%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY--GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKP-FPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +++MRR L++ FMNP EK+ A+G  P K+ + I+K+ ++T+Q+++F  +N   V+F E +  +FKHLFL  +    +          +A+Y   + +    +A+  Y +L   ++G + Y    + +  M +C  +Y+  +I P N T+  D  I T C  ++P  P    T          N  N +++F+ L+  E+ F L++I L++    ++PDC+ F + I F+N  H+G++ ++LD +IS   C    +      NT  + + D   +    VSLILC RS+IR  +  ++  NFFL     ++S + +  F +  Y++I   DIL I GSI+K+ +       K   +  VC+  LG    L +L ++RY  F+ K ++LI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFR+      CLFSL+NGDDM+ T
Sbjct:   35 EDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAE-------NKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQKNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNGWYIMIIISDILTIIGSILKMEIQA-----KSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFAT 463          
BLAST of Mucolipin-3 vs. TrEMBL
Match: A0A077LDL1 (Transient receptor potential ion channel ML a (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPMLa PE=2 SV=1)

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 452/641 (70.51%), Postives = 528/641 (82.37%), Query Frame = 3
Query:   72 NEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSG--DYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPM-NVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREIQIQNHHXXXXXXXXXXXFLNRQLINRXXXXXXXXXKILVNRNRSPRENYGSMCHTHHQSSNFREAINNSFE 1985
            N + HE+TE+QERMRRNLRYHFMNP+EKWQAKGTLPIKMILII KLI+LT+QII+FSENNS EVSF EGSKTSFKHLFL NWQSS+ETLPYPPSSGPFAIY+I EF+SA+S+ALENYYKLNEEAIGPYGYG  NKP M LC+TYY+IS+I P N++Y F N +   CI+L P   Q  +G SYNVK+ L N NF+INFNGL KAEI FTLRSIQLKSYE+DKIPDCF+FD+ I F+NNNHNGQVVV L + ++E+ C  +I      DY+   LKV+D+LAL FS+ SL+LCCRS  RL+KFWKKVK+F+L EMG+DI NKR++FFSISYML+F GDIL+I G+I KL M   V + KK + N SV NYFLGIGVFLGYL LLRYFTFYRKSS+LINTIKAA++PLLRFSLCSIILY+AFSLLGWIILGPYHLKFRTF+SSVACLFSLMNGDDMYVTLSIIS  + +IF+FSQLFIYLFCLLFIFVVLNLILTIIIEAYN+VQHQDL++ QLDNFWGFINACQES KS LY+SDMIYDKS+RK +SANFSRKFVDTFCCCIGKG++T+EI+  N   D   D  +      Q         DDD++ LVNR  + R+NYG+   THH+S    E+ N++ +
Sbjct:    4 NGDNHEYTENQERMRRNLRYHFMNPREKWQAKGTLPIKMILIIFKLIILTIQIILFSENNSNEVSFVEGSKTSFKHLFLENWQSSYETLPYPPSSGPFAIYKIAEFYSAASFALENYYKLNEEAIGPYGYGKYNKPIMTLCVTYYKISEIFPYNSSYIFTNELIRNCIDLMPISFQNKSGYSYNVKDILQNNNFTINFNGLTKAEILFTLRSIQLKSYEIDKIPDCFEFDLNIYFDNNNHNGQVVVDLKVNMTELECNKEIKNPNQKDYVTITLKVIDYLALIFSTFSLVLCCRSHYRLFKFWKKVKSFYLDEMGVDIINKRKYFFSISYMLMFFGDILVISGTIAKLKM--DVLEGKKAITNFSVTNYFLGIGVFLGYLTLLRYFTFYRKSSVLINTIKAATSPLLRFSLCSIILYLAFSLLGWIILGPYHLKFRTFVSSVACLFSLMNGDDMYVTLSIISSENSVIFVFSQLFIYLFCLLFIFVVLNLILTIIIEAYNDVQHQDLSSTQLDNFWGFINACQESSKSPLYRSDMIYDKSLRKLKSANFSRKFVDTFCCCIGKGSHTQEIKENNDERDNGNDFRSMPQYFEQ---------DDDNQSLVNRTNNIRDNYGAFHSTHHRSPTCHESPNDNLD 633          
BLAST of Mucolipin-3 vs. TrEMBL
Match: A0A2J7R4F7 (Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=B7P43_G16161 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.171e-90
Identity = 198/552 (35.87%), Postives = 329/552 (59.60%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQI--LPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            +ERMRR LR+ FMNP EKWQAK  +P K ++ +IK+I++TVQ+ +F+ N  K V++   ++ +F HLFL  W ++ E   YPPS GP A+Y+I +F+    +A+  Y  L   AIGPY Y   +   P   LC+  Y+   I   N +Y F++ I+ RC+ L   PN T    +Y+ K+FL      INF+ L+KAE+ F+L+++  K+      PDC++F+IKI F+N +H+GQ++++LD +   + C   +  +      + +L +++ L +   S+SLILCCR+I R  +      NFF      D+S + +  F ++ Y++I   D+LII GS IK  +      D+     ++C+ FLG G  L +  +LRY  F++  +++I T+K A+  + RF LC++++Y  F+  GW+ILGPYH+KFR+  S+  CLF+L+NGDDMY T SI+S  SP+++ +S++++Y F  L+I+VV++L +++I++AY+ ++          +   F+ AC +   S +Y+++           S++     VD  CCC
Sbjct:   65 EERMRRKLRFFFMNPIEKWQAKHRVPYKFVVQVIKIILVTVQLCLFAHNRYKHVNYTWDNRIAFSHLFLNGWDTTREVNSYPPSVGPLAVYKISKFYETLDFAVIGYANLGN-AIGPYSYTEEDNSMPAPLLCLYQYKEGTIFGFNESYMFNSEIDERCLNLTVEPNVT--AKNYSAKDFLKEHGILINFSSLVKAEMTFSLKTVNFKAAGPITPPDCYKFNIKISFDNEDHDGQMLLSLDADAVRLYCKGDVEYVVDNRLDSILLSILNSLVIVICSISLILCCRAIYRAQQLKLVTINFFQKAYKKDLSAEGQLEFLNMWYIMIIINDVLIILGSGIKEQIERKFAGDQW----NICSVFLGTGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKVARFLLCALLIYAGFTFCGWLILGPYHMKFRSLASTSECLFALINGDDMYATFSIMSFKSPMLWWYSRIYLYCFISLYIYVVISLFISVIMDAYDTIKLYYKCGFPKSDLQAFVAACTDEASSGIYRNE-----------SSSSLGDMVDKLCCC 598          
BLAST of Mucolipin-3 vs. TrEMBL
Match: A0A2J7R4I6 (Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=B7P43_G16161 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 1.699e-90
Identity = 198/552 (35.87%), Postives = 329/552 (59.60%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQI--LPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            +ERMRR LR+ FMNP EKWQAK  +P K ++ +IK+I++TVQ+ +F+ N  K V++   ++ +F HLFL  W ++ E   YPPS GP A+Y+I +F+    +A+  Y  L   AIGPY Y   +   P   LC+  Y+   I   N +Y F++ I+ RC+ L   PN T    +Y+ K+FL      INF+ L+KAE+ F+L+++  K+      PDC++F+IKI F+N +H+GQ++++LD +   + C   +  +      + +L +++ L +   S+SLILCCR+I R  +      NFF      D+S + +  F ++ Y++I   D+LII GS IK  +      D+     ++C+ FLG G  L +  +LRY  F++  +++I T+K A+  + RF LC++++Y  F+  GW+ILGPYH+KFR+  S+  CLF+L+NGDDMY T SI+S  SP+++ +S++++Y F  L+I+VV++L +++I++AY+ ++          +   F+ AC +   S +Y+++           S++     VD  CCC
Sbjct:   65 EERMRRKLRFFFMNPIEKWQAKHRVPYKFVVQVIKIILVTVQLCLFAHNRYKHVNYTWDNRIAFSHLFLNGWDTTREVNSYPPSVGPLAVYKISKFYETLDFAVIGYANLGN-AIGPYSYTEEDNSMPAPLLCLYQYKEGTIFGFNESYMFNSEIDERCLNLTVEPNVTAK--NYSAKDFLKEHGILINFSSLVKAEMTFSLKTVNFKAAGPITPPDCYKFNIKISFDNEDHDGQMLLSLDADAVRLYCKGDVEYVVDNRLDSILLSILNSLVIVICSISLILCCRAIYRAQQLKLVTINFFQKAYKKDLSAEGQLEFLNMWYIMIIINDVLIILGSGIKEQIERKFAGDQW----NICSVFLGTGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKVARFLLCALLIYAGFTFCGWLILGPYHMKFRSLASTSECLFALINGDDMYATFSIMSFKSPMLWWYSRIYLYCFISLYIYVVISLFISVIMDAYDTIKLYYKCGFPKSDLQAFVAACTDEASSGIYRNE-----------SSSSLGDMVDKLCCC 598          
BLAST of Mucolipin-3 vs. TrEMBL
Match: R7UMX7 (PKD_channel domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_136028 PE=4 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 2.041e-89
Identity = 170/455 (37.36%), Postives = 271/455 (59.56%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSN--KPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKP---FPNQTNTGLS-YNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDY--INTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            ++ + +RR L++ FMNP EKW+AK   P KM+L ++K+  +T Q+ +F  +    V F E S  +FKHLFL  WQ SFET+PYPP++G FA+Y I EFFS+ +YAL  Y    + AIG Y + + N  KP + +C T+Y+I  IS  N ++ FD+     C +L P   +   T + ++ Y+V++FL   N SINF+ +I  E+ F+++++ L+       PDCF+F+I I ++N+ HNGQ+ VAL      + C  ++    D   + T++ + D + +  SSVSL LCCRS+ R  +  K+   FF   +   +  +    F +  Y++I   D++ I GS +K+ +     ++K+      C   LG    L +  +LRY  F+ K +ILI T+K ++  +LRF +C+ + Y  F++ GW++LGPYHLKFRT   +  CLF+L+NGD++YVT
Sbjct:   17 QEGDLLRRKLKFFFMNPCEKWRAKRRFPWKMVLQLVKIFFVTAQLALFGFDRGGHVDFLEKSNIAFKHLFLEGWQPSFETMPYPPATGAFAVYTIPEFFSSVNYALRQYNLTEKVAIGTYHFSNPNATKPPVVMCNTFYKIGKISAHNQSFLFDDTKIEDCFQLLPVIEYDESTQSAVAIYDVEKFLLLRNKSINFDSIISVELKFSVKTVHLRKLSKVHTPDCFRFNISIFYDNSLHNGQMTVALSCSQEMLKCNGKVTSDVDEGPLLTLVTIFDAIVILVSSVSLFLCCRSLHRGNQLRKETSVFFEERLNHPLQVHSHFEFVNFWYIMIVINDLMTIVGSGLKIRI-----ENKESAAYEACGVLLGTANLLVWFGVLRYLGFFEKYNILILTMKKSAPNILRFLVCAGVFYFGFTVCGWVVLGPYHLKFRTLSVASECLFALVNGDELYVT 466          
BLAST of Mucolipin-3 vs. TrEMBL
Match: A0A2J7R4H3 (Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=B7P43_G16161 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.669e-89
Identity = 197/552 (35.69%), Postives = 328/552 (59.42%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQI--LPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRR-HFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCC 1742
            +ERMRR LR+ FMNP EKWQAK  +P K ++ +IK+I++TVQ+ +F+ N  K V++   ++ +F HLFL  W ++ E   YPPS GP A+Y+I +F+    +A+  Y  L   AIGPY Y   +   P   LC+  Y+   I   N +Y F++ I+ RC+ L   PN T    +Y+ K+FL      INF+ L+KAE+ F+L+++  K+      PDC++F+IKI F+N +H+GQ++++LD +   + C   +  +      + +L +++ L +   S+SLILCCR+I R  +      NFF      D+S + +  F ++ Y++I   D+LII GS IK  +    +        ++C+ FLG G  L +  +LRY  F++  +++I T+K A+  + RF LC++++Y  F+  GW+ILGPYH+KFR+  S+  CLF+L+NGDDMY T SI+S  SP+++ +S++++Y F  L+I+VV++L +++I++AY+ ++          +   F+ AC +   S +Y+++           S++     VD  CCC
Sbjct:   65 EERMRRKLRFFFMNPIEKWQAKHRVPYKFVVQVIKIILVTVQLCLFAHNRYKHVNYTWDNRIAFSHLFLNGWDTTREVNSYPPSVGPLAVYKISKFYETLDFAVIGYANLGN-AIGPYSYTEEDNSMPAPLLCLYQYKEGTIFGFNESYMFNSEIDERCLNLTVEPNVT--AKNYSAKDFLKEHGILINFSSLVKAEMTFSLKTVNFKAAGPITPPDCYKFNIKISFDNEDHDGQMLLSLDADAVRLYCKGDVEYVVDNRLDSILLSILNSLVIVICSISLILCCRAIYRAQQLKLVTINFFQKAYKKDLSAEGQLEFLNMWYIMIIINDVLIILGSGIKEQIE---RKQFAGDQWNICSVFLGTGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKVARFLLCALLIYAGFTFCGWLILGPYHMKFRSLASTSECLFALINGDDMYATFSIMSFKSPMLWWYSRIYLYCFISLYIYVVISLFISVIMDAYDTIKLYYKCGFPKSDLQAFVAACTDEASSGIYRNE-----------SSSSLGDMVDKLCCC 599          
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Match: mcoln1a (mucolipin-1-like [Source:NCBI gene;Acc:103039116])

HSP 1 Score: 246.128 bits (627), Expect = 4.145e-72
Identity = 181/520 (34.81%), Postives = 286/520 (55.00%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYG---SSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTN-TGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQES 1637
            +++E +RR L+Y FM+P +K+ AKG  P K+ L ++K+I++TVQ+++F  +N   V+F E +  SFKHLFL           Y   S   A+Y   + + +  YA+E Y  L E  +G Y Y      N   + LC  YY    I P+N T+  D HINT C+ + P    +   G  Y        +NF++ F+ LI   I F L++I L++   ++IPDC+ F I I+ +N  H+G+V ++LD E++   C  P +  SG   N      D        +SL+LC RSI R      +   FF   +   +S   R  F +  Y+L+   D+L I GS IK+ +     + K   +  VC   LG    L ++ ++RY +F++K +ILI T++AA   ++RF  C   +Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT S + ESS ++++FSQ+++Y F  LFI++VL+L + +I  AY  ++HQ      + +   FI  C+++
Sbjct:   52 QEEEALRRKLKYFFMSPCDKFHAKGRKPFKLFLQLVKIIIVTVQLVLFGLSNQMVVTFKEENTASFKHLFLKG---------YDGESDALAVYTQSDVYDSIYYAVEQYLALPETTVGRYAYVYGVGVNGSALSLCQQYYRRGWIDPANDTFSIDPHINTDCVGVTPLDTPSGFIGSDY--------KNFTLKFHKLINVTIQFQLKAINLQTIINNEIPDCYTFTITIVLDNKAHSGKVKISLDNEVAIKECKDPSV--SGHAENYARVTFDVAVAVVCLLSLLLCGRSIFRGVLLQHEFVQFFKDTLNRKVSWGDRMEFINGWYILLIISDLLTITGSFIKIGI-----ESKNIASYDVCGILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPNVIRFCCCVAAIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSDMQESSTLVWVFSQVYLYTFISLFIYMVLSLFIALITGAYETIKHQTQEPIHITDLHAFIAECKDT 547          
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Match: mcoln1a (mucolipin-1-like [Source:NCBI gene;Acc:103039116])

HSP 1 Score: 245.743 bits (626), Expect = 4.446e-72
Identity = 181/520 (34.81%), Postives = 286/520 (55.00%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYG---SSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTN-TGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQES 1637
            +++E +RR L+Y FM+P +K+ AKG  P K+ L ++K+I++TVQ+++F  +N   V+F E +  SFKHLFL           Y   S   A+Y   + + +  YA+E Y  L E  +G Y Y      N   + LC  YY    I P+N T+  D HINT C+ + P    +   G  Y        +NF++ F+ LI   I F L++I L++   ++IPDC+ F I I+ +N  H+G+V ++LD E++   C  P +  SG   N      D        +SL+LC RSI R      +   FF   +   +S   R  F +  Y+L+   D+L I GS IK+ +     + K   +  VC   LG    L ++ ++RY +F++K +ILI T++AA   ++RF  C   +Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT S + ESS ++++FSQ+++Y F  LFI++VL+L + +I  AY  ++HQ      + +   FI  C+++
Sbjct:   52 QEEEALRRKLKYFFMSPCDKFHAKGRKPFKLFLQLVKIIIVTVQLVLFGLSNQMVVTFKEENTASFKHLFLKG---------YDGESDALAVYTQSDVYDSIYYAVEQYLALPETTVGRYAYVYGVGVNGSALSLCQQYYRRGWIDPANDTFSIDPHINTDCVGVTPLDTPSGFIGSDY--------KNFTLKFHKLINVTIQFQLKAINLQTIINNEIPDCYTFTITIVLDNKAHSGKVKISLDNEVAIKECKDPSV--SGHAENYARVTFDVAVAVVCLLSLLLCGRSIFRGVLLQHEFVQFFKDTLNRKVSWGDRMEFINGWYILLIISDLLTITGSFIKIGI-----ESKNIASYDVCGILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPNVIRFCCCVAAIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSDMQESSTLVWVFSQVYLYTFISLFIYMVLSLFIALITGAYETIKHQTQEPIHITDLHAFIAECKDT 547          
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Match: MCOLN3 (mucolipin 3 [Source:NCBI gene;Acc:103027252])

HSP 1 Score: 234.572 bits (597), Expect = 2.244e-68
Identity = 172/532 (32.33%), Postives = 293/532 (55.08%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQT--NTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQIL----PSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSD 1664
            E+ E  RR L+Y FMNP EK++A+G  P K++L IIK+ V+T+Q++ F  +N   V+F E +  +FKHLFL ++           S   +A+Y   E ++  S+ +  + +L    +G + +    +    + +C  +Y    ISPSN T++ D  +   C+E+ P    +  +  LS          NF++ F  L++  + FTL++I L++ +  ++PDC+ F+I I FNN  H+G++ V LD ++    C    +    P   Y   +  VV  L       SL+LC RS+    +   +  NFF+   G  +S + R  F +  Y+LI   DIL I GS++K+ +       K   +  VC+  LG G  L ++ +LRY  +++K +ILI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFRT  +   CLFSL+NGDDM+ T   + + S ++++FS++++Y F  LFI++VL+L +T+I + Y  ++ Q  + + +     FI+ C++   S  Y+ D
Sbjct:   21 EEVESFRRKLKYFFMNPCEKYRARGRKPWKLMLQIIKIAVITIQLVSFGLSNQMVVTFKEENLMAFKHLFLKDYSDH--------SPNTYAVYTQAEVYTHLSHIVGQFLRLRNITVGNHAHDKDGRFFTPLLICQQFYHNGSISPSNETFEIDAQVEEECLEIYPVQPSSLPDADLS----------NFTLQFKRLLEVNVYFTLKAINLQTVQHHELPDCYDFNITIRFNNRAHSGRIKVDLDNDVDINECKDWKVTGASPKKIYYTVLFDVVIILTCL---ASLVLCTRSLSTGVQL--QFVNFFVKHYGKRVSWSDRMEFINGWYILIVISDILTITGSVLKIAI-----QLKALTSYDVCSILLGTGTMLVWIGVLRYMGYFKKYNILIITLRAAFPNVIRFCCCAGLIYLGYCFCGWIVLGPYHEKFRTLNTVSECLFSLINGDDMFATFKNMQQKSYLVWLFSRVYLYTFVSLFIYMVLSLFITLITDTYETIKQQQSDGEPVSELQAFISECKDHPNSGCYRVD 524          
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Match: MCOLN3 (mucolipin 3 [Source:NCBI gene;Acc:103027252])

HSP 1 Score: 234.187 bits (596), Expect = 5.035e-68
Identity = 169/527 (32.07%), Postives = 293/527 (55.60%), Query Frame = 3
Query:  105 ERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQIL----PSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSD 1664
            E  RR L+Y FMNP EK++A+G  P K++L IIK+ V+T+Q++ F  +N   V+F E +  +FKHLFL ++           S   +A+Y   E ++  S+ +  + +L    +G + +    +    + +C  +Y    ISPSN T++ D  +   C+E+  +P Q ++    ++       NF++ F  L++  + FTL++I L++ +  ++PDC+ F+I I FNN  H+G++ V LD ++    C    +    P   Y   +  VV  L       SL+LC RS+    +   +  +FF+   G  +S + R  F +  Y+LI   DIL I GS++K+ +       K   +  VC+  LG G  L ++ +LRY  +++K +ILI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFRT  +   CLFSL+NGDDM+ T   + + S ++++FS++++Y F  LFI++VL+L +T+I + Y  ++ Q  + + +     FI+ C++   S  Y+ D
Sbjct:   35 ESFRRKLKYFFMNPCEKYRARGRKPWKLMLQIIKIAVITIQLVSFGLSNQMVVTFKEENLMAFKHLFLKDYSDH--------SPNTYAVYTQAEVYTHLSHIVGQFLRLRNITVGNHAHDKDGRFFTPLLICQQFYHNGSISPSNETFEIDAQVEEECLEI--YPVQPSSLPDADL------SNFTLQFKRLLEVNVYFTLKAINLQTVQHHELPDCYDFNITIRFNNRAHSGRIKVDLDNDVDINECKDWKVTGASPKKIYYTVLFDVVIILTCL---ASLVLCTRSLSTGVQLQFEYADFFVKHYGKRVSWSDRMEFINGWYILIVISDILTITGSVLKIAI-----QLKALTSYDVCSILLGTGTMLVWIGVLRYMGYFKKYNILIITLRAAFPNVIRFCCCAGLIYLGYCFCGWIVLGPYHEKFRTLNTVSECLFSLINGDDMFATFKNMQQKSYLVWLFSRVYLYTFVSLFIYMVLSLFITLITDTYETIKQQQSDGEPVSELQAFISECKDHPNSGCYRVD 537          
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Match: MCOLN3 (mucolipin 3 [Source:NCBI gene;Acc:103027252])

HSP 1 Score: 234.187 bits (596), Expect = 5.035e-68
Identity = 169/527 (32.07%), Postives = 293/527 (55.60%), Query Frame = 3
Query:  105 ERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNK--PEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQIL----PSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSD 1664
            E  RR L+Y FMNP EK++A+G  P K++L IIK+ V+T+Q++ F  +N   V+F E +  +FKHLFL ++           S   +A+Y   E ++  S+ +  + +L    +G + +    +    + +C  +Y    ISPSN T++ D  +   C+E+  +P Q ++    ++       NF++ F  L++  + FTL++I L++ +  ++PDC+ F+I I FNN  H+G++ V LD ++    C    +    P   Y   +  VV  L       SL+LC RS+    +   +  +FF+   G  +S + R  F +  Y+LI   DIL I GS++K+ +       K   +  VC+  LG G  L ++ +LRY  +++K +ILI T++AA   ++RF  C+ ++Y+ +   GWI+LGPYH KFRT  +   CLFSL+NGDDM+ T   + + S ++++FS++++Y F  LFI++VL+L +T+I + Y  ++ Q  + + +     FI+ C++   S  Y+ D
Sbjct:   35 ESFRRKLKYFFMNPCEKYRARGRKPWKLMLQIIKIAVITIQLVSFGLSNQMVVTFKEENLMAFKHLFLKDYSDH--------SPNTYAVYTQAEVYTHLSHIVGQFLRLRNITVGNHAHDKDGRFFTPLLICQQFYHNGSISPSNETFEIDAQVEEECLEI--YPVQPSSLPDADL------SNFTLQFKRLLEVNVYFTLKAINLQTVQHHELPDCYDFNITIRFNNRAHSGRIKVDLDNDVDINECKDWKVTGASPKKIYYTVLFDVVIILTCL---ASLVLCTRSLSTGVQLQFEYADFFVKHYGKRVSWSDRMEFINGWYILIVISDILTITGSVLKIAI-----QLKALTSYDVCSILLGTGTMLVWIGVLRYMGYFKKYNILIITLRAAFPNVIRFCCCAGLIYLGYCFCGWIVLGPYHEKFRTLNTVSECLFSLINGDDMFATFKNMQQKSYLVWLFSRVYLYTFVSLFIYMVLSLFITLITDTYETIKQQQSDGEPVSELQAFISECKDHPNSGCYRVD 537          
BLAST of Mucolipin-3 vs. Ensembl Nematostella
Match: EDO42542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S161])

HSP 1 Score: 209.92 bits (533), Expect = 2.014e-60
Identity = 137/445 (30.79%), Postives = 234/445 (52.58%), Query Frame = 3
Query:  108 RMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS--SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKR-RHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            ++R+ L+ HFM P +K++ +G  P K+++ +IK+I++T Q+ +F       V + E +  +F HLF+LN             +   AIY   +F++   + L  YY ++++A+G Y   +    +  + LC   Y+   + P NATY F+   N  C +L P P + +     N+ EF    N    F   I     F     ++KS  + K P CF F++ I+F+N+ H+G++ V LD +     C   +  S  Y+   L V+D   +   ++S  LC RS+ + ++  K  + FF  ++   +S        S+ ++LI   D   + GS++K+ +     D +   N   C+ FLG GV L +  +LRY  + ++ +IL+ T++A++  +LRF +C+ +LY  F   GWI+LGPYH KFRT      C+FSL+NGDDM++T
Sbjct:    1 QIRKRLKSHFMTPYQKFKHRGRKPWKLLIQLIKIIIVTAQVCLFGNELFSIVDYLENNLDTFNHLFILN----------STRANGGAIYTRTQFYTQVRHTLNQYYAISQDAVGVYSPPTVMGQQTPLKLCTYSYKQGFVDPGNATYTFNRCTNYSCFDLLP-PRKEDR----NITEFRLRNNLPYTFERYI-----FISLIAEIKSLHIQKHPQCFTFNVTIVFDNSKHDGKIPVTLDADGIMDDCGGGLEESNQYL---LTVLDIFVMVICAISYFLCARSLYKHFRLVKTTRRFFADQLDDHLSYWDCLDLISLWFILILISDTCTVIGSLLKILI-----DWEVLSNYDTCSIFLGTGVLLTWTGVLRYLGYMKQYNILLVTLRASAPSVLRFCVCAALLYFGFMFCGWIVLGPYHPKFRTLSMVSECMFSLINGDDMFMT 417          
BLAST of Mucolipin-3 vs. Ensembl Nematostella
Match: EDO42580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S163])

HSP 1 Score: 167.933 bits (424), Expect = 3.031e-45
Identity = 137/452 (30.31%), Postives = 237/452 (52.43%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGS----SNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTP--QILPSGDY---INTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMD--ISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +R  + YHFMNP EK++A+   P K+++ I K+I++TVQ+ +F  +    V+F + ++ + ++LFL ++           ++    +Y  ++ +    YA E YY + E A G Y Y       + P + LC  YY+  +++ S+ +Y FD  +   C +  P P+     ++          N S NF  L+  +++F L +I LK  +    P C+Q ++ ++F+N   +GQ+ + L++E + + C    QI     Y   I  +L V D L +     SL L  RS+I+  K   K + FF+     D    +     F+  +++I   DIL I GSI K+ +     D K      VC+  LGI V L +  LLR+  ++++ ++L+ T+KA+   +LRF +C+ +L++ F+  GWI++GPY+ KFR    +   L+SL+NGDDMY T
Sbjct:    2 LRAQIEYHFMNPWEKYKARNRKPWKLLIQIFKIIIVTVQVYLFGADRFSVVNFMDDNQEALRYLFLKDYGGD--------ANAVRTVYTKNQVYMYLKYAHEQYYNIAEAA-GSYAYTDLDIFGDPPAVRLCYDYYKQVELNASSNSYTFDPTVINEC-DFLPKPHDHQHIIT----------NTSFNFGRLLSLKLDFLLNAINLKGVKAWDKPTCYQLNVTLLFDNKKRDGQMPINLNLENNWLQCKADSQIHSIDSYSTIIRILLIVFDSLVVVVCLASLTLSVRSLIKCLKL-IKARAFFIANEDQDPLSLSDAMDLFNWWFVIIIISDILTILGSIYKMAI-----DQKDSNFYDVCSLLLGIAVLLVWTGLLRFLGYFKQYNVLLLTLKASGPSILRFCVCAGVLFLGFTFCGWIVIGPYNTKFRDTTVTAEALYSLVNGDDMYNT 427          
BLAST of Mucolipin-3 vs. Ensembl Nematostella
Match: EDO38971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBB6])

HSP 1 Score: 49.2914 bits (116), Expect = 5.974e-6
Identity = 28/93 (30.11%), Postives = 51/93 (54.84%), Query Frame = 3
Query: 1155 SVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFS-LMNGDDMYV 1430
             +  YF G+ VF+  + LL+   F  +  +   T+  A  PLL F L  +I Y+A+S + +++ G    ++R+ +S++  LFS L+ G D + 
Sbjct:  828 ELLTYFEGLLVFVANMKLLKLCRFNHRIFMFTKTLSTAVEPLLSFLLVFLIFYLAYSSIYYLVFGSGIYEYRSMVSTIETLFSTLLGGYDYHA 920          
BLAST of Mucolipin-3 vs. Ensembl Medaka
Match: mcoln1a (mucolipin-1 [Source:NCBI gene;Acc:101164208])

HSP 1 Score: 228.024 bits (580), Expect = 1.606e-65
Identity = 175/529 (33.08%), Postives = 291/529 (55.01%), Query Frame = 3
Query:   96 EDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYG---SSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPF--PNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCT-PQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKS 1661
            E++E +RR L+Y FM+P +K+ AKG  P K+IL ++K+I++T Q+++F  +N   V+F E +  +FKHLFL ++  +        +   FA+Y   + +    + +E Y  L E  +G Y Y      N   + LC  YY+   I P+N T+  D  I T CI + P   P+Q   G SY         NF++ F+ LI   I F L++I +++   ++IPDC+ F I ++ +N  H+G+V + L+ + +   C  P +  SG   N      D        +SL+LC RSI+R     ++   +F   +   +S   R  F +  ++L+   DI  + GSIIK+ +     + K   +  +C   LG    L ++ ++RY TF++K +ILI T++AA   ++RF  C  ++Y+ +   GWI+LGPYH+KFR+      CLFSL+NGDDM+VT S + ESS ++++FSQ+++Y F  LFI++VL+L + +I  AY  ++HQ      + +   FI  C ++  S  ++ 
Sbjct:   61 EEEEALRRKLKYFFMSPCDKYHAKGRKPFKLILQLLKIIIVTAQLVLFGLSNQVVVTFKEENTMTFKHLFLKDYDDA--------TGDSFAVYTQQDVYDHIFHVVEKYLTLPETTVGRYAYVYDVGVNGSALSLCQQYYKRGRIDPANDTFSIDPQIKTDCIGVNPLAVPSQ-RLGSSY--------RNFTLKFHKLINVTIEFQLKAINIQTIINNEIPDCYTFYITVVLDNKAHSGKVKIWLENKATIKECKDPSV--SGHAENYTRVAFDVAVAVVCLLSLLLCGRSILRGIMLQQEYVRYFKENLDRPVSWTDRLEFINGWFILLIISDIFTVTGSIIKIGI-----ESKNMSSYDLCGILLGTSTLLVWVGVIRYLTFFQKYNILIITLRAAFPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSEMQESSNLVWLFSQVYLYTFISLFIYMVLSLFIALITGAYETIKHQTQEPLHITDLHAFIAECTDAPSSGKFRG 565          
BLAST of Mucolipin-3 vs. Ensembl Medaka
Match: MCOLN3 (mucolipin-3-like [Source:NCBI gene;Acc:101169350])

HSP 1 Score: 226.098 bits (575), Expect = 5.401e-65
Identity = 169/538 (31.41%), Postives = 299/538 (55.58%), Query Frame = 3
Query:   66 ETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY---GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVAL--DMEISEIPCTPQILPSGDYINTILKVV-DFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYK 1658
            E   E  E  E+ E +RR ++Y+FMNP EK+ A+G  P K++L IIK+ ++T+Q++ F  +N   V F E +  +F+HLFL ++               +AIYR  + +    Y +  +  L+   +G + +   G++  P + LC  ++    I P N T++ D ++++ C+++ P         + + KE L  ++F ++F  L+  +I F L++I L++    ++PDC+ F + I  +N  H+G++ V L  D+EI+E  C    +      +  L VV D L +    +S  LC RS++   K   +   F     G D+  + +  F S  Y+LI   D L I GSI+K+ +       K      VC+ FLGIG    ++ ++RY  ++RK +IL+ T++AA   ++RF  C+ I+Y+++   GW++LGPYH KFR+  +   CLFSL+NGDDM+ T   + + + +++IFS++++Y F  LFI+++L+L +TII + Y+ ++HQ  +     +   F++ C++  KS LY+
Sbjct:   21 EHQSEHLENLEEVEALRRKIKYYFMNPCEKYHARGRKPWKLLLQIIKIGIITIQLVSFGLSNQMVVEFKEENLMTFRHLFLKDYVDG--------DKETYAIYRQADVYDQIEYIITQFRLLHNNTVGNHEFEKNGTAYSP-LRLCQEFFRNGSIYPGNETFEIDANVDSECLDVYPM-------FTPSAKEIL--QHFKVHFKRLLSVKIVFVLKAINLQTVRHRELPDCYDFTVFITLDNQAHSGRIAVQLENDVEINE--CRDWKVSGAAGKSIYLTVVFDCLIITTCIISFALCTRSVVTGIKLMLEYSRFCDRRCGKDVPWSDKLEFVSGWYILIIVSDTLTITGSILKIEI-----QTKILTTYDVCSIFLGIGTMFVWIGVIRYMGYFRKYNILLLTLRAAFPNVIRFICCAGIIYLSYCFCGWVVLGPYHEKFRSLNTVSECLFSLINGDDMFPTFKDMQQKNNLVWIFSRVYLYTFVSLFIYMILSLFITIITDTYDTIKHQQQSGNPTSDLQKFLSVCKDLPKSGLYR 533          
BLAST of Mucolipin-3 vs. Ensembl Medaka
Match: MCOLN3 (mucolipin-3-like [Source:NCBI gene;Acc:101169350])

HSP 1 Score: 226.098 bits (575), Expect = 5.401e-65
Identity = 169/538 (31.41%), Postives = 299/538 (55.58%), Query Frame = 3
Query:   66 ETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY---GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVAL--DMEISEIPCTPQILPSGDYINTILKVV-DFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDIS-NKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYK 1658
            E   E  E  E+ E +RR ++Y+FMNP EK+ A+G  P K++L IIK+ ++T+Q++ F  +N   V F E +  +F+HLFL ++               +AIYR  + +    Y +  +  L+   +G + +   G++  P + LC  ++    I P N T++ D ++++ C+++ P         + + KE L  ++F ++F  L+  +I F L++I L++    ++PDC+ F + I  +N  H+G++ V L  D+EI+E  C    +      +  L VV D L +    +S  LC RS++   K   +   F     G D+  + +  F S  Y+LI   D L I GSI+K+ +       K      VC+ FLGIG    ++ ++RY  ++RK +IL+ T++AA   ++RF  C+ I+Y+++   GW++LGPYH KFR+  +   CLFSL+NGDDM+ T   + + + +++IFS++++Y F  LFI+++L+L +TII + Y+ ++HQ  +     +   F++ C++  KS LY+
Sbjct:   21 EHQSEHLENLEEVEALRRKIKYYFMNPCEKYHARGRKPWKLLLQIIKIGIITIQLVSFGLSNQMVVEFKEENLMTFRHLFLKDYVDG--------DKETYAIYRQADVYDQIEYIITQFRLLHNNTVGNHEFEKNGTAYSP-LRLCQEFFRNGSIYPGNETFEIDANVDSECLDVYPM-------FTPSAKEIL--QHFKVHFKRLLSVKIVFVLKAINLQTVRHRELPDCYDFTVFITLDNQAHSGRIAVQLENDVEINE--CRDWKVSGAAGKSIYLTVVFDCLIITTCIISFALCTRSVVTGIKLMLEYSRFCDRRCGKDVPWSDKLEFVSGWYILIIVSDTLTITGSILKIEI-----QTKILTTYDVCSIFLGIGTMFVWIGVIRYMGYFRKYNILLLTLRAAFPNVIRFICCAGIIYLSYCFCGWVVLGPYHEKFRSLNTVSECLFSLINGDDMFPTFKDMQQKNNLVWIFSRVYLYTFVSLFIYMILSLFITIITDTYDTIKHQQQSGNPTSDLQKFLSVCKDLPKSGLYR 533          
BLAST of Mucolipin-3 vs. Ensembl Medaka
Match: mcoln3a (mucolipin-3 [Source:NCBI gene;Acc:101157647])

HSP 1 Score: 221.861 bits (564), Expect = 1.572e-63
Identity = 157/527 (29.79%), Postives = 285/527 (54.08%), Query Frame = 3
Query:  105 ERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGY---GSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTP-QILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFF--LFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDM 1667
            E  RR L+Y+FMNP +K++A+G  P K++L I+K+ ++TVQ++ F  +N   V+F E +  +F+HLFL  ++ +++        G  AIY   + +    Y +  Y  L    +G   Y   G +  P + +C   Y  S++ P N T+  D H+   C+ +    +  N            + NF ++F  L+   +  TL+++ L++    ++PDC+ F I IIF+N  H+G++ V +  ++    C    +  +   I+ +L + D + +     SLILC RS+I+  +   +   F+   +   + +S+ R  F +  Y+LI   D+L + GS++K+ +       K   N  +C+  LG    L ++ ++RY  F++K +ILI T++AA   ++RF  C  ++Y+ +   GWI+LGPYH KFRT      CLFSL+NGDDMY T     ++  ++++FS+L++Y F  LFI++VL+L + +I + Y  ++H   + + +     F+  C++  +S  Y++D+
Sbjct:   34 EDFRRRLKYYFMNPCQKYRARGRKPWKLMLQILKIAIITVQLVSFGLSNEMMVTFKEENLMTFRHLFLKGYKDNWQ--------GSHAIYSQADLYDHIYYLISRYSHLQNLTVGNLAYERVGGTFTP-LTVCKVLYRKSNVDPGNDTFDIDPHVEKDCVSIYSASSGNNK----------THTNFYLDFKRLLSVNVYLTLKTVNLQTVRHHELPDCYDFHITIIFDNRAHSGKIKVDVKNQVRIYECRDWNVEGNSGKIDYLLVLFDTVVIVACFTSLILCSRSVIKGIQLQFEFSRFYHTFYNKVVSLSD-RLEFVNGWYILIIASDVLTMAGSLMKIGI-----QTKFQSNYDICSILLGTATMLSWVGVIRYLGFFKKYNILILTLRAAFPNVIRFCCCVAMIYLGYCFCGWIVLGPYHDKFRTLGKVTECLFSLINGDDMYATFLKTRDNCYMVWLFSRLYLYSFISLFIYMVLSLFIALITDTYETIKHHQKDKESVSQLHIFMAECRDQPESGKYQTDV 535          
BLAST of Mucolipin-3 vs. Ensembl Medaka
Match: mcoln2 (mucolipin 2 [Source:NCBI gene;Acc:101158932])

HSP 1 Score: 217.238 bits (552), Expect = 7.991e-62
Identity = 137/450 (30.44%), Postives = 235/450 (52.22%), Query Frame = 3
Query:  102 QERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKP---EMDLCITYYEISDISPSNATYKFDNHINTRCIELKP-FPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINT-ILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDI-SNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVT 1433
            +ER+R +L+Y+FM+P EK++A+  +P KM + I+K++++T Q++ F  NN   VS+ E +  + K+LF+  +    E           A+Y   + + +  Y L+ Y +L E ++G   Y          + +C  YY+   + PS+  Y  D  + T C+E  P   NQ             N+  F ++F  L+  ++ F L+ I L++    ++PDC+ F + I F+N +H+G+V + LD++     C    +      NT  L V D   +    +S  LC RSII   +  ++   FF       +  + ++ F +  Y+L+   D+L I GSI+K+ +       K   +  VC+ FLG    L ++ ++RY  +++K ++LI T+KAA   +LRF  C+ ++Y+ ++  GWI+LGPYH KF        CLFSL+NGDDM+ T
Sbjct:   25 EERLRDDLKYYFMSPCEKYRARRHIPWKMGVQILKIVMITTQLVFFGLNNQLVVSYKEENTMALKNLFIKGYSGVDE------DDFSIAVYTQRDVYDSLFYVLDQYSQLGELSVGAISYAEDEDGLLLPLTVCKEYYKRGSLKPSDEAYDIDAQLETLCMEHDPRTANQWRKQ---------NSSFFDLDFYRLVNIKVTFNLKGINLQTVRSRELPDCYSFYVMITFDNESHSGKVKLYLDIDAESSACQDWKISGTAQKNTHYLLVFDGFVILVCIISTTLCTRSIILAVRLLQRFSQFFQEHFDRKVCEDDQKEFLNGWYVLVIVSDVLTIIGSILKMEIQA-----KSLTSYDVCSIFLGTSTLLVWVGVIRYLGYFQKYNVLILTMKAAFPKVLRFCCCAGMIYLGYTFCGWIVLGPYHEKFEGLSRVAECLFSLLNGDDMFTT 454          
BLAST of Mucolipin-3 vs. Planmine SMEST
Match: SMESG000015161.1 (SMESG000015161.1)

HSP 1 Score: 1155.58 bits (2988), Expect = 0.000e+0
Identity = 650/653 (99.54%), Postives = 652/653 (99.85%), Query Frame = 3
Query:   51 MQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREIQIQNHHXXXXXXXXXXXFLNRQLINRXXXXXXXXXKILVNRNRSPRENYGSMCHTHHQSSNFREAINNSFEKQENHLPC 2009
            MQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGTLPIKMILIIIKLIVLTVQIIIFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDM++SEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLSIISESSPIIFIFSQLFIYLFCLLFIFVVLNLILTIIIEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREIQIQNHHDDLDEDDDNTDFLNRQLINRDDDE DDDDKILVNRNRSPRENYGSMCHTHHQSSNFREAINNSFEKQENHLPC
Sbjct:    1 MQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGTLPIKMILIIIKLIVLTVQIIIFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMKMSEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLSIISESSPIIFIFSQLFIYLFCLLFIFVVLNLILTIIIEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREIQIQNHHDDLDEDDDNTDFLNRQLINRDDDEDDDDDKILVNRNRSPRENYGSMCHTHHQSSNFREAINNSFEKQENHLPC 653          
BLAST of Mucolipin-3 vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 333/557 (59.78%), Postives = 428/557 (76.84%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC---TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREI 1772
            MRR+LRYHFMNPKEKW+AKGTLPIKMILI++KLI++TVQI++FSENNS EVSF EGSKTSFKHLFL NWQSSFETLPYPPS+GPFAIY++++F+ + +YALENYYKL  EAIGPY YG  N P + LCI YY   +I P N TY F       C ++KP  + ++  + ++ KE+L  +NF+I+FN L+KA++ F++RSIQLKSYE+D+ PDC QFDI I+F+N+NHNGQ+ V L  E++   C   TP I  S    NT+L  +D LAL FS +SLIL  RS+I LY+FWKK K FF  E+ +DIS+K ++F+ I+Y +IF GDIL+I G+I+K+ MY   K D      ++CNYFLG G+FLG+L L+RYF+++ KSSIL+NTI+ A  PLLRFSLCS +LY+AFSLLGWIILGPYH+KFRT  SS+ACLFSLM GDDMYVTLS+I+ S+ +++IFSQLFIYLFC+LFIFVVLNLILTII EAY E + Q+     +D FW FIN+C ES    LYK D+I+D+++ K+R    ++K VD  CCC+GK N+  EI
Sbjct:    1 MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKI-FDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDID--RFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEI 553          
BLAST of Mucolipin-3 vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 333/557 (59.78%), Postives = 428/557 (76.84%), Query Frame = 3
Query:  111 MRRNLRYHFMNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC---TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREI 1772
            MRR+LRYHFMNPKEKW+AKGTLPIKMILI++KLI++TVQI++FSENNS EVSF EGSKTSFKHLFL NWQSSFETLPYPPS+GPFAIY++++F+ + +YALENYYKL  EAIGPY YG  N P + LCI YY   +I P N TY F       C ++KP  + ++  + ++ KE+L  +NF+I+FN L+KA++ F++RSIQLKSYE+D+ PDC QFDI I+F+N+NHNGQ+ V L  E++   C   TP I  S    NT+L  +D LAL FS +SLIL  RS+I LY+FWKK K FF  E+ +DIS+K ++F+ I+Y +IF GDIL+I G+I+K+ MY   K D      ++CNYFLG G+FLG+L L+RYF+++ KSSIL+NTI+ A  PLLRFSLCS +LY+AFSLLGWIILGPYH+KFRT  SS+ACLFSLM GDDMYVTLS+I+ S+ +++IFSQLFIYLFC+LFIFVVLNLILTII EAY E + Q+     +D FW FIN+C ES    LYK D+I+D+++ K+R    ++K VD  CCC+GK N+  EI
Sbjct:    1 MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKI-FDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDID--RFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEI 553          
BLAST of Mucolipin-3 vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 325/548 (59.31%), Postives = 419/548 (76.46%), Query Frame = 3
Query:  138 MNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC---TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREI 1772
            MNPKEKW+AKGTLPIKMILI++KLI++TVQI++FSENNS EVSF EGSKTSFKHLFL NWQSSFETLPYPPS+GPFAIY++++F+ + +YALENYYKL  EAIGPY YG  N P + LCI YY   +I P N TY F       C ++KP  + ++  + ++ KE+L  +NF+I+FN L+KA++ F++RSIQLKSYE+D+ PDC QFDI I+F+N+NHNGQ+ V L  E++   C   TP I  S    NT+L  +D LAL FS +SLIL  RS+I LY+FWKK K FF  E+ +DIS+K ++F+ I+Y +IF GDIL+I G+I+K+ MY   K D      ++CNYFLG G+FLG+L L+RYF+++ KSSIL+NTI+ A  PLLRFSLCS +LY+AFSLLGWIILGPYH+KFRT  SS+ACLFSLM GDDMYVTLS+I+ S+ +++IFSQLFIYLFC+LFIFVVLNLILTII EAY E + Q+     +D FW FIN+C ES    LYK D+I+D+++ K+R    ++K VD  CCC+GK N+  EI
Sbjct:    1 MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKI-FDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDID--RFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEI 544          
BLAST of Mucolipin-3 vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 325/548 (59.31%), Postives = 419/548 (76.46%), Query Frame = 3
Query:  138 MNPKEKWQAKGXXXXXXXXXXXXXXXXXXXXXXFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPPSSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCITYYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNENFSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQVVVALDMEISEIPC---TPQILPSGDYINTILKVVDFLALFFSSVSLILCCRSIIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSIIKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILINTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLFSLMNGDDMYVTLXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXEAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRSANFSRKFVDTFCCCIGKGNNTREI 1772
            MNPKEKW+AKGTLPIKMILI++KLI++TVQI++FSENNS EVSF EGSKTSFKHLFL NWQSSFETLPYPPS+GPFAIY++++F+ + +YALENYYKL  EAIGPY YG  N P + LCI YY   +I P N TY F       C ++KP  + ++  + ++ KE+L  +NF+I+FN L+KA++ F++RSIQLKSYE+D+ PDC QFDI I+F+N+NHNGQ+ V L  E++   C   TP I  S    NT+L  +D LAL FS +SLIL  RS+I LY+FWKK K FF  E+ +DIS+K ++F+ I+Y +IF GDIL+I G+I+K+ MY   K D      ++CNYFLG G+FLG+L L+RYF+++ KSSIL+NTI+ A  PLLRFSLCS +LY+AFSLLGWIILGPYH+KFRT  SS+ACLFSLM GDDMYVTLS+I+ S+ +++IFSQLFIYLFC+LFIFVVLNLILTII EAY E + Q+     +D FW FIN+C ES    LYK D+I+D+++ K+R    ++K VD  CCC+GK N+  EI
Sbjct:    1 MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKI-FDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDID--RFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEI 544          
The following BLAST results are available for this feature:
BLAST of Mucolipin-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCOLN14.442e-6531.86mucolipin 1 [Source:HGNC Symbol;Acc:HGNC:13356][more]
MCOLN32.662e-6332.07mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358][more]
MCOLN22.418e-6130.80mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357][more]
MCOLN22.693e-6130.28mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357][more]
MCOLN33.505e-4932.56mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358][more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cup-53.098e-5230.41CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-53.098e-5230.41CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-54.565e-5230.41CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-54.796e-5230.41CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-54.796e-5230.41CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trpml1.410e-8635.08gene:FBgn0262516 transcript:FBtr0074952[more]
CG426381.410e-8635.08gene:FBgn0261361 transcript:FBtr0302283[more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a4.813e-7335.00mucolipin 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2704... [more]
mcoln1b1.248e-6832.26mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1][more]
mcoln3a1.682e-6431.40mucolipin 3a [Source:ZFIN;Acc:ZDB-GENE-121116-4][more]
MCOLN32.966e-6231.13mucolipin 3b [Source:NCBI gene;Acc:100001113][more]
MCOLN31.156e-6131.25mucolipin 3b [Source:NCBI gene;Acc:100001113][more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln11.358e-7132.69mucolipin 1 [Source:NCBI gene;Acc:496811][more]
mcoln12.630e-7133.04mucolipin 1 [Source:NCBI gene;Acc:496811][more]
wdsub13.357e-6731.03WD repeat, sterile alpha motif and U-box domain co... [more]
wdsub13.524e-6731.25WD repeat, sterile alpha motif and U-box domain co... [more]
wdsub13.561e-6731.03WD repeat, sterile alpha motif and U-box domain co... [more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcoln18.862e-6931.79mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498][more]
Mcoln31.685e-6831.47mucolipin 3 [Source:MGI Symbol;Acc:MGI:1890500][more]
Mcoln22.046e-5830.80mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529][more]
Mcoln23.959e-5830.80mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529][more]
Mcoln11.491e-664.52mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498][more]
back to top
BLAST of Mucolipin-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99J21|MCLN1_MOUSE6.199e-6831.79Mucolipin-1 OS=Mus musculus OX=10090 GN=Mcoln1 PE=... [more]
sp|Q8R4F0|MCLN3_MOUSE1.178e-6731.47Mucolipin-3 OS=Mus musculus OX=10090 GN=Mcoln3 PE=... [more]
sp|Q9GZU1|MCLN1_HUMAN2.133e-6431.86Mucolipin-1 OS=Homo sapiens OX=9606 GN=MCOLN1 PE=1... [more]
sp|Q60HE8|MCLN1_MACFA5.588e-6331.50Mucolipin-1 OS=Macaca fascicularis OX=9541 GN=MCOL... [more]
sp|Q8TDD5|MCLN3_HUMAN1.278e-6232.07Mucolipin-3 OS=Homo sapiens OX=9606 GN=MCOLN3 PE=1... [more]
back to top
BLAST of Mucolipin-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077LDL10.000e+070.51Transient receptor potential ion channel ML a (Fra... [more]
A0A2J7R4F71.171e-9035.87Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=... [more]
A0A2J7R4I61.699e-9035.87Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=... [more]
R7UMX72.041e-8937.36PKD_channel domain-containing protein OS=Capitella... [more]
A0A2J7R4H32.669e-8935.69Mucolipin-3 OS=Cryptotermes secundus OX=105785 GN=... [more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a4.145e-7234.81mucolipin-1-like [Source:NCBI gene;Acc:103039116][more]
mcoln1a4.446e-7234.81mucolipin-1-like [Source:NCBI gene;Acc:103039116][more]
MCOLN32.244e-6832.33mucolipin 3 [Source:NCBI gene;Acc:103027252][more]
MCOLN35.035e-6832.07mucolipin 3 [Source:NCBI gene;Acc:103027252][more]
MCOLN35.035e-6832.07mucolipin 3 [Source:NCBI gene;Acc:103027252][more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucolipin-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucolipin-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO425422.014e-6030.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425803.031e-4530.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389715.974e-630.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mucolipin-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a1.606e-6533.08mucolipin-1 [Source:NCBI gene;Acc:101164208][more]
MCOLN35.401e-6531.41mucolipin-3-like [Source:NCBI gene;Acc:101169350][more]
MCOLN35.401e-6531.41mucolipin-3-like [Source:NCBI gene;Acc:101169350][more]
mcoln3a1.572e-6329.79mucolipin-3 [Source:NCBI gene;Acc:101157647][more]
mcoln27.991e-6230.44mucolipin 2 [Source:NCBI gene;Acc:101158932][more]
back to top
BLAST of Mucolipin-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015161.10.000e+099.54SMESG000015161.1[more]
SMESG000015162.10.000e+059.78SMESG000015162.1[more]
SMESG000015162.10.000e+059.78SMESG000015162.1[more]
SMESG000015162.10.000e+059.31SMESG000015162.1[more]
SMESG000015162.10.000e+059.31SMESG000015162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018109 ID=SMED30018109|Name=Mucolipin-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2129bp
TATATAAATCTTATATGTTTTATTCAAAATAGAAGGTAGCAACCATTACT
ATGCAATCCTGTATTGAGACAAATGAAGAGGTCCATGAATTTACAGAAGA
TCAAGAAAGAATGCGTAGAAATTTACGATATCATTTTATGAATCCGAAAG
AAAAATGGCAAGCTAAAGGGACTCTTCCAATTAAAATGATATTAATTATT
ATTAAATTAATAGTTCTCACAGTACAAATTATTATTTTTAGTGAAAATAA
TTCTAAAGAAGTGTCATTTAATGAAGGATCTAAGACCTCATTCAAACATT
TATTTCTACTGAACTGGCAGTCGAGTTTTGAAACTCTGCCATACCCCCCT
AGTTCTGGTCCTTTTGCAATTTACAGAATAGATGAATTCTTTTCTGCGTC
AAGCTATGCTTTAGAAAATTACTATAAATTAAATGAAGAAGCAATTGGTC
CTTATGGATATGGATCTAGCAATAAACCGGAAATGGATTTATGTATCACA
TATTATGAAATCAGTGACATAAGTCCTTCAAATGCTACTTATAAATTTGA
CAACCACATTAATACGAGATGCATTGAACTGAAGCCTTTTCCAAATCAAA
CCAATACAGGTTTATCGTATAATGTGAAAGAATTTTTGAATAATGAAAAT
TTCAGCATCAATTTTAATGGATTGATTAAAGCAGAAATTAATTTCACTTT
AAGAAGTATTCAATTGAAATCATATGAGTTAGATAAAATTCCAGATTGTT
TTCAATTTGATATTAAAATAATTTTCAATAATAATAATCACAACGGACAA
GTAGTCGTCGCATTAGACATGGAAATTTCAGAGATTCCCTGCACCCCACA
GATTTTACCTTCGGGAGATTATATCAATACTATTCTCAAAGTTGTGGATT
TCTTGGCTTTATTTTTCAGTTCAGTTTCATTAATTTTATGTTGCAGATCT
ATTATCAGATTATATAAATTTTGGAAGAAAGTGAAAAATTTTTTTTTATT
TGAAATGGGAATGGATATTTCAAACAAGAGAAGACACTTCTTTAGTATTT
CTTATATGTTGATATTCTGTGGTGACATTCTTATTATATGTGGGAGCATT
ATAAAGTTAACAATGTATGGTTCGGTTAAAGACGATAAAAAACCTATGAA
TGTCAGTGTGTGCAACTATTTTCTTGGAATAGGTGTCTTTCTCGGATATC
TTGCATTGTTGCGATATTTCACATTTTATCGCAAGAGTAGTATCCTTATA
AACACGATCAAAGCCGCTTCTGCACCATTGTTAAGGTTTTCATTGTGTTC
CATTATTCTTTATATGGCTTTTTCACTTTTGGGATGGATCATTCTTGGGC
CGTATCATTTAAAATTCAGAACTTTTATTAGTTCAGTAGCTTGCCTCTTT
TCTTTAATGAATGGTGATGATATGTACGTGACTCTGTCAATAATTAGTGA
AAGCTCTCCAATTATTTTCATATTTTCTCAATTATTCATATATCTATTTT
GTCTACTTTTTATTTTTGTGGTTCTCAATTTGATACTTACAATTATAATT
GAGGCATACAATGAAGTTCAGCATCAAGATTTAAATACAAAACAACTTGA
CAATTTCTGGGGTTTTATTAATGCATGCCAAGAATCTTGCAAATCACATC
TATATAAAAGTGACATGATTTACGACAAAAGTATGAGAAAACAACGAAGC
GCCAATTTTTCCAGGAAATTTGTAGACACATTTTGTTGTTGTATTGGAAA
AGGAAATAACACACGAGAAATACAAATACAGAATCATCACGATGATCTTG
ATGAAGATGATGATAACACTGATTTCCTAAATAGGCAGTTAATCAATCGA
GATGATGATGAATATGATGATGATGACAAAATATTGGTCAATAGAAACAG
AAGTCCCCGAGAGAATTACGGCTCCATGTGCCATACTCATCATCAATCTT
CCAATTTCAGAGAGGCAATAAATAATTCATTTGAGAAACAAGAGAATCAT
TTGCCATGTTAGCGCACGAGTCTTTCGGATTTTGAGAAATTGTTGGCTAT
TTTTATAATGAGGTCCTTAATTTTATACAGTTTTTATTGGTTTTATAATA
ATAAATGTACATTTTTACGTCAAAAAAAA
back to top

protein sequence of SMED30018109-orf-1

>SMED30018109-orf-1 ID=SMED30018109-orf-1|Name=SMED30018109-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=654bp
MQSCIETNEEVHEFTEDQERMRRNLRYHFMNPKEKWQAKGTLPIKMILII
IKLIVLTVQIIIFSENNSKEVSFNEGSKTSFKHLFLLNWQSSFETLPYPP
SSGPFAIYRIDEFFSASSYALENYYKLNEEAIGPYGYGSSNKPEMDLCIT
YYEISDISPSNATYKFDNHINTRCIELKPFPNQTNTGLSYNVKEFLNNEN
FSINFNGLIKAEINFTLRSIQLKSYELDKIPDCFQFDIKIIFNNNNHNGQ
VVVALDMEISEIPCTPQILPSGDYINTILKVVDFLALFFSSVSLILCCRS
IIRLYKFWKKVKNFFLFEMGMDISNKRRHFFSISYMLIFCGDILIICGSI
IKLTMYGSVKDDKKPMNVSVCNYFLGIGVFLGYLALLRYFTFYRKSSILI
NTIKAASAPLLRFSLCSIILYMAFSLLGWIILGPYHLKFRTFISSVACLF
SLMNGDDMYVTLSIISESSPIIFIFSQLFIYLFCLLFIFVVLNLILTIII
EAYNEVQHQDLNTKQLDNFWGFINACQESCKSHLYKSDMIYDKSMRKQRS
ANFSRKFVDTFCCCIGKGNNTREIQIQNHHDDLDEDDDNTDFLNRQLINR
DDDEYDDDDKILVNRNRSPRENYGSMCHTHHQSSNFREAINNSFEKQENH
LPC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005261cation channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039031Mucolipin
IPR013122PKD1_2_channel
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 370..506
e-value: 3.4E-12
score: 45.8
IPR039031MucolipinPANTHERPTHR12127MUCOLIPINcoord: 10..565
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 331..353
NoneNo IPR availableTMHMMTMhelixcoord: 478..500
NoneNo IPR availableTMHMMTMhelixcoord: 281..303
NoneNo IPR availableTMHMMTMhelixcoord: 410..432
NoneNo IPR availableTMHMMTMhelixcoord: 368..390