PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30018098
Length (bp)2410
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PBPe domain-containing protein (SMED30018098) t-SNE clustered cells

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30018098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PBPe domain-containing protein (SMED30018098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30018098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018098

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018098SMESG000073173.1 SmedASXL_000379SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018098SMESG000073173.1 SmedASXL_032718SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018098SMESG000073173.1 dd_Smed_v6_68725_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018098SMESG000073173.1 dd_Smed_v6_51765_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018098SMESG000073173.1 OX_Smed_1.0.15413ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 129.798 bits (325), Expect = 3.513e-30
Identity = 105/457 (22.98%), Postives = 207/457 (45.30%), Query Frame = 1
Query: 1051 SQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSEN---------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNL---VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLR-KASKRR 2328
            +++P  ++     NKT+ + TI  SP+V  +KN       +   G+ + +   ++K   F+  + I  DG YG      + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+   EF    E Q SE+          W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ + + +I    ++  S      +S+  V  K+     SA+ ++     +     + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +G++       W+       +D   K  T  L  +++          G+F+I+       ++   IEF  + +A  +R
Sbjct:  353 TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHT-EEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA---------GVFYILVGGLGLAMLVALIEFCYKSRAEAKR 798          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 129.798 bits (325), Expect = 3.513e-30
Identity = 105/457 (22.98%), Postives = 207/457 (45.30%), Query Frame = 1
Query: 1051 SQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSEN---------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNL---VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLR-KASKRR 2328
            +++P  ++     NKT+ + TI  SP+V  +KN       +   G+ + +   ++K   F+  + I  DG YG      + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+   EF    E Q SE+          W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ + + +I    ++  S      +S+  V  K+     SA+ ++     +     + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +G++       W+       +D   K  T  L  +++          G+F+I+       ++   IEF  + +A  +R
Sbjct:  353 TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHT-EEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA---------GVFYILVGGLGLAMLVALIEFCYKSRAEAKR 798          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:HGNC Symbol;Acc:HGNC:4572])

HSP 1 Score: 129.798 bits (325), Expect = 3.839e-30
Identity = 105/457 (22.98%), Postives = 207/457 (45.30%), Query Frame = 1
Query: 1051 SQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSEN---------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNL---VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLR-KASKRR 2328
            +++P  ++     NKT+ + TI  SP+V  +KN       +   G+ + +   ++K   F+  + I  DG YG      + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+   EF    E Q SE+          W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ + + +I    ++  S      +S+  V  K+     SA+ ++     +     + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +G++       W+       +D   K  T  L  +++          G+F+I+       ++   IEF  + +A  +R
Sbjct:  400 TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHT-EEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA---------GVFYILVGGLGLAMLVALIEFCYKSRAEAKR 845          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 128.642 bits (322), Expect = 6.937e-30
Identity = 99/429 (23.08%), Postives = 199/429 (46.39%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-----NLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEF--SLRKASKR 2325
            + +N+++ + T+   PFV  RK+    +  D   G+ I +L  L+  L F   I +  DG YG    K Q+ +G V ++   KA++A +  T T  R   +D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + SP+  +     N G E  + +      +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   +      KS+    +K+     S  S LV +  + +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L     +    +++   + +     EN     +G     GIF ++ +  +  ++    EF   LRK ++R
Sbjct:  430 SLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQW-NGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSE-VVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCN-LTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLH--IMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAVGEFVYKLRKTAER 853          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 128.642 bits (322), Expect = 8.612e-30
Identity = 110/474 (23.21%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D++++ S    +S     +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      ++ LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     +N     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DSNKDKSSNITDS----LANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDNKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 124.405 bits (311), Expect = 5.517e-29
Identity = 100/417 (23.98%), Postives = 190/417 (45.56%), Query Frame = 1
Query: 1036 ASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPN-ESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL----GLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSE----DKVLQKLSAKSNL-VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFII 2256
            AS  +  +  +S       K +KI     +PFV     +G+++     G+ I +L  ++  L+F  +I    D  YG      ++ SG VG++Q+  A++A +  T +  RS V+D+T P M   ++I++ +P    S WF  +  L  ++W+M      +VS    +I K SP+  +      G    + ++     +FW  + S + QG +      S R+++  WW F++I+++ ++A+L + LTT          ++ AA+  I    +   S  +   +S+    +++ Q +S+   L V S  + +     ++ A + + S + Y VE+DC     I   +D    G  +PK S ++ L+   I +L  +  +     E   +  + VC          G +I  GIF I+
Sbjct:  382 ASSEAVVIANSSEKLTLEGKHLKISVYLEAPFVM-ITSNGSYE-----GYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKW-SGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSDYAYLMESSMLEYAVERDC-ELMQIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTE-LKEKWWKDKSVVCEQPKRKDQDDGESIG-GIFIIL 788          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 124.405 bits (311), Expect = 5.824e-29
Identity = 89/394 (22.59%), Postives = 181/394 (45.94%), Query Frame = 1
Query: 1027 FEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESS---KWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSE------------NFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL------SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            F+    N  +  ++ +  +     +++      PFV +  +      +   GF I +L  +++ L+F  +I    DGTYG      ++ +G +G +Q+ +A+++ S  T T  R+ VVD+T P M   ++I+  R +E +     +  +  L + +W+ + I   +VS +  ++ K SP+  +NL      +DE  F              +FW  +GS + QG D      + R+++  WWMF+ II++ ++A L ++LT +       + ++ A +  I   ++   S  +   +S+  + +++      S+    V S  + +        A + + S + Y +E+DC     I   +DS   G  +PK S  + +L   + +L  R I++
Sbjct:  386 FDSRYANRWEFDIDPDSEDLEGLHLRVVVYLEEPFVIKTGE------NQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRW-NGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNL----ERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCE-LQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILE 767          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 122.094 bits (305), Expect = 3.276e-28
Identity = 87/370 (23.51%), Postives = 173/370 (46.76%), Query Frame = 1
Query: 1099 IKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESS---KWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSE------------NFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL------SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            +++      PFV +  +      +   GF I +L  +++ L+F  +I    DGTYG      ++ +G +G +Q+ +A+++ S  T T  R+ VVD+T P M   ++I+  R +E +     +  +  L + +W+ + I   +VS +  ++ K SP+  +NL      +DE  F              +FW  +GS + QG D      + R+++  WWMF+ II++ ++A L ++LT +       + ++ A +  I   ++   S  +   +S+  + +++      S+    V S  + +        A + + S + Y +E+DC     I   +DS   G  +PK S  + +L   + +L  R I++
Sbjct:  410 LRVVVYLEEPFVIKTGE------NQYEGFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRW-NGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNL----ERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCE-LQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILE 767          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 117.087 bits (292), Expect = 1.221e-26
Identity = 94/374 (25.13%), Postives = 163/374 (43.58%), Query Frame = 1
Query: 1102 KICTIENSPFVTRKNKSGTFDIDN-MSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESS-KWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDE--------------IQFSENF------WTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKS----EDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            ++ TI   P+V  K      D ++   GF I +L  LSK L F  +I+   DG YG        + G +G++ + +AEMA +  T    RS  VD+T P +S  ++I+Y  P++     F+ +  L  +IW  I   ++ V+     +   +P+  WNL        E              I  S N+      W V+ + L  G DF    +S R++   WW+F ++I++ ++A+L + LT          L++ A +  I    + G S      +S      K+ Q +  K   V S  K +      N A + + + + Y  +++C+    I   + S   G  + K SE+   +  +I   + RGII+
Sbjct:  440 RVTTIMERPYVMLKKNHYELDANSKFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYE-WNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTTISYGTIRGGSTMQFFQESRIAAHVKMWQYMKDKDVFVTSNGKGVERALSMNYAYLMESTSLEYETQQNCN-LTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIE 811          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 103.99 bits (258), Expect = 1.548e-22
Identity = 80/290 (27.59%), Postives = 144/290 (49.66%), Query Frame = 1
Query: 1030 EDASRNSSQVP---LNSNPFNFSNKTIKICTIENSPFVTRKNKS-GTFDI---DNMSGFVIKILLHLSKTLE-FRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESS-KWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSA---WNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVN--GSSAA 1857
            ++  ++SSQ     L S P+        + T+   PFV  K ++ G  ++   D   G+ I +L  L+K +  F   ++I+ DG   G       + G +G +  + A++A +  T T +R   VD++ P M+  ++I+  +P +     F+ +  L M IW+        VS T  L+   SP+     +  G EF + +E     + W  + +F+ QG D     +S R+ S+ WW F++II++ ++A+L ++LT +       ++E+ A +N  ILY VN  GS+AA
Sbjct:  466 QEKKKDSSQTRKGILPSKPWQLR---FNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGFEYDVFIS-DGNKYGSRQADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRG-EFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNK-ILYGVNEGGSTAA 749          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 139.043 bits (349), Expect = 1.811e-33
Identity = 110/418 (26.32%), Postives = 203/418 (48.56%), Query Frame = 1
Query: 1090 NKTIKICTIENSPFVTR---KNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL----GLE-FAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-SAKSNLVPSCNKLLLNKDI-----NNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKN-NTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKI 2295
            N T+ + TI  +P+V     KN +G    +   GF + IL  +S+ + F   + +  D  YG   P+   ++G V  + + KA++A    T T  R SV+D+T P M+  ++I++  P +E ++ F+ +  L ++IW+ + I   LVS    ++ K SP   W       LE  +I ++   +++FW  IG+F+ Q  D Y   +S R++S+ W  FS+II+A ++A+L ++LTT+  +      E+ A++ +I    ++  S       S  +  +K+  +  N  PS         I      N A + + + + Y+V++DC+    I   +D+   G   PK S ++  +   I +L  RG IQ   L D   KN +  C  +N+       ++ L     ++ + + GI+   +
Sbjct:  402 NVTLVVITILETPYVMMHYGKNFTGN---ERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIE-WKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCN-LTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQ--MLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAV 812          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 136.346 bits (342), Expect = 1.197e-32
Identity = 94/416 (22.60%), Postives = 193/416 (46.39%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFS--AWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ----NWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGI 2280
            N  NKT+ + TI ++P+  RK  +      D   G+ + ++  +SK+L F   I +  DG+YG        ++G + ++ +++A++A +  T T +R   VD+T P M+  ++I+Y +P  +    F+ +  L + +W+ +    L VS    ++ K +P+   A+       +  +       W  IGS + QG DF    +S R+V+  WW F++I+++ ++A+L ++LT +       + E+ A +  I    + G S A     S+    Q++     SA+ ++  + N      + K   + A + + + + Y+ E++C     +   +D+   G   P  S ++  +++ I KL   G +      W+ E   ++    C  E S        + L     ++ + +GG+
Sbjct:  412 NLKNKTLVVTTILSNPYCMRKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNC-ELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKE---KRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGM 823          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 134.035 bits (336), Expect = 7.725e-32
Identity = 110/418 (26.32%), Postives = 202/418 (48.33%), Query Frame = 1
Query: 1090 NKTIKICTIENSPFVTR---KNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL----GLE-FAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-SAKSNLVPSCNKLLLNKDI-----NNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKN-NTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKI 2295
            N T+ + TI  +P+V     KN +G    +   GF + IL  +S+ + F   + +  D  YG   P+   ++G V  +  K A++A    T T  R SV+D+T P M+  ++I++  P +E ++ F+ +  L ++IW+ + I   LVS    ++ K SP   W       LE  +I ++   +++FW  IG+F+ Q  D Y   +S R++S+ W  FS+II+A ++A+L ++LTT+  +      E+ A++ +I    ++  S       S  +  +K+  +  N  PS         I      N A + + + + Y+V++DC+    I   +D+   G   PK S ++  +   I +L  RG IQ   L D   KN +  C  +N+       ++ L     ++ + + GI+   +
Sbjct:  402 NVTLVVITILETPYVMMHYGKNFTGN---ERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLM-KYADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIE-WKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCN-LTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQ--MLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAV 811          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 131.724 bits (330), Expect = 4.214e-31
Identity = 93/366 (25.41%), Postives = 179/366 (48.91%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILD--EIQF--SENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNA-ACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            N +N T+ + T E  P+V  K            GF I +L  ++  + F+  I +  D  YG  IP+   ++G V ++ +++A++A +  T    R SV+D+T P M+  + I++  P ++ ++ F+ +  L ++IWL +    +LVS    ++ + SP+   N    +   D  E QF  S +FW + G+FL QG        S R+V   W+ F +II++ ++A+L ++LT +  +    +  + A + +I    + G S       S+  + QK+     + K+ +     +  + + +  + A + + + + Y V++DC+    I   +DS   G   PK S ++  +   I +L  +GIIQ
Sbjct:  421 NIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCN-LTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQ 785          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 131.724 bits (330), Expect = 4.214e-31
Identity = 93/366 (25.41%), Postives = 179/366 (48.91%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILD--EIQF--SENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNA-ACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            N +N T+ + T E  P+V  K            GF I +L  ++  + F+  I +  D  YG  IP+   ++G V ++ +++A++A +  T    R SV+D+T P M+  + I++  P ++ ++ F+ +  L ++IWL +    +LVS    ++ + SP+   N    +   D  E QF  S +FW + G+FL QG        S R+V   W+ F +II++ ++A+L ++LT +  +    +  + A + +I    + G S       S+  + QK+     + K+ +     +  + + +  + A + + + + Y V++DC+    I   +DS   G   PK S ++  +   I +L  +GIIQ
Sbjct:  421 NIANITLVVMTREERPYVMVKEDKNLTGNLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCN-LTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQ 785          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: LO018303.1 (glutamate receptor ionotropic, kainate 3 [Source:NCBI gene;Acc:100334689])

HSP 1 Score: 135.576 bits (340), Expect = 3.949e-32
Identity = 157/717 (21.90%), Postives = 321/717 (44.77%), Query Frame = 1
Query:  373 PDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSIN-STKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGTVEIIKKN--PFNY---NDTNIYIVCQEMVYWNSFLENSAIE---------------MMKENGYVYASFIINFLSITNLYQNKAQKEED---------------YLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSI-----NGNLKMTFEDASR--NSSQVPLNSNPFN----FSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNES-SKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-----NLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQK--NNTVCLY-ENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIE---FSLRKASKR 2325
            PD + L Y + D +V FL      V+Y       ++++ +++  S+   ++ I  +   T     L+ ++K    F+I+      M  +IL   +   ++ + + +I   T++++  N  P+ +   N T   I+  +     S +E  ++E               M  +    Y +  ++ +S++  YQ+  Q   +               ++SF+K+ + +G+  ++  +  +       L I     +G  K+    AS   N ++VP   N  N     SN+++ I TI   P+V  +K+       D   GF I +L  L+  L F   I++  DG YG    K Q+ +G + ++ + +A++A +  T T  R   +D++ P ++  ++I+Y +PN + S +F+ +  +   IW+ I +  L VS    +I + SP+  +     N G +  + +      +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I   +V   +  +   KS     +K+ A       ++ V S    +     ++ A + + + + Y+  ++C+    +   +DS   G   PK S ++  +   I      GI+++  L  L +K  + + CL  E     P+G   +LG  FI+ +  L   VF+ I    + LRK ++R
Sbjct:  148 PDYSSLSYAILD-LVQFLKWKTATVVYDDS-TGLIRLQELIMAPSRYNIRLKIRQLPMDTVDTRPLLKEMKRSREFRIIFDCSHTMAAQILKQAQMMGMMTEYYHYIFT-TLDLMAINLEPYRFCGVNMTGFRILNVDNPQVASIVEKWSLERQIPPKPDSGLLEGIMTTDAALTYDA--VHIVSVS--YQHAPQMTVNSLQCHRHKPWRFGGRFMSFIKESHWDGLTGRLCFNRTTGLRTDFDLDIVSLKEDGLQKVGKWSASGGLNITEVP-RQNGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFSYEIHLVPDGKYGFQDDKGQW-NGMIRELMEHRADLAVAPLTITFMREKAIDFSKPFLNTGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSD-VVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSRQSTSFVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCN-LTQVGGIIDSKGYGIGTPKGSPYRDKITIAIL-----GILEDGRLHMLKEKWWSGSSCLEDERYETGPMGIQ-NLGGIFIVLASGLVLSVFVAIGEFIYKLRKTAER 847          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 129.028 bits (323), Expect = 2.364e-30
Identity = 81/280 (28.93%), Postives = 146/280 (52.14%), Query Frame = 1
Query: 1084 FSNKTIKICTIENSPFVTRKNKSGTFDIDNM-SGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYH-RPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLG---LEFAILDEIQFS--ENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLP-NTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL 1899
             +NK++ I TI  +P+V RK     F+ +    GF + +L  LS  L+F   I +  DG YG P P   + +G VG++  +KA++A + FT TS+R  V+D++ P M+  ++I+Y         +F+ +      +WL + +  L VS    L  + SP+  +N      E   L E Q++   + W  +G F+ QG +     +S R VS  WW F++II++ ++A+L ++LT    +++P  + ++ A + +I    ++G S     M S  +  Q++
Sbjct:  144 LANKSLIITTILENPYVMRKINYQEFEGNEQYEGFCVDMLRELSDILKFTYRIKLVDDGLYGAPEPNGSW-TGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNPHPCLRERRDLLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQR-MEVPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRM 421          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 129.413 bits (324), Expect = 2.651e-30
Identity = 90/374 (24.06%), Postives = 176/374 (47.06%), Query Frame = 1
Query: 1069 SNPFNFSNKTIKICTIENSPFVTRKNKSGTF-DIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENF------WTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSE----DKVLQKLSAKSNLVPSCNK----LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII 2142
            ++     NKT+ + TI  +P+V  K  +  F D +   G+ + +   ++K   F+  + I ADG YG    + + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+       E   L   + +  F      W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+    DK+ Q + +    V   N     L + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KL+ +G++
Sbjct:  399 NDTMGMENKTVIVTTILEAPYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNAVNLAVLKLNEQGLL 772          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 129.028 bits (323), Expect = 4.333e-30
Identity = 90/373 (24.13%), Postives = 175/373 (46.92%), Query Frame = 1
Query: 1072 NPFNFSNKTIKICTIENSPFVTRKNKSGTF-DIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENF------WTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSE----DKVLQKLSAKSNLVPSCNK----LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII 2142
            +     NKT+ + TI  +P+V  K  +  F D +   G+ + +   ++K   F+  + I ADG YG    + + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+       E   L   + +  F      W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+    DK+ Q + +    V   N     L + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KL+ +G++
Sbjct:  404 DTMGMENKTVIVTTILEAPYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNAVNLAVLKLNEQGLL 776          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2a (glutamate receptor, ionotropic, AMPA 2a [Source:ZFIN;Acc:ZDB-GENE-020125-3])

HSP 1 Score: 129.028 bits (323), Expect = 4.333e-30
Identity = 90/373 (24.13%), Postives = 175/373 (46.92%), Query Frame = 1
Query: 1072 NPFNFSNKTIKICTIENSPFVTRKNKSGTF-DIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENF------WTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSE----DKVLQKLSAKSNLVPSCNK----LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII 2142
            +     NKT+ + TI  +P+V  K  +  F D +   G+ + +   ++K   F+  + I ADG YG    + + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+       E   L   + +  F      W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+    DK+ Q + +    V   N     L + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KL+ +G++
Sbjct:  404 DTMGMENKTVIVTTILEAPYVMLKKNAELFTDNERYEGYCVDLAAEIAKHCGFKYQLRIVADGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGQLGPSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIALFDKMWQYMKSAEPSVFVKNTVEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNAVNLAVLKLNEQGLL 776          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: gria3 (glutamate receptor, ionotropic, AMPA 3 [Source:NCBI gene;Acc:100127683])

HSP 1 Score: 130.954 bits (328), Expect = 1.233e-30
Identity = 110/462 (23.81%), Postives = 208/462 (45.02%), Query Frame = 1
Query: 1054 QVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL---------------GLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSL--RKASKR 2325
            Q P N +  +  NKTI + TI  +P+V +K      D  D   G+ + +   ++K +  +  + I  DG YG   P+ + ++G VG++   +A++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+L                 EF I + + FS      +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+  V +K+     SA+ ++           + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +GI+       W+       +D   K+ T  L  +++          G+F+I+       ++   IEF    R  SKR
Sbjct:  352 QQPTNESS-SVENKTIIVTTILENPYVMKKKNHELLDGNDKYEGYCVDLASEIAKHVGIKYKLSIVEDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDTDEARDPQNPPDPPNEFGIFNSLWFS------LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTDDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVA---------GVFYILVGGLGLAMMVALIEFCYKSRAESKR 796          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: gria3 (glutamate receptor, ionotropic, AMPA 3 [Source:NCBI gene;Acc:100127683])

HSP 1 Score: 130.568 bits (327), Expect = 1.508e-30
Identity = 110/462 (23.81%), Postives = 208/462 (45.02%), Query Frame = 1
Query: 1054 QVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL---------------GLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSL--RKASKR 2325
            Q P N +  +  NKTI + TI  +P+V +K      D  D   G+ + +   ++K +  +  + I  DG YG   P+ + ++G VG++   +A++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+L                 EF I + + FS      +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+  V +K+     SA+ ++           + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +GI+       W+       +D   K+ T  L  +++          G+F+I+       ++   IEF    R  SKR
Sbjct:  392 QQPTNESS-SVENKTIIVTTILENPYVMKKKNHELLDGNDKYEGYCVDLASEIAKHVGIKYKLSIVEDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDTDEARDPQNPPDPPNEFGIFNSLWFS------LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTDDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVA---------GVFYILVGGLGLAMMVALIEFCYKSRAESKR 836          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: gria3 (glutamate receptor, ionotropic, AMPA 3 [Source:NCBI gene;Acc:100127683])

HSP 1 Score: 130.568 bits (327), Expect = 1.573e-30
Identity = 110/462 (23.81%), Postives = 208/462 (45.02%), Query Frame = 1
Query: 1054 QVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL---------------GLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSL--RKASKR 2325
            Q P N +  +  NKTI + TI  +P+V +K      D  D   G+ + +   ++K +  +  + I  DG YG   P+ + ++G VG++   +A++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+L                 EF I + + FS      +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+  V +K+     SA+ ++           + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +GI+       W+       +D   K+ T  L  +++          G+F+I+       ++   IEF    R  SKR
Sbjct:  396 QQPTNESS-SVENKTIIVTTILENPYVMKKKNHELLDGNDKYEGYCVDLASEIAKHVGIKYKLSIVEDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDTDEARDPQNPPDPPNEFGIFNSLWFS------LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTDDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVA---------GVFYILVGGLGLAMMVALIEFCYKSRAESKR 840          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: gria3 (glutamate receptor, ionotropic, AMPA 3 [Source:NCBI gene;Acc:100127683])

HSP 1 Score: 130.568 bits (327), Expect = 1.853e-30
Identity = 110/462 (23.81%), Postives = 208/462 (45.02%), Query Frame = 1
Query: 1054 QVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNL---------------GLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSL--RKASKR 2325
            Q P N +  +  NKTI + TI  +P+V +K      D  D   G+ + +   ++K +  +  + I  DG YG   P+ + ++G VG++   +A++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+L                 EF I + + FS      +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+  V +K+     SA+ ++           + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +GI+       W+       +D   K+ T  L  +++          G+F+I+       ++   IEF    R  SKR
Sbjct:  405 QQPTNESS-SVENKTIIVTTILENPYVMKKKNHELLDGNDKYEGYCVDLASEIAKHVGIKYKLSIVEDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDTDEARDPQNPPDPPNEFGIFNSLWFS------LGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTDDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVA---------GVFYILVGGLGLAMMVALIEFCYKSRAESKR 849          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 130.568 bits (327), Expect = 1.869e-30
Identity = 102/442 (23.08%), Postives = 200/442 (45.25%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSY------VRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFI-----IYSIYLGGIVFM---KIEFSLRKASKRRNNCDIL 2346
            + SN+++ + TI   P+V  +K+    +      G+ I +L  LSK L F   + +  DG YG      Q ++G V ++   KA++A +    T  R  V+D+T P M+  ++I+Y +PN ++   F+ +  L   IW+ I +  L VS    +I + SP+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   +      KS     +K+ A  N       +  N++       +DY++      + ++ +++C+    I   +DS   G   P  S ++  +   I +L   G++    +++   + N     E+     +G     GIF +     + S+++    F+   K    L K S  + +C IL
Sbjct:  389 SLSNRSLIVTTILEEPYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLH--MMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKKNAQLEKVSSDKEHCAIL 827          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 130.183 bits (326), Expect = 1.939e-30
Identity = 111/474 (23.42%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D +R+ S    N+   + +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      +S LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     ++     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DGNRDRS----NNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDSKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 129.798 bits (325), Expect = 2.075e-30
Identity = 111/474 (23.42%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D +R+ S    N+   + +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      +S LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     ++     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DGNRDRS----NNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDSKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 129.798 bits (325), Expect = 2.590e-30
Identity = 105/457 (22.98%), Postives = 207/457 (45.30%), Query Frame = 1
Query: 1051 SQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSEN---------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNL---VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLR-KASKRR 2328
            +++P  ++     NKT+ + TI  SP+V  +KN       +   G+ + +   ++K   F+  + I  DG YG      + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W+   EF    E Q SE+          W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ + + +I    ++  S      +S+  V  K+     SA+ ++     +     + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +G++       W+       +D   K  T  L  +++          G+F+I+       ++   IEF  + +A  +R
Sbjct:  400 TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHT-EEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA---------GVFYILVGGLGLAMLVALIEFCYKSRAEAKR 845          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 129.798 bits (325), Expect = 2.788e-30
Identity = 111/474 (23.42%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D +R+ S    N+   + +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      +S LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     ++     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DGNRDRS----NNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDSKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik3 (glutamate receptor, ionotropic, kainate 3 [Source:MGI Symbol;Acc:MGI:95816])

HSP 1 Score: 128.257 bits (321), Expect = 8.220e-30
Identity = 99/432 (22.92%), Postives = 199/432 (46.06%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-----NLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEF--SLRKASKRRNN 2334
            + +N+++ + T+   PFV  RK+    +  D   G+ I +L  L+  L F   I +  DG YG    K Q+ +G V ++   KA++A +  T T  R   +D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + SP+  +     N G E  + +      +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   +      KS+    +K+     S  S LV +  + +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L     +    +++   + +     EN     +G     GIF ++ +  +  ++    EF   LRK ++R   
Sbjct:  430 SLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQW-NGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSE-VVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYITQRNCN-LTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLH--IMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAVGEFIYKLRKTAEREQR 856          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R4M0|GRIA2_PONAB (Glutamate receptor 2 OS=Pongo abelii OX=9601 GN=GRIA2 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 9.219e-31
Identity = 107/457 (23.41%), Postives = 208/457 (45.51%), Query Frame = 1
Query: 1051 SQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSEN---------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNL---VPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLR-KASKRR 2328
            +++P  ++     NKT+ + TI  SP+V  +KN       +   G+ + +   ++K   F+  + IA DG YG      + ++G VG++   KA++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +Y L  +IW+ I    + VS    L+ + SP+  W+   EF    E Q SE+          W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ + + +I    ++  S      +S+  V  K+     SA+ ++     +     + K     A + + +   Y+ ++       +   +DS   G   PK S     ++  + KLS +G++       W+       +D   K  T  L  +++          G+F+I+       ++   IEF  + +A  +R
Sbjct:  400 TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIAGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLYPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHT-EEFEDGRETQSSESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA---------GVFYILVGGLGLAMLVALIEFCYKSRAEAKR 845          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P39086|GRIK1_HUMAN (Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.618e-29
Identity = 110/474 (23.21%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D++++ S    +S     +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      ++ LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     +N     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DSNKDKSSNITDS----LANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDNKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU4|GRIK1_MACFA (Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis OX=9541 GN=GRIK1 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.824e-29
Identity = 110/474 (23.21%), Postives = 222/474 (46.84%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D++++ S    +S     +N+T+ + TI   P+V  RK+    +  D   G+ + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      ++ LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     +N     +G   ++G  FI+ +  L   VF+ I   + K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DSNKDKSSNITDS----LANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDNKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFIYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P22756|GRIK1_RAT (Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3)

HSP 1 Score: 128.257 bits (321), Expect = 5.352e-29
Identity = 111/474 (23.42%), Postives = 221/474 (46.62%), Query Frame = 1
Query:  949 YQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNN 2334
            Y+VW  +        I + N  L MT  D +R+ S    N+   + +N+T+ + TI   P+V  RK+    +  D    + + +L  LS  L F   + +  DG YG    K ++ +G V ++   +A++A +  T T  R  V+D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + +P+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+ A      +S LV + ++ +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L   G +    +++   + N     ++     +G   ++G  FI+ +  L   VF+ I   L K+  R+NN
Sbjct:  412 YKVWKKIG-------IWNSNSGLNMT--DGNRDRS----NNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEAYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEW-NGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH--MMKEKWWRGNGCPEEDSKEASALGVE-NIGGIFIVLAAGLVLSVFVAIGEFLYKS--RKNN 865          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|B1AS29|GRIK3_MOUSE (Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 5.750e-29
Identity = 99/432 (22.92%), Postives = 199/432 (46.06%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-----NLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEF--SLRKASKRRNN 2334
            + +N+++ + T+   PFV  RK+    +  D   G+ I +L  L+  L F   I +  DG YG    K Q+ +G V ++   KA++A +  T T  R   +D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ + +  L VS    +I + SP+  +     N G E  + +      +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   +      KS+    +K+     S  S LV +  + +      + A + + + + Y+ +++C+    I   +DS   G   P  S ++  +   I +L     +    +++   + +     EN     +G     GIF ++ +  +  ++    EF   LRK ++R   
Sbjct:  430 SLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQW-NGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSE-VVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRTLTADYALLMESTTIEYITQRNCN-LTQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLH--IMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAVGEFIYKLRKTAEREQR 856          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.587e-64
Identity = 143/426 (33.57%), Postives = 230/426 (53.99%), Query Frame = 1
Query: 1078 FNFSNKTIKICTIENSPFVTRKNKSGTFDIDNM--SGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLT---TDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAK---SNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSI-PDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
              F N+TI+IC+ E  PF   +    TF    +   G +  +L  L+  L+FR S+ +  DG +GGP   + +FSGCVG+VQ+    +  S FT T+ R SVVD++ P+  +   I+  RP   SK +NV       +W+++ I + + +  T ++   SPFSA+NL LEFAI DEI   E  W+++GSF+ QGQDFY + +S R V AFWWMF+VII   ++ DLT++LT   TD  +K   TL +  A++ +   +  G++   ++  S   V ++++ K   S+ +P C +          AC+TDY+ + Y+   +CS+     E  ++A V F+ P+ + F   +D + QK+   GI+Q  F  +    ++ VC   +S   D I    S G F +  + Y  G++ + +E    KA KR 
Sbjct:  150 LGFKNETIRICSTEILPFTIYRQ---TFPNKTVIVGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIK---TLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQ---GKEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLF--NTYWSSDAVCSSGSSTEADSINLEGSGGCFIVALAFYGLGLLTLLVELLWTKALKRH 564          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.165e-62
Identity = 142/426 (33.33%), Postives = 230/426 (53.99%), Query Frame = 1
Query: 1078 FNFSNKTIKICTIENSPFVTRKNKSGTFDIDNM--SGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLT---TDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAK---SNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSI-PDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
              F N+TI+IC+ E  PF   +    TF    +   G +  +L  L+  L+FR S+ +  DG +GGP   + +FSGCVG+VQ+    +  S FT T+ R SVVD++ P+  +   I+  RP   SK +NV       +W+++ I + + +  T ++   SPF+A+NL LEFAI DEI   E  W+++GSF+ QGQDFY + +S R V AFWWMF+VII   ++ DLT++LT   TD  +K   TL +  A++ +   +  G++   ++  S   V ++++ K   S+ +P C +          AC+TDY+ + Y+   +CS+     E  ++A V F+ P+ + F   +D + QK+   GI+Q  F  +    ++ VC   +S   D I    S G F +  + Y  G++ + +E    KA KR 
Sbjct:  348 LGFKNETIRICSTEILPFTIYRQ---TFPNKTVIVGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIK---TLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQ---GKEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLF--NTYWSSDAVCSSGSSTEADSINLEGSGGCFIVALAFYGLGLLTLLVELLWTKALKRH 762          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J047 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 5.244e-62
Identity = 136/423 (32.15%), Postives = 233/423 (55.08%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLT---TDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLS-AKSNLVP--SCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSI-PDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
             F N+TI +CT E+ P +T   K  +     ++G    +L  L+  LEFR     + DG +G P+P Q +F+GCVG++Q+    +AA  FT T+ R SV+DY+ P+  +   I+  RP  +SK +NV    +  +W+ + + + + S  T ++   SPF+A+NL  E+AI DE+ F E  W+V+GSFL QGQDFY + +S R + AFWWMF+VII   ++ DLT++LT   TD  +K   TL +  ++  I  Y+  G++   +  +S   V ++++    +L P   C   ++ ++    AC+ DY+Y+  +  K+C+++   +E  ++A V F+ P  + F    D  +QKL   G++Q  F   +   ++ VC    S   + I F    G F +   +Y  G++ + +E +  K +K++
Sbjct:    2 GFKNQTIVVCTPESPP-MTNFEKRFSNSTVIINGMTFDLLNILASKLEFRFYTKDSDDGNWGAPVPNQPYFNGCVGELQRGLVTIAAGPFTRTTTRDSVIDYSTPLFQESNGILLPRPPPASKMWNVYLPFNYDVWISVIVLLFICSFITWILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIK---TLSDLVSQTAIKPYVPAGTNLYTLFKESNSGVYKQVADVMVDLGPYDYCPDSVVRQE---RACLNDYTYLLAIAMKNCTQYYLAEETFNTATVAFMYPDDAYFAEYFDFYMQKLLETGLMQRLF--KIYWSSDIVCTVGKSTEANSINFKGVEGCFIVTGCLYGVGLILLLLELAWTKLAKKQ 415          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.534e-61
Identity = 123/382 (32.20%), Postives = 205/382 (53.66%), Query Frame = 1
Query: 1186 VIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIP-DPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
             + IL + S  L+FR     + DG +G P     +F+GCVG++Q+ +  +AA  FT T+ R  V+D++ P+  +  AI+  RP   SK + V     M +WL I   + + +  T ++   SPF+A+NL LEFAI DE+   E  W+ IGSFL QGQDFY + +S+R   AFWW+ SVII   F+ DLT++LT         TL++   + +I  Y++ G+S   +++ +E  V +K++     +   +    +    N AC+TDY+Y+  +  K+C++F   +E   +A +  ++P  + +  L +  +QKL   G +Q WF   L   +++VC   +S   D I    + G F      Y  G++ + +E    K +KR+
Sbjct:    2 TLSILEYFSTQLDFRFLTKDSTDGNWGSPEVNSTYFNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNPNQACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFYAELFNFHMQKLHETGQLQRWF--QLYWSSDSVCSVGSSAETDAISLESAGGCFIATLCFYGLGLLILLLELVWTKLAKRQ 381          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J0R4 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 8.489e-60
Identity = 172/646 (26.63%), Postives = 316/646 (48.92%), Query Frame = 1
Query:  562 DLIYDLK---SKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGT----VEIIKKNPFNYN----DTNIYIVCQEMVY---------WNSFLEN---SAIEMMKE---------------------NGYVYASFIIN-FLSITNLYQNKAQKEEDYLS--FLKQYYQEGIAY-QVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVT--RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLT---TDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLS-AKSNLVP--SCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSI-PDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
            DL++ LK    K +F++LL    +  + +L    +  ++ +N+ W+++ T     +++   P N N      +++  C   V          W   L+     A+E M +                       +   S ++N  +SI++    +     + L+  F  Q  +   +Y ++W+S  S    ++  + +G L   F         +   +    F N+TI +CT E+ P     ++  + T  I+ M+  ++ IL   +  LEFR     + DG +G P+P Q +F+GCVG++Q+    +AA  FT T+ R SV+DY+ P+  +   I+  RP  +SK +NV    +  +W+ + + + + S  T ++   SPF+A+NL  E+AI DE+ F E  W+V+GSFL QGQDFY + +S R + AFWWMF+VII   ++ DLT++LT   TD  +K   TL +  ++  I  Y+  G++   +  +S   V ++++    +L P   C   ++ ++    AC+ DY+Y+  +  K+C+++   +E  ++A V F+ P  + F    D  +QKL   G++Q  F   +   ++ VC    S   + I F    G F +   +Y  G++ + +E +  K +K++
Sbjct:  209 DLVHHLKRLVKKKVFKLLLFASPRNALSVLRLAREAAVMQQNYFWLVLDTGLSKADVLSVTPANANVALLRGSVFTECTAAVMDVFPQCQTDWLRTLDARFVDAVEAMAKALNDSLLDPGFSPGNASCAPLRHWTSGSTVLNRLMSISDYDTQRGLISFNSLTRHFSSQRVEVVASYNELWSSPVSMLRSAQFDASSGALSKQFR---YKGVSLAFPNTFMGFKNQTIVVCTPESPPMTNFEKRFSNSTVIINGMTFDLLNIL---ASKLEFRFYTKDSDDGNWGAPVPNQPYFNGCVGELQRGLVTIAAGPFTRTTTRDSVIDYSTPLFQESNGILLPRPPPASKMWNVYLPFNYDVWISVIVLLFICSFITWILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIK---TLSDLVSQTAIKPYVPAGTNLYTLFKESNSGVYKQVADVMVDLGPYDYCPDSVVRQE---RACLNDYTYLLAIAMKNCTQYYLAEETFNTATVAFMYPDDAYFAEYFDFYMQKLLETGLMQRLF--KIYWSSDIVCTVGKSTEANSINFKGVEGCFIVTGCLYGVGLILLLLELAWTKLAKKQ 840          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 136.346 bits (342), Expect = 1.558e-32
Identity = 157/720 (21.81%), Postives = 318/720 (44.17%), Query Frame = 1
Query:  373 PDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSIN-STKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGTVEIIKKN--PFNY---NDTNIYIVCQEMVYWNSFLENSAIE---------------MMKENGYVYASFIINFLSITNLYQNKAQKEED---------------YLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSIN-------GNLKMTFEDASR--NSSQVPLNSN---PFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNES-SKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII----QNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIE---FSLRKASKRRN 2331
            PD + L Y + D +V FL      V+Y       ++++ +++  S+   ++ I  +   T     L+ ++K    F+I+      M  +IL   +   ++ + + +I   T++++  N  P+ +   N T   I+  +     S +E  + E               M  +    Y +  ++ +S++  YQ+  Q   +               ++SF+K+ + +G+  ++  S N +  +     ++       G  K+    AS   N ++VP  S      + SN+++ I TI   P+V  +K+       D   GF I +L  L+  L F   I +  DG YG    K Q+ +G + ++ + +A++A +  T T  R  V+D++ P M+  ++I+Y RPN + S +F+ +  +   IW+ I +  L VS    +I + SP+  ++        D ++       +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I   +V   +  +   KS     +K+ A       ++LV S    +     ++ A + + + + Y+  ++C+    +   +DS   G   PK S ++  +   I  L   G +    + W+     Q++     YE     P+G   +LG  FI+ +  L   VF+ I    + LRK ++R  
Sbjct:  151 PDYSSLSYAILD-LVQFLKWKTATVVYDDS-TGLIRLQELIMAPSRYNIRLKIRQLPLDTTDTRPLLKEMKRSREFRIIFDCSHTMAAQILKQAQMMGMMTEYYHYIFT-TLDLMAINLEPYRFCGVNMTGFRILNVDNPQVASIVEKWSTEKQIPPKPDSGLLEGIMTTDAALTYDA--VHIVSVS--YQHAPQMTVNSLQCHRHKPWRFGGRFMSFIKESHWDGLTGRL--SFNRTTGLRTDFDLDIVNLKEDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYGFQDDKGQW-NGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCN-LTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSGSSCQEDER---YEAG---PMGIQ-NLGGIFIVLASGLVLSVFVAIGEFIYKLRKTAEREQ 852          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 136.346 bits (342), Expect = 1.714e-32
Identity = 158/721 (21.91%), Postives = 318/721 (44.11%), Query Frame = 1
Query:  373 PDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSIN-STKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGTVEIIKKN--PFNY---NDTNIYIVCQEMVYWNSFLENSAIE---------------MMKENGYVYASFIINFLSITNLYQNKAQKEED---------------YLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSIN-GNLKMTFEDA-----------SRNSSQVPLNSN---PFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNES-SKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII----QNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIE---FSLRKASKR 2325
            PD + L Y + D +V FL      V+Y       ++++ +++  S+   ++ I  +   T     L+ ++K    F+I+      M  +IL   +   ++ + + +I   T++++  N  P+ +   N T   I+  +     S +E  + E               M  +    Y +  ++ +S++  YQ+  Q   +               ++SF+K+ + +G+  ++  S N +  +     ++  NLK   ED              N ++VP  S      + SN+++ I TI   P+V  +K+       D   GF I +L  L+  L F   I +  DG YG    K Q+ +G + ++ + +A++A +  T T  R  V+D++ P M+  ++I+Y RPN + S +F+ +  +   IW+ I +  L VS    +I + SP+  ++        D ++       +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I   +V   +  +   KS     +K+ A       ++LV S    +     ++ A + + + + Y+  ++C+    +   +DS   G   PK S ++  +   I  L   G +    + W+     Q++     YE     P+G   +LG  FI+ +  L   VF+ I    + LRK ++R
Sbjct:  153 PDYSSLSYAILD-LVQFLKWKTATVVYDDS-TGLIRLQELIMAPSRYNIRLKIRQLPLDTTDTRPLLKEMKRSREFRIIFDCSHTMAAQILKQAQMMGMMTEYYHYIFT-TLDLMAINLEPYRFCGVNMTGFRILNVDNPQVASIVEKWSTEKQIPPKPDSGLLEGIMTTDAALTYDA--VHIVSVS--YQHAPQMTVNSLQCHRHKPWRFGGRFMSFIKESHWDGLTGRL--SFNRTTGLRTDFDLDIVNLK---EDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYGFQDDKGQW-NGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCN-LTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSGSSCQEDER---YEAG---PMGIQ-NLGGIFIVLASGLVLSVFVAIGEFIYKLRKTAER 852          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 134.035 bits (336), Expect = 7.663e-32
Identity = 119/500 (23.80%), Postives = 225/500 (45.00%), Query Frame = 1
Query:  937 EGIAYQVWTSVNSSQSMSRILSINGNLKMTF----EDA-----------SRNSSQVPLNSN---PFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNES-SKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII----QNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIE---FSLRKASKR 2325
            EGI    W  +    S +R   +  +  +      ED              N ++VP  S      + SN+++ I TI   P+V  +K+       D   GF I +L  L+  L F   I +  DG YG    K Q+ +G + ++ + +A++A +  T T  R  V+D++ P M+  ++I+Y RPN + S +F+ +  +   IW+ I +  L VS    +I + SP+  ++        D ++       +FW  +GS + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I   +V   +  +   KS     +K+ A       ++LV S    +     ++ A + + + + Y+  ++C+    +   +DS   G   PK S ++  +   I  L   G +    + W+     Q++     YE     P+G   +LG  FI+ +  L   VF+ I    + LRK ++R
Sbjct:  314 EGIMTSHWDGLTGRLSFNRTTGLRTDFDLDIVNLKEDGLEKVGKWSASGGLNITEVPKRSGMNITDSLSNRSLVITTILEEPYVMLKKSDKALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYGFQDDKGQW-NGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCN-LTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSGSSCQEDER---YEAG---PMGIQ-NLGGIFIVLASGLVLSVFVAIGEFIYKLRKTAER 804          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-264f5.8 (si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-209])

HSP 1 Score: 133.265 bits (334), Expect = 1.785e-31
Identity = 83/286 (29.02%), Postives = 148/286 (51.75%), Query Frame = 1
Query: 1066 NSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYH-RPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLG---LEFAILDEIQFS--ENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLP-NTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL 1899
            N+     +NKT+ + TI  +P+V RK     F+  D   GF + +L  LS  L+F   I +  DG YG P P   + +G VG++  +KA++A + FT TS+R  V+D++ P M+  ++I+Y         +F+ +      +WL + +  L VS    L  + SP+  +N      E   L E Q++   + W  +G F+ QG +     +S R VS  WW F++II++ ++A+L ++LT    +++P  + ++ A + +I    ++G S     M S  +  Q++
Sbjct:  370 NNMSHTLANKTLTVTTILENPYVMRKENYQDFEGNDQYEGFCVDMLRELSDILKFSFRIKLVDDGLYGAPEPNGSW-TGMVGELINRKADLAVAGFTITSEREKVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERRDLLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQR-MEVPIESADDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRM 653          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-251b21.1 (probable glutamate receptor [Source:NCBI gene;Acc:103035003])

HSP 1 Score: 127.872 bits (320), Expect = 6.291e-31
Identity = 79/273 (28.94%), Postives = 146/273 (53.48%), Query Frame = 1
Query: 1093 KTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHR--PNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQF--SENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL 1899
            + +K+ TI+  P+   K   GT     + GF I +L  L+  L F+  +++  DG YG    +Q  ++G +G+V +++A++A +  T T+ R + VD T P M   L+ I  +   ++ S++ + +     ++WL I +  LL S    L  + SP S W    E    DE QF  S +FW  +G+  +QG   +   +S R+++A WW+FS+++LA + A+L+++L +D+      + E+ A +N I    + GSS+ N    S + + +++
Sbjct:   31 QPLKVTTIKQEPYAMSK---GT----ELEGFCIDLLSALASKLGFKYELHVVKDGRYGAK-NEQGTWNGMIGEVFRREADLAVAPLTLTASREAAVDMTKPFMQTGLSFIMRKDIASDDSQYLSFLNLFSTEMWLGILVAYLLTSFCIYLAARISP-SEW----EKPQADENQFTLSHSFWYTVGAITLQGAGPHPKALSGRLITAIWWLFSLMVLACYFANLSAWLHSDSNQLSIKSFEDLANQNIIQYGTIKGSSSLNFFKNSNNPIYRRV 290          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 5.692e-22
Identity = 62/203 (30.54%), Postives = 102/203 (50.25%), Query Frame = 1
Query: 1180 GFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSG--------TTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLT 1764
            GF + ++  LSK+L F   I++ AD +YG P      +SG +G++  K+A++A S  T T +R SVVD+T   M   + +   RP +S+  F ++  L+   W  + + + LV          T     +HSP                    + W V GSF+ QG +  S  +SAR+V   WW+F+ I+++ ++A LT+ LT
Sbjct:   22 GFSVDVMDALSKSLGFSYEIFMPADLSYGLPQ-ADGTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRREPRHSP----------------SLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLT 207          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 98.2117 bits (243), Expect = 1.425e-21
Identity = 81/395 (20.51%), Postives = 170/395 (43.04%), Query Frame = 1
Query: 1087 SNKTIKICTIENSP-FVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALD---MKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAI-------------------------------LDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNK---LLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII 2142
             N+T+ + TI ++P F+ +KN       D   G+ + +   ++   +F     +  DG YG   P  + ++G VG++   +A++A +  T +  R  V+D++ P MS  ++I+  +P +S     V+  LD    +IW+ I    + VS    L+ + SP+  W    +  +                                +E     + W  +G+F+ QG +     +S R+V   WW F++II++ ++A+L ++LT +  +    + ++ A + +I    ++  S      +S+  V +K+      A+  +    N      + K     A + + +   Y  ++       +   +DS   G   PK S  +  ++  + KL+ +G++
Sbjct:   29 GNRTVIVTTILDAPYFMLKKNHEQFEGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKP--GVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYE-WQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLL 420          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 2.250e-19
Identity = 62/284 (21.83%), Postives = 133/284 (46.83%), Query Frame = 1
Query: 1324 KAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQ----FSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-----SAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQ 2145
            KA++A +  T    R   +D++ P M+  ++I+Y +PN ++   F+ +  L   IW+ I +  L VS    +I + SP+  +N        D ++       +FW  +G+ + QG +     +S R+V   WW F++II++ ++A+L ++LT +      ++ ++ A +  I    V   S      KS+    +K+     S ++ L+ +  + +      + A + + + + Y+ +++C+    I   +D+   G   P  S ++  +   I +L   G + 
Sbjct:    9 KADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCN-LTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLH 291          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000889.1 (pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1 gene:ENSPMAG00000000813.1 transcript:ENSPMAT00000000889.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 2.747e-14
Identity = 42/136 (30.88%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 1117 ENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSG 1524
            + SP+V R  K          GF I IL  LS T+ F   +Y+  +G +G  I  Q  ++G VG+V+QK+A MA    T   +RS VVD++ P +   ++++  R N +      +      +W+M+ I  L++S 
Sbjct:   78 DKSPYVKRCCK----------GFCIDILRKLSTTVRFTYDLYLVVNGKHGKKI--QGVWNGMVGEVEQKRAHMAVGSLTINEERSQVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSAAVWVMMFILCLMLSA 201          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 1.451e-13
Identity = 53/205 (25.85%), Postives = 99/205 (48.29%), Query Frame = 1
Query: 1180 GFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFY--SYPI------SARVVSAFWWMFSVIILAVFSADLTSYLTTD 1770
            GF I IL  LSKT++F   +Y+  +G +G  I     ++G +G+V   +A MA    T   +RS VVD++ P +   ++++  R N +      +      +W+M+ I  LLVSG    I ++     +N  L        +F    +T+  S  +     +  S P+      +++ + + W  F+VI LA ++A+L +++  +
Sbjct:  398 GFCIDILKKLSKTVKFTYDLYLVTNGKHGSKI--NGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAG----KEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQE 596          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 132.494 bits (332), Expect = 1.154e-31
Identity = 116/451 (25.72%), Postives = 202/451 (44.79%), Query Frame = 1
Query: 1084 FSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-------NLGLEFAILDE---IQFSENFWTVIGSFLMQGQDFYSYPISA--RVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLP-NTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQK----LSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKD-CSRFAYIQEF----VDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDP-------IGFNISLGIF-FIIYSIYLGGIVFM----KIEFSLRKASKRRNN 2334
             +++TI++ + + SPF T    + +  +D   G VI +L  LS+ L F  +IY++ DG  G   P    + G + ++ Q++A++A    T TS R  V+D+T P M+  + ++    N    +F  +      +W+ I   +L +     L    SPF  +       N  ++ + L +   + F  + W+    +L QG D  ++P+SA  R   A WW    I+ A ++A++ ++LTT T ++ P   +E+ +++ +I    V  S   N    S  +  Q     +  + +L P     +        A I D   + YL  K  C R   I  +      +A  GF +PK S +  LL  EI KL   GI +    E + ++     L E    D        +G N  LG+F F++  I +GG++ +       +S  K  KR+ N
Sbjct:  377 LADRTIRVVSFKGSPF-TMPVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDG-NHPVSASGRAAVAVWWFVITILGATYTANMAAFLTT-TRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCAPLDEAEEQDAKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLLEWFVAAYSDVKRDKRKRN 824          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 113.235 bits (282), Expect = 7.626e-27
Identity = 89/358 (24.86%), Postives = 170/358 (47.49%), Query Frame = 1
Query: 1114 IENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRP-NESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAIL---DEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLP-NTLEEFAARNDIILYLVNGSSAANIIMKSEDKV------LQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYL-VEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN 2148
            +++ PF+  + N S     D   GF   ++  LS+ L FR  I I+ + +YG  +  Q  + G +G++ +++A++A    T T++R  V+D++ P +   +A+I  +P  E    F  +   D K+WL     + LVS     + + SP   +    E +     DE   S + W  + S L QG D      S RV++A +W+F++I+++ ++A+L +Y T + G++   N+LE+  +++ +   +  G S       SE KV       Q++ ++   V      +L       A +TD   + Y  + K C+    ++  +D+      + + SE+  L+   I +L   G I+ 
Sbjct:    6 LQDEPFMMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQ--WQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSP-QGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFF--SESKVDIYATMFQQMKSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTM-LVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEK 357          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 99.7525 bits (247), Expect = 1.627e-21
Identity = 66/272 (24.26%), Postives = 131/272 (48.16%), Query Frame = 1
Query: 1057 VPLNSNPFNFSNKTIKICTIENSPFV---TRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAI-IYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLE----------FAILDEIQFSENFWTVIGSFLMQGQDFYSYPIS--ARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDI 1824
            VP +S      N+T+K+ TI  +PF+   T+ N  G   +  + G+ I++L  LS+ L F+  +Y+  D  +G   P  + ++G V +V   +A++A +  T + +R  V+D+T P M   L + I   P E    F ++      +W+ I   M++V     L    SPF  +   ++            + D +      W+ +  ++ Q  D + +P+S   R+  A +W   +I+++ ++A+L ++LT        +++++ A + DI
Sbjct:  433 VPTDSTHI-LENRTLKVVTIAEAPFIFAQTQTNGQGETRVI-IEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSD-HLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDI 701          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 95.5153 bits (236), Expect = 3.080e-20
Identity = 97/429 (22.61%), Postives = 182/429 (42.42%), Query Frame = 1
Query: 1063 LNSNPFN-FSNKTIKICTIENSPFVTRK-----NKSGTFDI-------------DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYG------GPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQG-QDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARND----IILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQK--NNTVCLYENSIPDPIGFNISLGIFFI 2253
            LN+ P   F +  +++ T+   PFV  K      +    D              D  SGF + +L+ L + + F  S+ ++ DG+YG      G   KQ  ++G VG+V Q KA++  +  T  ++R+  ++++ P     L I+  +  +S+   + +    + +WL++ + + +V+    L+ + SPF  + L  +      +  S   W   G  L  G  +      SARV+   W  F++II+A ++A+L ++L  D    + + +++   RN     I   + N S  A    + E   +       N+  +   +   K+    A I D   + Y   KDC+      E    +  G  +PK S +   +   I      G+     +E+L     + + C  EN+ P  +G    LG+F +
Sbjct:  383 LNTTPTGVFLSNHLRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQ--WNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCT-LTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGV-----MEELETTWIDASKCNTENTSPATLGLQHMLGVFIM 803          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO32623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK5])

HSP 1 Score: 80.8777 bits (198), Expect = 2.942e-17
Identity = 60/229 (26.20%), Postives = 107/229 (46.72%), Query Frame = 1
Query: 1126 PFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESS---KWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEE 1803
            PF+  +    T  +   +G  I +L  L+    F+  IY +A+   GG + +   + G  GD+Q +KA++     T  S R   +D++ P M   + ++  +P E       F   Y +   +WLM   C + V+G  +L+  +SP+       E    DE  F  + W  + S L QG D     +S R+V+   W   ++ ++ ++A+L ++LTT +     N LE+
Sbjct:    1 PFIISEKDPTTGAV-KYTGHSIDLLDILAGMNGFQYEIYESAE--LGG-VKEDGTYYGLFGDIQSEKADLTTLPLTINSARLQYLDFSEPFMHVSMDLVTRKPEEKQIDITGFMTPYTI--PVWLMTMACWIFVTGCLSLVNYYSPYGHRLRDTE-GDGDEFSFFNSLWFCLASMLQQGGDATPKMLSGRIVTGTLWFVILVWVSTYTANLAAFLTTSSSDSAINNLED 222          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria3b (glutamate receptor 3 [Source:NCBI gene;Acc:101171999])

HSP 1 Score: 129.798 bits (325), Expect = 1.594e-30
Identity = 108/454 (23.79%), Postives = 206/454 (45.37%), Query Frame = 1
Query: 1060 PLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILD---------EIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-SAKSNLVPSC-------NKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQN-----WF------LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSL--RKASKR 2325
            P  SN  +  N+TI + TI  +P+V  +KN       D   G+ + +   ++K +  +  + I  DG YG   P+ + ++G VG++   +A++A +  T T  R  V+D++ P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  WNL  +  I D         +     + W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++  S      +S+  V +K+ S   +  PS            + K     A + + +   Y+ ++       +   +DS   G   PK S  +  ++  + KLS +GI+       W+       +D   K+ T  L  +++          G+F+I+       ++   IEF    R+ +KR
Sbjct:  401 PQVSNDSSVENRTIVVTTIMEAPYVMYKKNFIHLEGNDRYEGYCVDLASEIAKHVGIKYKLSIVMDGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WNLEEQDEIKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNV---------AGVFYILVGGLGLAMMVALIEFCYKSRQETKR 844          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001416.2 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 129.798 bits (325), Expect = 1.732e-30
Identity = 80/292 (27.40%), Postives = 147/292 (50.34%), Query Frame = 1
Query: 1045 NSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYH-RPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEI-----QFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL 1899
            NS+ + LN++    +NK++ + TI  +P+V RK+    +   D   GF + +L  L+  L+F   I +  DG YG P P   + +G VG++  +KA++A + FT TS+R  V+D++ P M+  ++I+Y         +F+ +      +WL + +  L VS    L  + SP+  +N    F    +I         + W  +G F+ QG +     +S R VS  WW F++II++ ++A+L ++LT         + ++ A + +I    ++G S     M S  +  Q++
Sbjct:  379 NSTSLDLNASQ-TLANKSLIVTTILENPYVMRKSNYQDYQGNDQYEGFCVDMLRELAGILKFSFKIKLVDDGLYGAPEPNGSW-TGMVGELIDRKADLAVAGFTITSEREKVIDFSKPFMTLGISILYRVHLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPYPCFRERRDILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESADDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRM 668          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 130.183 bits (326), Expect = 1.770e-30
Identity = 82/292 (28.08%), Postives = 150/292 (51.37%), Query Frame = 1
Query: 1045 NSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDI-DNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYH-RPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLG---LEFAILDEIQFS--ENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL 1899
            NS+ + +N +    +NKT+ + TI  +P+V RK+    F   D   GF + +L  L+  L+F   I +  DG YG P P   + +G VG++  +KA++A + FT TS+R  V+D++ P M+  ++I+Y  +      +F+ +      +WL + +  L VS    L  + SP+  +N      E   + E Q++   + W  +G F+ QG +     +S R VS  WW F++II++ ++A+L ++LT         + ++ A + +I    ++G S     M S  +  Q++
Sbjct:  399 NSTSLDINVSE-TLANKTLIVTTILENPYVMRKDNYQDFQGNDQYEGFCVDMLRELADILKFSFKIKLVDDGLYGAPEPNGSW-TGMVGELINRKADLAVAAFTITSEREKVIDFSKPFMTLGISILYRVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIEYGTIHGGSTMTFFMNSRYQTYQRM 688          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 129.798 bits (325), Expect = 1.775e-30
Identity = 103/435 (23.68%), Postives = 205/435 (47.13%), Query Frame = 1
Query: 1081 NFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNES-SKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAW-----NLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSA------KSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQK--NNTVCL-YENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEF--SLRKASKRRN 2331
            + +N+++ I TI   P+V  +K+       D   GF I +L  L+  L F   I +  DG YG    K Q+ +G + ++ + +A++A +  T T  R   +D++ P MS  ++I+Y +PN + S +F+ +  +   IW+ I +  L VS    +I + SP+  +     N G +  + +      +FW  + S + QG +     +S R++   WW F++II++ ++A+L ++LT +      ++ ++ A +  I   ++   +  +   KS     +K+ A      +++LV S    +     ++ A IT+ + + Y+  ++C+    +   +DS   G   P  S ++  +   I       I+++  L  L +K  + + CL  E     P+G     G+F ++ S  +  +     EF   LRK ++R  
Sbjct:  428 SLANRSLVITTILEEPYVMLKKSDRALVGNDRFEGFCIDLLKELAGLLGFTYEIRLVPDGKYGSQDDKGQW-NGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSD-VVENNFTLLNSFWFGVSSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIAKQTKIEYGVIKDGATMSFFKKSRVSTFEKMWAFMSSRPRTSLVKSIEDGIQRVLKSDYALITESTTIDYITRRNCN-LTQVGGIIDSKGYGIGTPIGSPYRDKITIAILS-----ILEDGRLHMLKEKWWSGSSCLDEERRETGPMGIQNLGGLFIVLASGLVLSVFVAMAEFIYKLRKTAEREQ 854          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045625.1 (glutamate receptor 1 [Source:NCBI gene;Acc:101167340])

HSP 1 Score: 129.798 bits (325), Expect = 2.009e-30
Identity = 96/379 (25.33%), Postives = 179/379 (47.23%), Query Frame = 1
Query: 1060 PLNSNPFNFSNKTIKICTIENSPFVT-RKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKW-FNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEI-QFSEN-------FWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKL-SAKSNLVPSC-------NKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGII 2142
            PL    F   NKT  + TI  +P++  +KN       D   G+  ++   ++K + F   + + ADG YG      + ++G VG++   KA++A +  T T  R  V+D+T P MS  ++I+  +P +S    F+ +  L  +IW+ I    + VS    L+ + SP+  W  G +    DE+ Q + N        W  +G+F+ QG D     +S R+V   WW F++II++ ++A+L ++LT +  +    + E+ A + +I    ++G S      +S+  V +K+ S   +  PS          + + K     A + + S   Y+ ++       +   +DS   G   PK S  +  ++  + KL+ +G++
Sbjct:  397 PLQEEFFGLLNKTYVVTTILEAPYMMLKKNHEQFVGNDKYEGYCAELAAEIAKHVGFTYRLELVADGKYGARDVDSKLWNGMVGELVYGKADIAVAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WQ-GEDSDDEDEVAQTTTNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWSYMRSAEPSVFVRSTTDGVMRVRKSKGKYAYLLESSMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLRNPVNLAVLKLNEQGLL 773          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000073173.1 (SMESG000073173.1)

HSP 1 Score: 1382.08 bits (3576), Expect = 0.000e+0
Identity = 695/765 (90.85%), Postives = 699/765 (91.37%), Query Frame = 1
Query:   55 MRLQIILINLSICWGANVNIGILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGTVEIIKKNPFNYNDTNIYIVCQEMVYWNSFLENSAIEMMKENGYVYASFIINFLSITNLYQNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN 2349
            MRLQIILINLSICWGANVNIGILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNS+         +A  II  + I          TN+Y                                          QNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN
Sbjct:    1 MRLQIILINLSICWGANVNIGILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSV---------YASFIINFLSI----------TNLY------------------------------------------QNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN 704          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000073173.1 (SMESG000073173.1)

HSP 1 Score: 1341.64 bits (3471), Expect = 0.000e+0
Identity = 675/746 (90.48%), Postives = 680/746 (91.15%), Query Frame = 1
Query:  112 IGILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLEKNNILGKNFAWIIIGTVEIIKKNPFNYNDTNIYIVCQEMVYWNSFLENSAIEMMKENGYVYASFIINFLSITNLYQNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN 2349
            +GILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNS+         +A  II  + I          TN+Y                                          QNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN
Sbjct:    6 LGILSDFPLSNTDMAVFGYFNLTPVHFQTALDIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESDEYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCYSKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSV---------YASFIINFLSI----------TNLY------------------------------------------QNKAQKEEDYLSFLKQYYQEGIAYQVWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRRNNCDILN 690          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000073183.1 (SMESG000073183.1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.032e-130
Identity = 193/396 (48.74%), Postives = 266/396 (67.17%), Query Frame = 1
Query: 1141 KNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFSLRKASKRR 2328
            KNKS +F I+N+SGF+ K+L HLSK L F   IY   DG YG  +     +SGCVG++Q K A  AA  FTF  +R+ VVDY+YPI+SDPL ++Y  P+   +W+N + + ++ +W +  I ML +S  TT++CK+SPFSAWNL L F+I DEI   E+ WT IGSF +QGQDFY+YPIS+R+V+A WW+FS I +AV+SADLTS LT + G KLPN+L+E A  N+I L+L  G S  + +  S D++L KL  KS  V  C+KLLL  + +N ACI DYS +RY+   +CSR+  + E V++   GF+IPK +++K   D EIQ LS +G+I  WFLEDLN +NNT C  + + P  I FN S GIF +  +IYL G +F+ +E    +  KR+
Sbjct:    2 KNKSSSFSIENISGFLSKVLKHLSKVLNFNPVIYQPVDGQYGVKLNNNTVYSGCVGELQTKNASFAAGSFTFNDERNQVVDYSYPILSDPLVVMYQNPSSKVRWWNFLLSFNINVWCLTFISMLAISIFTTILCKYSPFSAWNLCLPFSIKDEILLKEHLWTSIGSFFLQGQDFYAYPISSRMVTASWWIFSAIFVAVYSADLTSLLTINNGQKLPNSLQEIADSNEIFLHLTVGYSITSNLKNSRDEILHKLYTKSKFVSECSKLLLEMETSNIACIGDYSEMRYIRMLNCSRYTIVPEVVEATFTGFLIPKLADYKDAFDKEIQLLSDKGVIFKWFLEDLNLQNNT-CESDQAEPKSIDFNNSAGIFMLTIAIYLLGGLFLMMEIICNRFIKRK 396          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000080367.1 (SMESG000080367.1)

HSP 1 Score: 375.555 bits (963), Expect = 4.135e-118
Identity = 184/402 (45.77%), Postives = 253/402 (62.94%), Query Frame = 1
Query: 1063 LNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWFLEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIY 2268
            +++  ++F NKTIKIC++E  PF T+ NKS  +  DN+SGF+ KI+ HL+K  +F+  IY   DG  G  I  +  FSGCVG+VQ K A  AAS FTF  +R +V+DY+YP MS+   II+  P   S W+N   +  + +W +    +  VS    + C+  PFSAWNL L+FA+ DEIQ  E+ WT  G F MQGQ+FY+YPIS+R V+A WW+ + I+ ++++ADL S LT DT  KLPNTL+E A   DI L+L +G +    +  S D V Q L +KS  VP C  LLLN + +N ACI D S + Y+   +CSRF  +QE V S +VGF  PK  +FK   D EIQ L  +G+I+ WFLEDL   +N+ C  +N +P PI F+ S GI+F+   IY
Sbjct:  350 ISTTKYSFRNKTIKICSMEYVPFFTKYNKSLPYSKDNISGFLAKIIKHLAKEFQFQFEIYEPLDGQSGVRIKNKTIFSGCVGEVQTKNASFAASTFTFNDERMTVIDYSYPFMSESQIIIFQNPLPKSHWWNPFLSFKVSVWALTFGSLAFVSILAMVFCRWGPFSAWNLKLQFAVRDEIQLGEHLWTSTGVFFMQGQNFYAYPISSRFVTASWWILTAILHSIYAADLASILTIDTERKLPNTLQEVADSEDITLHLSSGYAITAYLKSSNDPVQQALYSKSKFVPQCYDLLLNAETHNVACIADNSQMSYIKSLNCSRFTILQEIVKSTLVGFFFPKLVDFKNDFDKEIQLLGDKGVIRKWFLEDL---SNSTCGSQNYVPIPINFDKSAGIYFVTLMIY 748          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000080411.1 (SMESG000080411.1)

HSP 1 Score: 349.362 bits (895), Expect = 7.721e-112
Identity = 172/389 (44.22%), Postives = 250/389 (64.27%), Query Frame = 1
Query:  952 QVWTSVNSSQSMSRILSINGNLKMTFEDAS--RNSSQVPLNSNPFNFSNKTIKICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAADGTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMSDPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSPFSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFWWMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSAANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLVEKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAE 2112
            ++W   N  ++   ++++N N  + +  AS  +      ++S  ++F NKT+ IC +E  PF+   NKS +F++DN+SGF++KI+ HLS  LEF   +Y   DG YG  I  +  ++GCVG+VQ K A  AA  FTF  +R+ VVDY+YP+M+DP  +IY  P     W+N   +    +W++  + M L+   TTL CK +PFSAWNL L F I DEI F+E+ WT IG+F MQGQDFY+YPIS+R+V+A WW+ S I+LAV+SADLTS LT + G  +P+TLE  A  ++IIL+L  G +++  I KS+D V+QK+ AKS  VP C  LL N +  N ACI+D S  RY    +CS++  + E +++   GF+IPK S+FK  +D E
Sbjct:   87 EIWNRFN--KTFQLVMTVNKNFTL-YSSASIEKYFETKSISSKKYSFQNKTLSICALEYIPFLKIINKSRSFNMDNISGFLVKIIKHLSLKLEFLPDVYQPHDGQYGVKIENKTIYTGCVGEVQVKNASFAAGCFTFNEERNQVVDYSYPLMTDPQIVIYKNPLPKVHWWNPFLSFKAPVWILTFLSMFLIGVITTLFCKFTPFSAWNLKLNFCIKDEIMFAEHIWTSIGTFFMQGQDFYAYPISSRMVTASWWIVSAILLAVYSADLTSLLTLNNGPTMPDTLEGIADSDEIILHLTIGYASSANIKKSQDAVIQKMYAKSIFVPDCLALLTNPESENVACISDLSPSRYTKLLNCSKYTIVSEIIETTFTGFLIPKLSDFKEAIDRE 472          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA23.513e-3022.98glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA23.513e-3022.98glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIA23.839e-3022.98glutamate ionotropic receptor AMPA type subunit 2 ... [more]
GRIK36.937e-3023.08glutamate ionotropic receptor kainate type subunit... [more]
GRIK18.612e-3023.21glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-35.517e-2923.98GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-45.824e-2922.59GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-43.276e-2823.51GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-51.221e-2625.13GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-21.548e-2227.59Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ekar1.811e-3326.32gene:FBgn0039916 transcript:FBtr0110906[more]
KaiR1D1.197e-3222.60gene:FBgn0038837 transcript:FBtr0083987[more]
Ekar7.725e-3226.32gene:FBgn0039916 transcript:FBtr0344874[more]
CG111554.214e-3125.41gene:FBgn0039927 transcript:FBtr0333701[more]
CG111554.214e-3125.41gene:FBgn0039927 transcript:FBtr0089195[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LO018303.13.949e-3221.90glutamate receptor ionotropic, kainate 3 [Source:N... [more]
grik52.364e-3028.93glutamate receptor, ionotropic, kainate 5 [Source:... [more]
gria2a2.651e-3024.06glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a4.333e-3024.13glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
gria2a4.333e-3024.13glutamate receptor, ionotropic, AMPA 2a [Source:ZF... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria31.233e-3023.81glutamate receptor, ionotropic, AMPA 3 [Source:NCB... [more]
gria31.508e-3023.81glutamate receptor, ionotropic, AMPA 3 [Source:NCB... [more]
gria31.573e-3023.81glutamate receptor, ionotropic, AMPA 3 [Source:NCB... [more]
gria31.853e-3023.81glutamate receptor, ionotropic, AMPA 3 [Source:NCB... [more]
GRIK21.869e-3023.08glutamate receptor, ionotropic, kainate 2 [Source:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik11.939e-3023.42glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik12.075e-3023.42glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Gria22.590e-3022.98glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
Grik12.788e-3023.42glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik38.220e-3022.92glutamate receptor, ionotropic, kainate 3 [Source:... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R4M0|GRIA2_PONAB9.219e-3123.41Glutamate receptor 2 OS=Pongo abelii OX=9601 GN=GR... [more]
sp|P39086|GRIK1_HUMAN4.618e-2923.21Glutamate receptor ionotropic, kainate 1 OS=Homo s... [more]
sp|Q38PU4|GRIK1_MACFA4.824e-2923.21Glutamate receptor ionotropic, kainate 1 OS=Macaca... [more]
sp|P22756|GRIK1_RAT5.352e-2923.42Glutamate receptor ionotropic, kainate 1 OS=Rattus... [more]
sp|B1AS29|GRIK3_MOUSE5.750e-2922.92Glutamate receptor ionotropic, kainate 3 OS=Mus mu... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSX52.587e-6433.57PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1341.165e-6233.33PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8J0475.244e-6232.15PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8J1L92.534e-6132.20PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8J0R48.489e-6026.63PBPe domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK31.558e-3221.81glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.714e-3221.91glutamate ionotropic receptor kainate type subunit... [more]
GRIK37.663e-3223.80glutamate ionotropic receptor kainate type subunit... [more]
si:ch211-264f5.81.785e-3129.02si:ch211-264f5.8 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
si:ch211-251b21.16.291e-3128.94probable glutamate receptor [Source:NCBI gene;Acc:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000621.15.692e-2230.54pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
gria1b1.425e-2120.51glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.12.250e-1921.83pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000000889.12.747e-1430.88pep scaffold:Pmarinus_7.0:GL476542:184998:205948:1... [more]
ENSPMAT00000010716.11.451e-1325.85pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466331.154e-3125.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412917.626e-2724.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302031.627e-2124.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355453.080e-2022.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326232.942e-1726.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria3b1.594e-3023.79glutamate receptor 3 [Source:NCBI gene;Acc:1011719... [more]
ENSORLT00000001416.21.732e-3027.40glutamate receptor ionotropic, kainate 5 [Source:N... [more]
grik51.770e-3028.08glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.775e-3023.68glutamate ionotropic receptor kainate type subunit... [more]
ENSORLT00000045625.12.009e-3025.33glutamate receptor 1 [Source:NCBI gene;Acc:1011673... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073173.10.000e+090.85SMESG000073173.1[more]
SMESG000073173.10.000e+090.48SMESG000073173.1[more]
SMESG000073183.11.032e-13048.74SMESG000073183.1[more]
SMESG000080367.14.135e-11845.77SMESG000080367.1[more]
SMESG000080411.17.721e-11244.22SMESG000080411.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018098 ID=SMED30018098|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2410bp
AGTGAATATATAATTATAAAATAATTATTTCCAACGATAACTCATTTTGT
TATAATGAGACTTCAGATAATTCTGATTAACTTGTCTATATGCTGGGGGG
CAAATGTTAATATCGGAATTTTATCCGATTTTCCTTTATCGAATACCGAC
ATGGCAGTTTTCGGGTACTTTAACTTGACCCCTGTACACTTTCAAACGGC
CCTGGATATTTATAGAGAATTTGAGAAATTGTCACCAATCGCTGTGATCT
CTTTTAAAGGAACGAATAAAATTTCCAAGAAAATATTTAATCAAAGCAAA
ATTCCGTTCCTAGAGAACGAATTTAGCATCAGGAATGCCAGCTTCGAATC
AGATGAATATTCTATTCGACCACCGGATGTGACCATGTTGCGTTATATTC
TTTGTGATGTAATTGTCGGCTTTCTCACAACTAATCGTTTATATGTCATT
TATTCTCCTTTTTTCGAAAAACGAATGAAAATTCGAAATATTCTCCTCTG
TTATTCCAAAATTCAATATAAAATGCACATTTTTTCAATTAATTCCACGA
AGCAAATTTCGGATTTAATTTATGATTTAAAGTCAAAAAATATATTTCAA
ATTCTTTTGATTGTCGATGAAAAAATGACAATGGAAATTCTGAATTCCTT
AGAGAAAAATAATATTTTAGGAAAAAATTTCGCATGGATAATTATTGGAA
CTGTCGAAATAATCAAAAAAAATCCATTCAATTATAATGATACAAATATT
TACATTGTGTGTCAAGAAATGGTTTATTGGAATTCGTTCCTAGAAAATTC
AGCAATCGAAATGATGAAGGAAAATGGTTACGTTTATGCAAGCTTTATAA
TCAACTTTTTATCTATTACAAATTTATATCAAAATAAAGCTCAAAAAGAA
GAGGATTATTTGAGCTTTCTAAAACAATATTATCAAGAGGGGATTGCCTA
TCAAGTGTGGACCTCTGTCAACTCAAGTCAAAGCATGAGTCGAATATTAT
CAATAAATGGAAACTTGAAGATGACTTTTGAAGATGCCTCCAGGAATTCT
TCTCAGGTGCCTTTAAATAGCAATCCTTTCAATTTCAGCAATAAAACCAT
AAAAATATGCACTATTGAGAATAGCCCATTTGTTACAAGAAAAAACAAAA
GTGGAACTTTTGACATCGATAACATGTCTGGATTTGTAATTAAGATTTTA
CTACATTTATCCAAAACACTCGAGTTTAGAACATCAATTTACATAGCAGC
AGATGGCACATATGGGGGCCCTATTCCAAAGCAACAGTTCTTTTCTGGTT
GTGTCGGTGATGTTCAACAAAAGAAAGCTGAAATGGCTGCCAGTGTATTT
ACATTTACAAGTGACAGAAGTTCAGTGGTGGATTACACTTACCCGATCAT
GAGTGACCCTTTAGCAATTATTTATCATAGACCAAACGAATCCTCTAAGT
GGTTCAATGTTGTTTACGCATTAGATATGAAAATTTGGTTGATGATCCCG
ATATGCATGCTGCTGGTGTCCGGCACTACTACGTTGATATGCAAACACAG
TCCGTTTTCTGCCTGGAACTTAGGCTTAGAATTTGCTATTCTTGATGAAA
TACAGTTCAGTGAAAACTTTTGGACAGTCATTGGATCCTTCCTAATGCAA
GGTCAAGATTTCTATTCATATCCAATTTCTGCGAGAGTTGTTTCAGCATT
TTGGTGGATGTTTTCTGTAATTATATTAGCAGTATTTTCAGCCGACCTAA
CGTCGTATTTGACTACAGATACCGGATTGAAGTTACCAAATACATTAGAA
GAATTCGCAGCCAGAAATGATATAATTTTATATTTAGTTAATGGATCCTC
AGCAGCAAATATAATTATGAAATCTGAAGACAAAGTTTTGCAAAAGCTCA
GTGCAAAAAGCAATCTTGTACCATCTTGCAATAAATTGTTACTAAACAAG
GATATCAATAACGCAGCTTGCATAACGGATTACAGTTACGTGCGTTACCT
AGTTGAGAAAGACTGTTCGCGATTCGCCTATATCCAAGAATTTGTGGATT
CTGCAATTGTTGGATTTGTTATTCCAAAGTATTCTGAATTTAAATATTTA
CTGGATGCTGAAATACAAAAATTAAGTTCTCGTGGAATCATTCAAAATTG
GTTTCTAGAAGACTTAAATCAAAAGAACAACACGGTCTGTCTCTACGAAA
ATTCCATACCCGACCCAATTGGATTTAATATCTCATTGGGGATATTTTTT
ATTATTTATTCCATTTACTTAGGAGGAATCGTATTTATGAAAATAGAATT
CTCCCTCAGGAAAGCTTCAAAGAGAAGGAATAATTGCGATATCTTGAATT
AAATTCTAAAAATACTAGTAGTTAGATGATACTGTCAATTTGGTAATGCA
TTGGCATATG
back to top

protein sequence of SMED30018098-orf-1

>SMED30018098-orf-1 ID=SMED30018098-orf-1|Name=SMED30018098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=766bp
MRLQIILINLSICWGANVNIGILSDFPLSNTDMAVFGYFNLTPVHFQTAL
DIYREFEKLSPIAVISFKGTNKISKKIFNQSKIPFLENEFSIRNASFESD
EYSIRPPDVTMLRYILCDVIVGFLTTNRLYVIYSPFFEKRMKIRNILLCY
SKIQYKMHIFSINSTKQISDLIYDLKSKNIFQILLIVDEKMTMEILNSLE
KNNILGKNFAWIIIGTVEIIKKNPFNYNDTNIYIVCQEMVYWNSFLENSA
IEMMKENGYVYASFIINFLSITNLYQNKAQKEEDYLSFLKQYYQEGIAYQ
VWTSVNSSQSMSRILSINGNLKMTFEDASRNSSQVPLNSNPFNFSNKTIK
ICTIENSPFVTRKNKSGTFDIDNMSGFVIKILLHLSKTLEFRTSIYIAAD
GTYGGPIPKQQFFSGCVGDVQQKKAEMAASVFTFTSDRSSVVDYTYPIMS
DPLAIIYHRPNESSKWFNVVYALDMKIWLMIPICMLLVSGTTTLICKHSP
FSAWNLGLEFAILDEIQFSENFWTVIGSFLMQGQDFYSYPISARVVSAFW
WMFSVIILAVFSADLTSYLTTDTGLKLPNTLEEFAARNDIILYLVNGSSA
ANIIMKSEDKVLQKLSAKSNLVPSCNKLLLNKDINNAACITDYSYVRYLV
EKDCSRFAYIQEFVDSAIVGFVIPKYSEFKYLLDAEIQKLSSRGIIQNWF
LEDLNQKNNTVCLYENSIPDPIGFNISLGIFFIIYSIYLGGIVFMKIEFS
LRKASKRRNNCDILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004971AMPA glutamate receptor activity
GO:0015277kainate selective glutamate receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0032281AMPA glutamate receptor complex
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0035725sodium ion transmembrane transport
GO:0060079excitatory postsynaptic potential
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 727..751
score: 24.0
coord: 477..502
score: 26.54
coord: 545..572
score: 32.14
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 348..702
e-value: 0.004
score: -67.4
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 475..618
e-value: 4.6E-16
score: 59.0
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 358..422
e-value: 0.003
score: 26.8
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 347..460
e-value: 1.5E-21
score: 76.7
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 452..669
e-value: 3.6E-62
score: 212.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 69..107
e-value: 2.2E-9
score: 39.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 462..744
e-value: 3.6E-62
score: 212.2
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 372..720
e-value: 3.6E-62
score: 212.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 108..235
e-value: 2.2E-9
score: 39.1
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 307..702
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 307..702
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.584
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 346..699
NoneNo IPR availableTMHMMTMhelixcoord: 541..563
NoneNo IPR availableTMHMMTMhelixcoord: 477..496
NoneNo IPR availableTMHMMTMhelixcoord: 722..744