Talin-1

Overview
NameTalin-1
Smed IDSMED30018086
Length (bp)13480
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Talin-1 (SMED30018086) t-SNE clustered cells

Violin plots show distribution of expression levels for Talin-1 (SMED30018086) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Talin-1 (SMED30018086) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Talin-1 (SMED30018086) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018086

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30018086SMESG000019748.1 dd_Smed_v4_2028_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018086SMESG000019748.1 dd_Smed_v4_2028_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018086SMESG000019748.1 dd_Smed_v4_1233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018086SMESG000019748.1 dd_Smed_v4_1233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018086SMESG000019748.1 dd_Smed_v4_1233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018086SMESG000019748.1 dd_Smed_v4_1233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018086SMESG000019748.1 dd_Smed_v4_7313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30018086SMESG000019748.1 dd_Smed_v4_7313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018086SMESG000019748.1 dd_Smed_v4_7313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30018086SMESG000019748.1 dd_Smed_v4_7313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018086SMESG000019748.1 Contig26420newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018086SMESG000019748.1 Contig26420uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018086SMESG000019748.1 Contig45333uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018086SMESG000019748.1 Contig45333newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30018086SMESG000019748.1 dd_Smed_v4_7313_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v6_876_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018086SMESG000019748.1 dd_Smed_v4_2028_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018086SMESG000019748.1 dd_Smed_v4_1233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018086SMESG000066444.1 SMESG000060705.1 dd_Smed_v4_876_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Talin-1 vs. Ensembl Human
Match: TLN1 (talin 1 [Source:HGNC Symbol;Acc:HGNC:11845])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 725/2432 (29.81%), Postives = 1223/2432 (50.29%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK---VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKK-MRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRS------RTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQ--IDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVT-DSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR 7263
            L + I   +V K +  +P   ++  C  IR+ I EA    P  +GL+L  DD KKG+WL+  K L +Y+L+ GDT+EYR + R L IR +DGT KT+ VDDS TV+++++T+C ++GI N+DEYSL+ + M+     + T ++++  ++ +D++K++KLK+K HT+D LNWL+  ++LR+QG+EE E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G ++  K K GFLDL++ LPKEY K  +  E+KIF  H     +SE+EAK +Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+   +              M S AS         + +Q           +G        +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G+D AS+ W    +D S+  +  ++ A+ A  A V+    G          +  E     +  + + I+ +L  +   ++  A     L DE  SG  L+ AAK LA A + L+++A P   + R    + +  AA  VG+AS +LLQQI E                   ++ D  +Q+ L++LAK+VA+    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++ TK+VAPTI   VCQEQL+ +   V+KA++  V +S  AT+  +L      AA  V +AL+ L++H++           +  A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK      D    +  LREA E   + T        I+++++  L  AA++AA + T  I  +  AA   +AS      +    + ++ QI  L+  ++ ++  P    AQL LIAA + ++ P  ++  + K   PT+ D +    L+Q       A  EL+    +A   C  L++ +AL  ++ LE++L+ +K +     L PLP E  ++    L  S +   SA  Q          + E   G ++Y  +   DVAG         L  L  AARGVAA           +D  ++ +    +++   + +  A  L+ EAK +   P D +   R  Q +  ++ AL+ C+  LPGQRD+D   + +     +   + LP    +       +S L +     NQA  ELV A      ++G  + +  +  R  +  +  +    + +  A      +R  + + +  +S     LL   K +  +P    ++ QL  A + + DSIN+L+T + T   PGQKECD  +  LE++R +L+NPV PI+   YF CLD +++ + + L +++  I    K+ N  +F D+I   + ++C   E  AQ AYLVGV D  S+ G +GL + T F +  + I   CQ++  P  T  Q    ++S A  +A+++  LC + +  +   + P  K +     K    + + L+  ++ L+  F E+NR +  + +  + + V  L     + +F+   A IS E + +  PI  +  T+L++A  +IQ ++AL  +  +   +   +   + ++D++K LI+++++ APGQ EC+            A +S ++ +   S      +   R   S+E+    + +A+ ++ H I  L+ A + E  QL    S+  Q  E +  + + AA++T         L+   T+ E++ QLL   K++GGNPK  + H+Q  ++E  Q + E+ EDL   L++ +   G V  +V++IT++  ++ E  +   +  F + Q+ M+     +     ++ + +N+   +  L PL   LT  Y  L    + A     NE  G  ++  VQ +G    +LV     ++  PS A +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +   +RE     E F   R  ++  +  LV + K++V         L ++A     T   LA+ VK+G   L +   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   K  +A++                   I +E +   SP    + S            PE+  R+   +     K +   +       RQE++   +    +   ++  ACK    +  V  D + + L+   +    Y ELL +  L L  P+ E +
Sbjct:    4 LSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELME-EKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVK--QKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAI--------------MRSGASGP-------ENFQ-----------VGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG----------DPAETDYTAVGCAVTTISSNLTEMSRGVKLLAAL---LEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDTDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT-NAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQL---------LGEVAQGNENYAGIAARDVAG--------GLRSLAQAARGVAAL---------TSDPAVQAI----VLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLP---PSTGTFQEAQSRLNEAAAGLNQAATELVQA------SRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQ--EDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENS-KVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQ----VLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECE--------TAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPK-QAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEE--LGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTL---NREGT---ETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALE--------------ATTEHIRQELAVFCSPEPPAKTST-----------PEDFIRMTKGITMATAKAVAAGNS-----CRQEDVIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELK 2266          
BLAST of Talin-1 vs. Ensembl Human
Match: TLN2 (talin 2 [Source:HGNC Symbol;Acc:HGNC:15447])

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 717/2424 (29.58%), Postives = 1234/2424 (50.91%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMI------MSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKE 7257
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++   +  R+  +E   V       + SS                            +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A   D   DE  SGE+L+ AA+ LA A ++L+KA  P   + R    + +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ A+  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS               +  A   ++++  + ++ +  L+ EAK    +P D ++  R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       + + +      +S     LL   K +  +P     +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +LDNP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +F    A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +D++  L++ + + G V  +V+ I ++ +K+ E      K  F + Q+ ++   Y      T       S +    L  L   +T  Y  L    Q A AT   E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +++ +ACK    +  V+D  + + L    +    Y +LL++  + L  PT E
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQ--QFNRTGKAEHGSVALPAVMRSGSS--------------------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMD---DEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPR----QTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS-------------TTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK--YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------SETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------ECIKQELTVFQSKDVPEKTS-----------SPEESIRMTKGITMATAKAVAAGNS-----CRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPE 2265          
BLAST of Talin-1 vs. Ensembl Human
Match: MAST4 (microtubule associated serine/threonine kinase family member 4 [Source:HGNC Symbol;Acc:HGNC:19037])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 312/555 (56.22%), Postives = 401/555 (72.25%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            ++PRS+SL+P RSP   + +I ++NHVYKERFPKAT QM ERL  ++     +N +   + +    H QI++  +D L+ ++   ITS YF EL   L+KLL+E   +     LA ++ +V+ +L +IARPARLLEC+EFDP+EFY LLE AE + +    ++TD+P+YIIS+LGL+KDP     EE+      + G+ E                     + ES +S   S      P+ESDFE IKLISNGAYGAV+ VR K++++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV +YC+FETR++LCM+MEYVEGGD ATL+K++GPLP ++ARMYFAETVLALEYLHN+GIVHRDLKPDNLL+T  GHIKLTDFGLSKVGLM++TT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG +IS EI WP+  D   P +A +LIT LL+++PL RLG  G +EVK+H FF  +DW  LLRQKA FIP L+ EDDTSYFD R+ +Y H
Sbjct:  160 MRPRSRSLSPGRSPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDNVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPL----EEMAHLGNYDSGTAETPE------------------TDESVSSSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEINWPEK-DEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHH 691          

HSP 2 Score: 109.768 bits (273), Expect = 1.266e-22
Identity = 48/99 (48.48%), Postives = 69/99 (69.70%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            IVIH   +N+GF IRAIRV+ G+S++YT+HH++  V+    A QAGL+ GDLITHING  + G  HTEV+ ++++SG  +S+   P   + I+T GP R
Sbjct:  953 IVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKT-GPAR 1050          
BLAST of Talin-1 vs. Ensembl Human
Match: MAST4 (microtubule associated serine/threonine kinase family member 4 [Source:HGNC Symbol;Acc:HGNC:19037])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 312/555 (56.22%), Postives = 401/555 (72.25%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            ++PRS+SL+P RSP   + +I ++NHVYKERFPKAT QM ERL  ++     +N +   + +    H QI++  +D L+ ++   ITS YF EL   L+KLL+E   +     LA ++ +V+ +L +IARPARLLEC+EFDP+EFY LLE AE + +    ++TD+P+YIIS+LGL+KDP     EE+      + G+ E                     + ES +S   S      P+ESDFE IKLISNGAYGAV+ VR K++++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV +YC+FETR++LCM+MEYVEGGD ATL+K++GPLP ++ARMYFAETVLALEYLHN+GIVHRDLKPDNLL+T  GHIKLTDFGLSKVGLM++TT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG +IS EI WP+  D   P +A +LIT LL+++PL RLG  G +EVK+H FF  +DW  LLRQKA FIP L+ EDDTSYFD R+ +Y H
Sbjct:  349 MRPRSRSLSPGRSPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDNVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPL----EEMAHLGNYDSGTAETPE------------------TDESVSSSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEINWPEK-DEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHH 880          

HSP 2 Score: 109.768 bits (273), Expect = 1.525e-22
Identity = 48/99 (48.48%), Postives = 69/99 (69.70%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            IVIH   +N+GF IRAIRV+ G+S++YT+HH++  V+    A QAGL+ GDLITHING  + G  HTEV+ ++++SG  +S+   P   + I+T GP R
Sbjct: 1142 IVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKT-GPAR 1239          
BLAST of Talin-1 vs. Ensembl Human
Match: MAST4 (microtubule associated serine/threonine kinase family member 4 [Source:HGNC Symbol;Acc:HGNC:19037])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 312/555 (56.22%), Postives = 401/555 (72.25%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            ++PRS+SL+P RSP   + +I ++NHVYKERFPKAT QM ERL  ++     +N +   + +    H QI++  +D L+ ++   ITS YF EL   L+KLL+E   +     LA ++ +V+ +L +IARPARLLEC+EFDP+EFY LLE AE + +    ++TD+P+YIIS+LGL+KDP     EE+      + G+ E                     + ES +S   S      P+ESDFE IKLISNGAYGAV+ VR K++++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV +YC+FETR++LCM+MEYVEGGD ATL+K++GPLP ++ARMYFAETVLALEYLHN+GIVHRDLKPDNLL+T  GHIKLTDFGLSKVGLM++TT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG +IS EI WP+  D   P +A +LIT LL+++PL RLG  G +EVK+H FF  +DW  LLRQKA FIP L+ EDDTSYFD R+ +Y H
Sbjct:  155 MRPRSRSLSPGRSPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDNVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPL----EEMAHLGNYDSGTAETPE------------------TDESVSSSNASLKLRRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEINWPEK-DEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHH 686          

HSP 2 Score: 109.768 bits (273), Expect = 1.320e-22
Identity = 48/99 (48.48%), Postives = 69/99 (69.70%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            IVIH   +N+GF IRAIRV+ G+S++YT+HH++  V+    A QAGL+ GDLITHING  + G  HTEV+ ++++SG  +S+   P   + I+T GP R
Sbjct:  948 IVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKT-GPAR 1045          
BLAST of Talin-1 vs. Ensembl Celegans
Match: tln-1 (TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9])

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 670/2512 (26.67%), Postives = 1181/2512 (47.01%), Query Frame = 1
Query:   43 GNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISD--------------------------KMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGF-LDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRK--KAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIR---QKLYIISLQDNLDTIQKYKDQLMIENK--GPEIGKDEASQQWI----YVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKAT-QSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQ-VIDHLLVAARKAATTGTHLINTSLSAAK--KSRASNFKVCNDGRELSNQISNLIVAIKEARR---DPKDHL-AQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAAL----EQLKRLEQNL-KSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDML--SKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHL--SSNRDHIANGVMIMSEDCQ----TLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRL--LTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ-DSSLMISTAGQIAENSRKLCEASKTI--MISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKM------KIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQT-DLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAK--VQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADI-QNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLT-NPTKE--TRIPVET---VVSKLNELIKLLRDQVNL 7332
            G   L +   +  + K +  +P   I+   + IR+        +   YG++   ++  K LW+DN +T +HY+++  D IEY+ + R L +R +DG  KT+ VD+S  VS+LM+TVC K+GI NY+EYSL+ D                          K   S   D+      G    K+++KL++L+KK HT++ L WL+ +++LR+QGI E E L+L+RKYFFSD NVDSRDP+QL+LLY Q +D ++ G HPV    A +LA LQ  +Q G++  DK  P F LD R+ LPKEY KN K  EKK+   + +    SE++AK KY  LCR  KTYG+TFF+VKEK+ GKNKL+PRLLGVNKESV++VDE +K+I+  WPL  +R+W  S   F++DFG+Y  D YY+ QT  GE+I+QLI GY+DIILK+K+ +DH G++ DE S M E+ +AP+KA +V H         ++  V +R   +         +N     +V  +  +   QE          L R Q             R+   D+    Q+  I +++  +  ++  + +L  E +   P    D +  +W+     VN +N  +R+A    AM AA AQV++                 EE   ++  + + I  +LP +   +R    + +     D     L+ A K+L  AF   +    P E + R   R E+F  A  VGE S  L+  + E  N                 E  Q + E L++ AK+VA  T  L+   K I+ E + P  Q++V+ +AT+   A SQL++  ++VAPTI+ + CQ+QL  +  +V++++  ++  +  A  Q   L D+  +AA QV  ALD+L++H +               Y  +    +             R A+        +  +  +E ++ PE R++L++AA ++A AT+ +I + +       ++   Y LR A ER   V  T E     QEQ ++  L  AA++ A   T  I+ + SA    +SR+    +  +  + +  + NLI +I+E+++    P +   AQ  LI      ++ S +L ++ +   P VSD  L ++L+QS N+   +  +L+  V+ A    Q L+ S  L    E +K L+  L  + K +I RE L P+ +  S   ++ L+ +    GS   Q         +    T+ +D Y     +++A Q  R+ + A+  +V                +   D  L+KL            + +AR +V E+          DR ++ S       +    S   ++ +  L  +KHIE   H+       IQ  +    +N R        +  QA N+ + A S  +V  G    R       E  ++ V    D   S +  L   SN +++   ++   E+ Q     +L+ +++    P +  + +Q    T+ L  ++N+L  L+ +       Q+ECD  + R++++  +  +   P++   YF  L  + D + + L +++  +    K  + + F  S+   AD++C L E  + +AYLVG+    S  G   L D +   +  + I+ +CQ +      +RQ +   ++S    I + S  L +  +        PN K  L           S L+T  ++L++  + ++R    S + +++    +L+       FA     IS E   +Q PI  +   +LD++ ++IQ +K+  S+  +E  +   + + + ++D++  L++ I E+APGQ E + A+  L+ L  Q   S M       + KH +        +E      +Q    Q+   +++L  A  +  E+L ++     Q++E + ++  CAA  T D  Q + ++ +   T++EA   ++ A ++SGGNP A   H+ + + A  +  +  D+   + K+S +QG V  +V+TI+ S A   V  S+  P  S F ++Q++M     D+     ++ +   ++     L   + NL+++Y  +    + A   L   + G++L+  VQ +G   I  V      R  P        L ++   + +R++ V+  L S++ GTQAC  A   +  I  D+DT+I+F  S  +  +DDR++ S KE       +++  +  LV + K +V+    +   L  +A     T  +L++ VK G   L+S  S+  + ++ + ++V  +L S ++  +N SGL    P   +LK+  K  ++ +  LLK + ++++ N +  +A++ A+                   +A   E     + L+ G+ I     F PE + +    ++ +  ++++ +     P   +E I V ++S S V + L +  + +  +      +   L++   +  N   LL +    +  NP +E   R+ +E    V S L+ L+ L  +   L
Sbjct:    2 GVLSLTVSSAEKGIKKTMQFEPSTLIYDAAKLIREKF-AMHDVNANEYGIFRLDENPSKSLWMDNGRTFEHYLVRNKDEIEYKRKIRLLKVRMLDGAVKTISVDESQPVSQLMMTVCNKIGISNYEEYSLVRDDILMQNGGGGGGGGGQNGGSTWNLKEKESRSKSSDRGGGGIYGTMRKKNEQKLEELRKKLHTDEELPWLDHTKTLREQGITEEETLILRRKYFFSDSNVDSRDPVQLNLLYVQCRDGILRGLHPVEKETAFQLAALQSHIQYGDFPYDK--PKFHLDGRDVLPKEYAKN-KENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGVTFFVVKEKLPGKNKLVPRLLGVNKESVMRVDENSKQILKEWPLEQVRRWVPSAKCFSLDFGDYQ-DGYYSVQTTDGEKIAQLIQGYVDIILKKKRTQDHQGIEGDEGSTMLEDMVAPAKATLVAHGQIGSGQHATDGLVAVRGVLRTPQGGQGYGINGAQYGAVSGEITS---QE----------LARAQ-------------RLRYQDMYQHPQRALIGTIEATIRAVEDAEIELEAEPQIDIPRFNDDYSQNRWMEEQQAVNKENVNERLA----AMGAATAQVVQ-------------WTAVEEYDDRVGTAIATIGSNLPDVSRNVRDLGAFMEHRERGD-----LLDATKKLCGAFGKFLNTVNP-ETEAR---RNEVFRTAGHVGETSQHLI-NVMEAPN-----------------EGQQKFDERLVQSAKNVATSTAQLVLCAKTISAECDEPQVQERVIQSATKCAFATSQLVACARVVAPTIDNNACQQQLSTAATEVTQSVNNLLHDAEHAVYQQSSLTDIH-EAARQVTSALDSLLEHAKCSPKTQTTRREEEEMYNEVLRRTNRMVVHQGPSEDLTREARKVVRHSQLLTEQFQHEAHQRPEHRERLLDAAAKVAHATSEMILATEQAESQPRQVETEYALRTAAERLGQV--TNETTQEQQEQHIMQRLEQAAKQTAYDATQTISAANSAKDVIESRSYKENLVYESTQTAGHLPNLITSIRESQKVDNTPGEKFKAQSRLIRDSYKVLETSVRLFETARTAVPMVSDSHLASSLDQSANRLGTSLADLRTSVNDA----QQLNFSQQLLYSEELIKELDDQLVNTQKRAIARE-LPPIQNATSFSVSSKLMATTSNVGSGVAQL--------ITAAATSNDDKYVGTSAVELA-QGLRDFTDAITEIV----------------TVRTDIQLDKL------------IVSARSVVHESGRV------FDRVREKSAPTVLTDAAMNVSTSLKQVISCLPDTKHIEKAIHE-------IQTAHTS--ANIRP------MEVRQAANKFIEATSQLVVTIGSPDSR-------EAVDIFVRAYCDLHGSVVAQLQRQSNMNNVKTAIIDRLEEAQRGSIGVLETLRQA-GNPSDHTLSQQFTSKTRELATTVNQLVELSGMDGGESRWQRECDAALRRIQAVYHVTQHANVPLNDNGYFASLQSVSDGS-RRLGEAMTGMARHAKGNDTEGFCTSVRDSADALCSLAESASHSAYLVGISHPASSPGRAALIDSSEVARSVESINASCQRV-----ESRQLNREELMSDISSITKQSSSLAQLCRIASEKTQNPNVKKHLVGCAMGVASKTSSLVTAFKDLDRMPDAESR--CTSSASELRQVALQLLHFADKPDFAAIQGSISTEGHSAQQPILQSSREMLDSSAQMIQTAKSWASAPQDEATWQRMAVNSRQVSDSIMRLVNAIHEAAPGQMELEAAIGRLSALSGQIERSAMDCYASGNVQKHGA-------NAERQLLQQVQHIASQLEDKVDDLHNAAVEHGERLPKVVQLHCQMVEDLADAACCAAGMTVDSNQQTELF-DKCKTVVEAELAMMVASRESGGNPNAVHAHANVKDAAGQLKHAIGDMRQTIAKVSSEQGAVQGMVDTISSSIAHTDVAVSSAHP-GSSFADAQTRMTAYLEDIRRTAIEMPTLNTTD-----LGAASLNLSEKYRLVAGDVRQAAGMLPEADIGQRLKLAVQKLGTSCIETVTVAGGKRAHPEDERIQRQLSSQAGTVVERVEQVLAALHSASRGTQACINAANTVSGIIGDLDTTIMFATSGSLNSSDDRKFPSHKE-------AIVKTAKALVEDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKTGAVSLSSENSETQVLVIHAVRDVAAALTSLIQATKNASGLSLQHPAMGHLKDAAKVMVSNVARLLKTVATVEEKNQQGTRAVEAAV-------------------DAIGFEMKQFEHDLNEGAAIPTD--FRPEHLQQTAEHVSEITKRVMQGADA---PQSEEEIIGVANLSRSAVRS-LLAVVRTISNDADTAPQRYAVLDSGRDVANNVKSLLVSLHTQMVRNPGQEESRRLLLEASKGVSSALSHLVGLCNEMTGL 2310          
BLAST of Talin-1 vs. Ensembl Celegans
Match: kin-4 (KIN-4 protein; Protein KINase [Source:UniProtKB/TrEMBL;Acc:G5EFA4])

HSP 1 Score: 533.872 bits (1374), Expect = 3.643e-157
Identity = 263/503 (52.29%), Postives = 350/503 (69.58%), Query Frame = 1
Query: 9748 SRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC-PESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQT-------DVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESV-LNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA-EGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESES 11226
            +R +H QI++   D L  +  + IT +YF E++Q LE+ L E ++K  PESL  +  +V+ LL I++RPARLLEC+EFDP EFY LLE AE  +R           D+P+YII KLGLD+DP    +E +++S   +  +              T +    +  QE+N +          P E DF+ I+L+SNGAYGAV+LVR ++T++RFA+KK+ K  L+LRNQV+Q+FAERDI+T AD+PFVV  Y +FETR+YLCM+MEYVEGGD A L+KS G LP EL R+Y AET+LA+EYLH++GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMN TT + E      +   FQDKQ+ GTP+YIAPEVILR+GY K +DWWA+GIILYEF+VG  PF+G++ E LF  +IS ++E+P++ D  +P  A +L   LL+++P  RLG   G  ++  HEFF  +D+  LLRQKA F+P LD+E+DTSYFD RT RY HE+ES
Sbjct:  392 TRFLHHQIVEIALDCLGKSKDDLITCSYFCEMSQRLEETLNEAQMKTSPESLEYLSKLVKKLLMIVSRPARLLECLEFDPDEFYHLLEEAEGVVREQLGSGTARVPDLPQYIIGKLGLDRDPLIDSTEHVDSSENTHATT-----------SGTTSAKGAGSAWQETNRA----------PCEDDFDTIRLVSNGAYGAVYLVRHRETRQRFALKKMNKQTLMLRNQVDQVFAERDILTMADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEYLHSYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAEGYDAVVETQQFQDKQLCGTPEYIAPEVILRRGYGKPVDWWALGIILYEFLVGIVPFFGETPEALFSKVISEDVEYPEE-DEALPPEAADLCRRLLEKNPAERLGTLNGAAQLMAHEFFILLDFTSLLRQKAEFVPQLDNEEDTSYFDTRTDRYNHEAES 872          

HSP 2 Score: 78.1814 bits (191), Expect = 1.499e-13
Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGE-SNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQ 12471
            I I +    FGF ++++RV+ GE S  YT+ H++  V     AF A L+  D+ITH+NG  +    H +++  ++ +G  + LR++P+  + IR     R  GKMA K  P++ Q
Sbjct: 1173 ITIRKGPFGFGFTLKSVRVYLGEHSEYYTIEHIVTAVVEGSPAFHANLQAEDMITHVNGHPVHNLTHPQLMHRLLANGNELILRLVPLANTSIREGAARRTVGKMARK-KPKRPQ 1286          
BLAST of Talin-1 vs. Ensembl Celegans
Match: kin-4 (KIN-4 protein; Protein KINase [Source:UniProtKB/TrEMBL;Acc:G5EFA4])

HSP 1 Score: 528.48 bits (1360), Expect = 7.039e-157
Identity = 263/503 (52.29%), Postives = 350/503 (69.58%), Query Frame = 1
Query: 9748 SRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC-PESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQT-------DVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESV-LNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA-EGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESES 11226
            +R +H QI++   D L  +  + IT +YF E++Q LE+ L E ++K  PESL  +  +V+ LL I++RPARLLEC+EFDP EFY LLE AE  +R           D+P+YII KLGLD+DP    +E +++S   +  +              T +    +  QE+N +          P E DF+ I+L+SNGAYGAV+LVR ++T++RFA+KK+ K  L+LRNQV+Q+FAERDI+T AD+PFVV  Y +FETR+YLCM+MEYVEGGD A L+KS G LP EL R+Y AET+LA+EYLH++GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMN TT + E      +   FQDKQ+ GTP+YIAPEVILR+GY K +DWWA+GIILYEF+VG  PF+G++ E LF  +IS ++E+P++ D  +P  A +L   LL+++P  RLG   G  ++  HEFF  +D+  LLRQKA F+P LD+E+DTSYFD RT RY HE+ES
Sbjct:  206 TRFLHHQIVEIALDCLGKSKDDLITCSYFCEMSQRLEETLNEAQMKTSPESLEYLSKLVKKLLMIVSRPARLLECLEFDPDEFYHLLEEAEGVVREQLGSGTARVPDLPQYIIGKLGLDRDPLIDSTEHVDSSENTHATT-----------SGTTSAKGAGSAWQETNRA----------PCEDDFDTIRLVSNGAYGAVYLVRHRETRQRFALKKMNKQTLMLRNQVDQVFAERDILTMADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEYLHSYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAEGYDAVVETQQFQDKQLCGTPEYIAPEVILRRGYGKPVDWWALGIILYEFLVGIVPFFGETPEALFSKVISEDVEYPEE-DEALPPEAADLCRRLLEKNPAERLGTLNGAAQLMAHEFFILLDFTSLLRQKAEFVPQLDNEEDTSYFDTRTDRYNHEAES 686          

HSP 2 Score: 77.7962 bits (190), Expect = 2.353e-13
Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGE-SNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQ 12471
            I I +    FGF ++++RV+ GE S  YT+ H++  V     AF A L+  D+ITH+NG  +    H +++  ++ +G  + LR++P+  + IR     R  GKMA K  P++ Q
Sbjct:  987 ITIRKGPFGFGFTLKSVRVYLGEHSEYYTIEHIVTAVVEGSPAFHANLQAEDMITHVNGHPVHNLTHPQLMHRLLANGNELILRLVPLANTSIREGAARRTVGKMARK-KPKRPQ 1100          
BLAST of Talin-1 vs. Ensembl Celegans
Match: kin-4 (KIN-4 protein; Protein KINase [Source:UniProtKB/TrEMBL;Acc:G5EFA4])

HSP 1 Score: 529.635 bits (1363), Expect = 8.709e-156
Identity = 263/503 (52.29%), Postives = 350/503 (69.58%), Query Frame = 1
Query: 9748 SRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC-PESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQT-------DVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESV-LNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA-EGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESES 11226
            +R +H QI++   D L  +  + IT +YF E++Q LE+ L E ++K  PESL  +  +V+ LL I++RPARLLEC+EFDP EFY LLE AE  +R           D+P+YII KLGLD+DP    +E +++S   +  +              T +    +  QE+N +          P E DF+ I+L+SNGAYGAV+LVR ++T++RFA+KK+ K  L+LRNQV+Q+FAERDI+T AD+PFVV  Y +FETR+YLCM+MEYVEGGD A L+KS G LP EL R+Y AET+LA+EYLH++GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMN TT + E      +   FQDKQ+ GTP+YIAPEVILR+GY K +DWWA+GIILYEF+VG  PF+G++ E LF  +IS ++E+P++ D  +P  A +L   LL+++P  RLG   G  ++  HEFF  +D+  LLRQKA F+P LD+E+DTSYFD RT RY HE+ES
Sbjct:  389 TRFLHHQIVEIALDCLGKSKDDLITCSYFCEMSQRLEETLNEAQMKTSPESLEYLSKLVKKLLMIVSRPARLLECLEFDPDEFYHLLEEAEGVVREQLGSGTARVPDLPQYIIGKLGLDRDPLIDSTEHVDSSENTHATT-----------SGTTSAKGAGSAWQETNRA----------PCEDDFDTIRLVSNGAYGAVYLVRHRETRQRFALKKMNKQTLMLRNQVDQVFAERDILTMADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEYLHSYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAEGYDAVVETQQFQDKQLCGTPEYIAPEVILRRGYGKPVDWWALGIILYEFLVGIVPFFGETPEALFSKVISEDVEYPEE-DEALPPEAADLCRRLLEKNPAERLGTLNGAAQLMAHEFFILLDFTSLLRQKAEFVPQLDNEEDTSYFDTRTDRYNHEAES 869          

HSP 2 Score: 77.7962 bits (190), Expect = 2.339e-13
Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGE-SNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQ 12471
            I I +    FGF ++++RV+ GE S  YT+ H++  V     AF A L+  D+ITH+NG  +    H +++  ++ +G  + LR++P+  + IR     R  GKMA K  P++ Q
Sbjct: 1170 ITIRKGPFGFGFTLKSVRVYLGEHSEYYTIEHIVTAVVEGSPAFHANLQAEDMITHVNGHPVHNLTHPQLMHRLLANGNELILRLVPLANTSIREGAARRTVGKMARK-KPKRPQ 1283          
BLAST of Talin-1 vs. Ensembl Celegans
Match: kin-4 (KIN-4 protein; Protein KINase [Source:UniProtKB/TrEMBL;Acc:G5EFA4])

HSP 1 Score: 530.02 bits (1364), Expect = 2.971e-155
Identity = 263/503 (52.29%), Postives = 350/503 (69.58%), Query Frame = 1
Query: 9748 SRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC-PESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQT-------DVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESV-LNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA-EGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESES 11226
            +R +H QI++   D L  +  + IT +YF E++Q LE+ L E ++K  PESL  +  +V+ LL I++RPARLLEC+EFDP EFY LLE AE  +R           D+P+YII KLGLD+DP    +E +++S   +  +              T +    +  QE+N +          P E DF+ I+L+SNGAYGAV+LVR ++T++RFA+KK+ K  L+LRNQV+Q+FAERDI+T AD+PFVV  Y +FETR+YLCM+MEYVEGGD A L+KS G LP EL R+Y AET+LA+EYLH++GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMN TT + E      +   FQDKQ+ GTP+YIAPEVILR+GY K +DWWA+GIILYEF+VG  PF+G++ E LF  +IS ++E+P++ D  +P  A +L   LL+++P  RLG   G  ++  HEFF  +D+  LLRQKA F+P LD+E+DTSYFD RT RY HE+ES
Sbjct:  469 TRFLHHQIVEIALDCLGKSKDDLITCSYFCEMSQRLEETLNEAQMKTSPESLEYLSKLVKKLLMIVSRPARLLECLEFDPDEFYHLLEEAEGVVREQLGSGTARVPDLPQYIIGKLGLDRDPLIDSTEHVDSSENTHATT-----------SGTTSAKGAGSAWQETNRA----------PCEDDFDTIRLVSNGAYGAVYLVRHRETRQRFALKKMNKQTLMLRNQVDQVFAERDILTMADNPFVVSFYGSFETRQYLCMLMEYVEGGDCAALLKSAGTLPVELVRLYVAETILAIEYLHSYGIVHRDLKPDNLLITAMGHIKLTDFGLSKIGLMNRTTLVAEGYDAVVETQQFQDKQLCGTPEYIAPEVILRRGYGKPVDWWALGIILYEFLVGIVPFFGETPEALFSKVISEDVEYPEE-DEALPPEAADLCRRLLEKNPAERLGTLNGAAQLMAHEFFILLDFTSLLRQKAEFVPQLDNEEDTSYFDTRTDRYNHEAES 949          

HSP 2 Score: 77.411 bits (189), Expect = 2.578e-13
Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGE-SNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQ 12471
            I I +    FGF ++++RV+ GE S  YT+ H++  V     AF A L+  D+ITH+NG  +    H +++  ++ +G  + LR++P+  + IR     R  GKMA K  P++ Q
Sbjct: 1250 ITIRKGPFGFGFTLKSVRVYLGEHSEYYTIEHIVTAVVEGSPAFHANLQAEDMITHVNGHPVHNLTHPQLMHRLLANGNELILRLVPLANTSIREGAARRTVGKMARK-KPKRPQ 1363          
BLAST of Talin-1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0305210)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 685/2447 (27.99%), Postives = 1232/2447 (50.35%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLI-----SDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQE-DINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXA-YENI---QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK--VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNEL-VSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESE-ESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVE----TITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTT-EVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKP-IIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSK-LNELIKLLR 7317
              LRI +    VTK +   P  T+F  C+ IR    EA    P  YGL++  +  ++G+WL+  +TL +YIL   DT+EYR ++R L +R +DG  KT+ VDDS  VS+LM+ +CTK+GI N++EY L+     +   +       TL++KR I       K++ L+KK  T+D +NW++ S++LR+QGI+E+E +LL+R++FFSD N+DSRDP+QL+LLY Q +DA+++GTHPVT  +A E AG+Q  +Q G ++  K K GFLDL++ LP+ Y +  K +EKKIF++H K  DLSE++AK  Y    R   TYG+TFFLVKEK+ GKNKL+PRLLGV K+SV+++DE TKEI+ +WPLT++R+W AS N FT+DFG+Y+ ++YY+ QT + E+I QLIAGYIDIILK+K+ KDH G++ DE S M EE++APSKA  ++H   +       E + +   AH               +   D    Y E ++   +  + +G+        TT  +     +    Q+  +  +    D + +  ++L  +    E+G D  S +W    +D S+Q ++  +  M+AA AQ++ ++              +E     +  S S I   +P + +E+R  A     L + D SG++L+ AA+ L  AF++L+KAA P   +      + + +AA+ VGEA++ +L  I E+E                   E++   + LL LAK+VAN T  L+ + K IA   ++   + +V+ AA++  LA SQL++  K+VAPT+  + C+EQL  + ++V++A+  + E  N+A+   +L+   + AA  V ++L  +++H++    ++    +  L+  EN+    ++  S  D  ++V  AR L Q T  +I  I+ +A  +Q +  + +  L++AAKQLA+AT  L+++A+ C+ +  + + +  LR+A E    +T T      ++  +I  L   +++AA+  T  I+ + +A + S+    K  +  D + +++ I  L+ ++K  R  P D  AQL LI A   +I+P+ Q+S+S++ + PTV+D    T L++          EL     +A   C   +L +ALE++++L   L   + +     L PLP +  + +A  L KS +  G A +Q  +      V++ Q     SY        AG   R+ ++AL     +  GVAA+ +                    I++   + V ++  L+ +A+ +       +   QA   ++ ALS  +D +PGQR++D+  +++       + +  P        L   +SEL       + A  E+ VS  S  L+ +  +    +Y  ++ +   +     +E           R H+   +  +S    +LL   K I  +P     +  L  A + + +SIN+L+ + S    PGQKECD  +  +E++R +LD P  PI+   YF+C++    K+ + L  ++  +    K   + +F  S+ +  DS+  L+E ++Q AYL+GV    S  G  G+ D        + I ++C  + +  +T  Q    MIS    IA+++  LC   +  ++  S P  K +     K    A S+L+  ++ + +     +R   E L   + + V  + Q   S +F+   A IS E +++Q P+  AG  V+D  +E+++ +K+L  +  N  ++   S     +++++K L+  I++ APGQ +C++ L  L    ++     + +    ++ +S+  ++    +     ++  ++   +  +  AGK   EQL       ++ +  MVN  I A       Q     ++   +++E++  L+++ K+S GNP+A   H ++D+   G  E+ ++L   ++KI+ + G V  ++E    +IT+ + K Q          F + Q++M+    ++ +L  ++  NA S      L  L  ++TQ Y  L +   GA  T S+ +   +++  V  +G+   S+++S+    RP+ A +   +    +E+ +++  V+  L + + GTQAC  A   +  I  D+DT+I+F  +  + +D          F   R  ++  +  LV + K++V+      + L  +A     T   LA  VK G   L S+     + ++ + ++V  +L   +   +  SG    DP  Q+LKE  +  +  ++SLLK +K+++D + +  +A++  +                IS+E   + SP       +G          PE++ R+  ++     K +   +   +  I+   N+   +IS      E+   C+++  N   T+  + +TL     + E+Y +LL      L N + + R+ +   V+K + +L+ + R
Sbjct:    4 LSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRT-KGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRM------EQLNVESLAH------------PGIMRPYDGERSYMENEVQTVQYGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASH------------PDEVDTEAISASVSQIAQTIPEVTKEVRLIAA----LMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEP----PQHLINAASRVGEATTHVLSTIAEEE-----------------VPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGEA--DQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLS-----SVLHNQR----SY--------AGAAGRDTALALGDFTRSVHGVAATTQ-----------------NPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATL---QSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEE---------EVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLV-DASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFDCVEQATGKS-RNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ----MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSR---ERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAV---NAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM--NAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGS------FADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV--------------EAISQEIRAMHSPPPVGNTQVG----------PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAIS------EMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGI---LHNCSADDRMHLSRRVAKCVTDLVAMAR 2292          
BLAST of Talin-1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333105)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 685/2447 (27.99%), Postives = 1232/2447 (50.35%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLI-----SDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQE-DINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXA-YENI---QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK--VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNEL-VSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESE-ESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVE----TITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTT-EVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKP-IIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSK-LNELIKLLR 7317
              LRI +    VTK +   P  T+F  C+ IR    EA    P  YGL++  +  ++G+WL+  +TL +YIL   DT+EYR ++R L +R +DG  KT+ VDDS  VS+LM+ +CTK+GI N++EY L+     +   +       TL++KR I       K++ L+KK  T+D +NW++ S++LR+QGI+E+E +LL+R++FFSD N+DSRDP+QL+LLY Q +DA+++GTHPVT  +A E AG+Q  +Q G ++  K K GFLDL++ LP+ Y +  K +EKKIF++H K  DLSE++AK  Y    R   TYG+TFFLVKEK+ GKNKL+PRLLGV K+SV+++DE TKEI+ +WPLT++R+W AS N FT+DFG+Y+ ++YY+ QT + E+I QLIAGYIDIILK+K+ KDH G++ DE S M EE++APSKA  ++H   +       E + +   AH               +   D    Y E ++   +  + +G+        TT  +     +    Q+  +  +    D + +  ++L  +    E+G D  S +W    +D S+Q ++  +  M+AA AQ++ ++              +E     +  S S I   +P + +E+R  A     L + D SG++L+ AA+ L  AF++L+KAA P   +      + + +AA+ VGEA++ +L  I E+E                   E++   + LL LAK+VAN T  L+ + K IA   ++   + +V+ AA++  LA SQL++  K+VAPT+  + C+EQL  + ++V++A+  + E  N+A+   +L+   + AA  V ++L  +++H++    ++    +  L+  EN+    ++  S  D  ++V  AR L Q T  +I  I+ +A  +Q +  + +  L++AAKQLA+AT  L+++A+ C+ +  + + +  LR+A E    +T T      ++  +I  L   +++AA+  T  I+ + +A + S+    K  +  D + +++ I  L+ ++K  R  P D  AQL LI A   +I+P+ Q+S+S++ + PTV+D    T L++          EL     +A   C   +L +ALE++++L   L   + +     L PLP +  + +A  L KS +  G A +Q  +      V++ Q     SY        AG   R+ ++AL     +  GVAA+ +                    I++   + V ++  L+ +A+ +       +   QA   ++ ALS  +D +PGQR++D+  +++       + +  P        L   +SEL       + A  E+ VS  S  L+ +  +    +Y  ++ +   +     +E           R H+   +  +S    +LL   K I  +P     +  L  A + + +SIN+L+ + S    PGQKECD  +  +E++R +LD P  PI+   YF+C++    K+ + L  ++  +    K   + +F  S+ +  DS+  L+E ++Q AYL+GV    S  G  G+ D        + I ++C  + +  +T  Q    MIS    IA+++  LC   +  ++  S P  K +     K    A S+L+  ++ + +     +R   E L   + + V  + Q   S +F+   A IS E +++Q P+  AG  V+D  +E+++ +K+L  +  N  ++   S     +++++K L+  I++ APGQ +C++ L  L    ++     + +    ++ +S+  ++    +     ++  ++   +  +  AGK   EQL       ++ +  MVN  I A       Q     ++   +++E++  L+++ K+S GNP+A   H ++D+   G  E+ ++L   ++KI+ + G V  ++E    +IT+ + K Q          F + Q++M+    ++ +L  ++  NA S      L  L  ++TQ Y  L +   GA  T S+ +   +++  V  +G+   S+++S+    RP+ A +   +    +E+ +++  V+  L + + GTQAC  A   +  I  D+DT+I+F  +  + +D          F   R  ++  +  LV + K++V+      + L  +A     T   LA  VK G   L S+     + ++ + ++V  +L   +   +  SG    DP  Q+LKE  +  +  ++SLLK +K+++D + +  +A++  +                IS+E   + SP       +G          PE++ R+  ++     K +   +   +  I+   N+   +IS      E+   C+++  N   T+  + +TL     + E+Y +LL      L N + + R+ +   V+K + +L+ + R
Sbjct:    4 LSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRT-KGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRM------EQLNVESLAH------------PGIMRPYDGERSYMENEVQTVQYGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASH------------PDEVDTEAISASVSQIAQTIPEVTKEVRLIAA----LMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEP----PQHLINAASRVGEATTHVLSTIAEEE-----------------VPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGEA--DQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLS-----SVLHNQR----SY--------AGAAGRDTALALGDFTRSVHGVAATTQ-----------------NPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATL---QSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEE---------EVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLV-DASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFDCVEQATGKS-RNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ----MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSR---ERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAV---NAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM--NAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGS------FADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV--------------EAISQEIRAMHSPPPVGNTQVG----------PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAIS------EMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGI---LHNCSADDRMHLSRRVAKCVTDLVAMAR 2292          
BLAST of Talin-1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333106)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 685/2447 (27.99%), Postives = 1232/2447 (50.35%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLI-----SDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQE-DINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXA-YENI---QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK--VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNEL-VSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESE-ESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVE----TITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTT-EVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKP-IIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSK-LNELIKLLR 7317
              LRI +    VTK +   P  T+F  C+ IR    EA    P  YGL++  +  ++G+WL+  +TL +YIL   DT+EYR ++R L +R +DG  KT+ VDDS  VS+LM+ +CTK+GI N++EY L+     +   +       TL++KR I       K++ L+KK  T+D +NW++ S++LR+QGI+E+E +LL+R++FFSD N+DSRDP+QL+LLY Q +DA+++GTHPVT  +A E AG+Q  +Q G ++  K K GFLDL++ LP+ Y +  K +EKKIF++H K  DLSE++AK  Y    R   TYG+TFFLVKEK+ GKNKL+PRLLGV K+SV+++DE TKEI+ +WPLT++R+W AS N FT+DFG+Y+ ++YY+ QT + E+I QLIAGYIDIILK+K+ KDH G++ DE S M EE++APSKA  ++H   +       E + +   AH               +   D    Y E ++   +  + +G+        TT  +     +    Q+  +  +    D + +  ++L  +    E+G D  S +W    +D S+Q ++  +  M+AA AQ++ ++              +E     +  S S I   +P + +E+R  A     L + D SG++L+ AA+ L  AF++L+KAA P   +      + + +AA+ VGEA++ +L  I E+E                   E++   + LL LAK+VAN T  L+ + K IA   ++   + +V+ AA++  LA SQL++  K+VAPT+  + C+EQL  + ++V++A+  + E  N+A+   +L+   + AA  V ++L  +++H++    ++    +  L+  EN+    ++  S  D  ++V  AR L Q T  +I  I+ +A  +Q +  + +  L++AAKQLA+AT  L+++A+ C+ +  + + +  LR+A E    +T T      ++  +I  L   +++AA+  T  I+ + +A + S+    K  +  D + +++ I  L+ ++K  R  P D  AQL LI A   +I+P+ Q+S+S++ + PTV+D    T L++          EL     +A   C   +L +ALE++++L   L   + +     L PLP +  + +A  L KS +  G A +Q  +      V++ Q     SY        AG   R+ ++AL     +  GVAA+ +                    I++   + V ++  L+ +A+ +       +   QA   ++ ALS  +D +PGQR++D+  +++       + +  P        L   +SEL       + A  E+ VS  S  L+ +  +    +Y  ++ +   +     +E           R H+   +  +S    +LL   K I  +P     +  L  A + + +SIN+L+ + S    PGQKECD  +  +E++R +LD P  PI+   YF+C++    K+ + L  ++  +    K   + +F  S+ +  DS+  L+E ++Q AYL+GV    S  G  G+ D        + I ++C  + +  +T  Q    MIS    IA+++  LC   +  ++  S P  K +     K    A S+L+  ++ + +     +R   E L   + + V  + Q   S +F+   A IS E +++Q P+  AG  V+D  +E+++ +K+L  +  N  ++   S     +++++K L+  I++ APGQ +C++ L  L    ++     + +    ++ +S+  ++    +     ++  ++   +  +  AGK   EQL       ++ +  MVN  I A       Q     ++   +++E++  L+++ K+S GNP+A   H ++D+   G  E+ ++L   ++KI+ + G V  ++E    +IT+ + K Q          F + Q++M+    ++ +L  ++  NA S      L  L  ++TQ Y  L +   GA  T S+ +   +++  V  +G+   S+++S+    RP+ A +   +    +E+ +++  V+  L + + GTQAC  A   +  I  D+DT+I+F  +  + +D          F   R  ++  +  LV + K++V+      + L  +A     T   LA  VK G   L S+     + ++ + ++V  +L   +   +  SG    DP  Q+LKE  +  +  ++SLLK +K+++D + +  +A++  +                IS+E   + SP       +G          PE++ R+  ++     K +   +   +  I+   N+   +IS      E+   C+++  N   T+  + +TL     + E+Y +LL      L N + + R+ +   V+K + +L+ + R
Sbjct:    4 LSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRT-KGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRM------EQLNVESLAH------------PGIMRPYDGERSYMENEVQTVQYGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASH------------PDEVDTEAISASVSQIAQTIPEVTKEVRLIAA----LMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEP----PQHLINAASRVGEATTHVLSTIAEEE-----------------VPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGEA--DQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLS-----SVLHNQR----SY--------AGAAGRDTALALGDFTRSVHGVAATTQ-----------------NPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATL---QSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEE---------EVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLV-DASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFDCVEQATGKS-RNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ----MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSR---ERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAV---NAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM--NAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGS------FADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV--------------EAISQEIRAMHSPPPVGNTQVG----------PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAIS------EMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGI---LHNCSADDRMHLSRRVAKCVTDLVAMAR 2292          
BLAST of Talin-1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333108)

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 685/2447 (27.99%), Postives = 1232/2447 (50.35%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLI-----SDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQE-DINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXA-YENI---QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK--VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNEL-VSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESE-ESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVE----TITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTT-EVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKP-IIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSK-LNELIKLLR 7317
              LRI +    VTK +   P  T+F  C+ IR    EA    P  YGL++  +  ++G+WL+  +TL +YIL   DT+EYR ++R L +R +DG  KT+ VDDS  VS+LM+ +CTK+GI N++EY L+     +   +       TL++KR I       K++ L+KK  T+D +NW++ S++LR+QGI+E+E +LL+R++FFSD N+DSRDP+QL+LLY Q +DA+++GTHPVT  +A E AG+Q  +Q G ++  K K GFLDL++ LP+ Y +  K +EKKIF++H K  DLSE++AK  Y    R   TYG+TFFLVKEK+ GKNKL+PRLLGV K+SV+++DE TKEI+ +WPLT++R+W AS N FT+DFG+Y+ ++YY+ QT + E+I QLIAGYIDIILK+K+ KDH G++ DE S M EE++APSKA  ++H   +       E + +   AH               +   D    Y E ++   +  + +G+        TT  +     +    Q+  +  +    D + +  ++L  +    E+G D  S +W    +D S+Q ++  +  M+AA AQ++ ++              +E     +  S S I   +P + +E+R  A     L + D SG++L+ AA+ L  AF++L+KAA P   +      + + +AA+ VGEA++ +L  I E+E                   E++   + LL LAK+VAN T  L+ + K IA   ++   + +V+ AA++  LA SQL++  K+VAPT+  + C+EQL  + ++V++A+  + E  N+A+   +L+   + AA  V ++L  +++H++    ++    +  L+  EN+    ++  S  D  ++V  AR L Q T  +I  I+ +A  +Q +  + +  L++AAKQLA+AT  L+++A+ C+ +  + + +  LR+A E    +T T      ++  +I  L   +++AA+  T  I+ + +A + S+    K  +  D + +++ I  L+ ++K  R  P D  AQL LI A   +I+P+ Q+S+S++ + PTV+D    T L++          EL     +A   C   +L +ALE++++L   L   + +     L PLP +  + +A  L KS +  G A +Q  +      V++ Q     SY        AG   R+ ++AL     +  GVAA+ +                    I++   + V ++  L+ +A+ +       +   QA   ++ ALS  +D +PGQR++D+  +++       + +  P        L   +SEL       + A  E+ VS  S  L+ +  +    +Y  ++ +   +     +E           R H+   +  +S    +LL   K I  +P     +  L  A + + +SIN+L+ + S    PGQKECD  +  +E++R +LD P  PI+   YF+C++    K+ + L  ++  +    K   + +F  S+ +  DS+  L+E ++Q AYL+GV    S  G  G+ D        + I ++C  + +  +T  Q    MIS    IA+++  LC   +  ++  S P  K +     K    A S+L+  ++ + +     +R   E L   + + V  + Q   S +F+   A IS E +++Q P+  AG  V+D  +E+++ +K+L  +  N  ++   S     +++++K L+  I++ APGQ +C++ L  L    ++     + +    ++ +S+  ++    +     ++  ++   +  +  AGK   EQL       ++ +  MVN  I A       Q     ++   +++E++  L+++ K+S GNP+A   H ++D+   G  E+ ++L   ++KI+ + G V  ++E    +IT+ + K Q          F + Q++M+    ++ +L  ++  NA S      L  L  ++TQ Y  L +   GA  T S+ +   +++  V  +G+   S+++S+    RP+ A +   +    +E+ +++  V+  L + + GTQAC  A   +  I  D+DT+I+F  +  + +D          F   R  ++  +  LV + K++V+      + L  +A     T   LA  VK G   L S+     + ++ + ++V  +L   +   +  SG    DP  Q+LKE  +  +  ++SLLK +K+++D + +  +A++  +                IS+E   + SP       +G          PE++ R+  ++     K +   +   +  I+   N+   +IS      E+   C+++  N   T+  + +TL     + E+Y +LL      L N + + R+ +   V+K + +L+ + R
Sbjct:    4 LSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRT-KGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRM------EQLNVESLAH------------PGIMRPYDGERSYMENEVQTVQYGAFVGQVNHAHQPPTTKEVRISSVNLTEPQRALLGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQAVSSHVATMSAATAQIITASH------------PDEVDTEAISASVSQIAQTIPEVTKEVRLIAA----LMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEP----PQHLINAASRVGEATTHVLSTIAEEE-----------------VPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGEA--DQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLSS-----VLHNQR----SY--------AGAAGRDTALALGDFTRSVHGVAATTQ-----------------NPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATL---QSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEE---------EVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLV-DASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFDCVEQATGKS-RNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ----MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSR---ERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAV---NAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM--NAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGS------FADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV--------------EAISQEIRAMHSPPPVGNTQVG----------PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAIS------EMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGI---LHNCSADDRMHLSRRVAKCVTDLVAMAR 2292          
BLAST of Talin-1 vs. Ensembl Fly
Match: rhea (gene:FBgn0260442 transcript:FBtr0333107)

HSP 1 Score: 895.96 bits (2314), Expect = 0.000e+0
Identity = 686/2447 (28.03%), Postives = 1228/2447 (50.18%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLI-----SDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSR-QTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXA-YENI---QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK--VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNEL-VSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESE-ESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVE----TITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTT-EVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKP-IIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSK-LNELIKLLR 7317
              LRI +    VTK +   P  T+F  C+ IR    EA    P  YGL++  +  ++G+WL+  +TL +YIL   DT+EYR ++R L +R +DG  KT+ VDDS  VS+LM+ +CTK+GI N++EY L+     +   +       TL++KR I       K++ L+KK  T+D +NW++ S++LR+QGI+E+E +LL+R++FFSD N+DSRDP+QL+LLY Q +DA+++GTHPVT  +A E AG+Q  +Q G ++  K K GFLDL++ LP+ Y +  K +EKKIF++H K  DLSE++AK  Y    R   TYG+TFFLVKEK+ GKNKL+PRLLGV K+SV+++DE TKEI+ +WPLT++R+W AS N FT+DFG+Y+ ++YY+ QT + E+I QLIAGYIDIILK+K+ KDH G++ DE S M EE++APSKA  ++H   +       E + +   AH     +     AS         +     +N++  Q + LG   +    L         +D+++R K  I  L  +L +I                       +W    +D S+Q ++  +  M+AA AQ++ ++              +E     +  S S I   +P + +E+R  A     L + D SG++L+ AA+ L  AF++L+KAA P   +      + + +AA+ VGEA++ +L  I E+E                   E++   + LL LAK+VAN T  L+ + K IA   ++   + +V+ AA++  LA SQL++  K+VAPT+  + C+EQL  + ++V++A+  + E  N+A+   +L+   + AA  V ++L  +++H++    ++    +  L+  EN+    ++  S  D  ++V  AR L Q T  +I  I+ +A  +Q +  + +  L++AAKQLA+AT  L+++A+ C+ +  + + +  LR+A E    +T T      ++  +I  L   +++AA+  T  I+ + +A + S+    K  +  D + +++ I  L+ ++K  R  P D  AQL LI A   +I+P+ Q+S+S++ + PTV+D    T L++          EL     +A   C   +L +ALE++++L   L   + +     L PLP +  + +A  L KS +  G A +Q  +      V++ Q     SY        AG   R+ ++AL     +  GVAA+ +                    I++   + V ++  L+ +A+ +       +   QA   ++ ALS  +D +PGQR++D+  +++       + +  P        L   +SEL       + A  E+ VS  S  L+ +  +    +Y  ++ +   +     +E           R H+   +  +S    +LL   K I  +P     +  L  A + + +SIN+L+ + S    PGQKECD  +  +E++R +LD P  PI+   YF+C++    K+ + L  ++  +    K   + +F  S+ +  DS+  L+E ++Q AYL+GV    S  G  G+ D        + I ++C  + +  +T  Q    MIS    IA+++  LC   +  ++  S P  K +     K    A S+L+  ++ + +     +R   E L   + + V  + Q   S +F+   A IS E +++Q P+  AG  V+D  +E+++ +K+L  +  N  ++   S     +++++K L+  I++ APGQ +C++ L  L    ++     + +    ++ +S+  ++    +     ++  ++   +  +  AGK   EQL       ++ +  MVN  I A       Q     ++   +++E++  L+++ K+S GNP+A   H ++D+   G  E+ ++L   ++KI+ + G V  ++E    +IT+ + K Q          F + Q++M+    ++ +L  ++  NA S      L  L  ++TQ Y  L +   GA  T S+ +   +++  V  +G+   S+++S+    RP+ A +   +    +E+ +++  V+  L + + GTQAC  A   +  I  D+DT+I+F  +  + +D          F   R  ++  +  LV + K++V+      + L  +A     T   LA  VK G   L S+     + ++ + ++V  +L   +   +  SG    DP  Q+LKE  +  +  ++SLLK +K+++D + +  +A++  +                IS+E   + SP       +G          PE++ R+  ++     K +   +   +  I+   N+   +IS      E+   C+++  N   T+  + +TL     + E+Y +LL      L N + + R+ +   V+K + +L+ + R
Sbjct:    4 LSLRIQLEGGRVTKTIQFQPNTTVFDACKVIRDKFAEAVQGQPSEYGLFISDEQNQQGVWLEPGRTLGYYILHNQDTLEYRRKTRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTKIGITNHEEYGLVREDNEAQNENLPDNKFGTLTLKRKIMEKDRDAKMESLRKKLKTDDEMNWVDVSRTLREQGIDEAETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQDKACEFAGIQVHIQFGPHNEAKHKTGFLDLKDFLPQSYVRT-KGIEKKIFSEHRKHVDLSEIDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDEHTKEILISWPLTTVRRWGASPNTFTLDFGDYA-NQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGIEGDEGSTMVEESVAPSKATFLQHETNRM------EQLNVESLAH---PGIMRPYDASGHPMFYKTKEVRISSVNLTEPQRALLGYISAGQDVLI-------RADEELRTKAPIQELGSDLRSI-----------------------EWRENTLDTSKQAVSSHVATMSAATAQIITASH------------PDEVDTEAISASVSQIAQTIPEVTKEVRLIAA----LMENDTSGDQLLEAARNLCSAFSDLLKAAEPESKEP----PQHLINAASRVGEATTHVLSTIAEEE-----------------VPENRDLHDMLLALAKAVANTTAALVLRAKNIAASCDDEQARNRVIGAASQCALATSQLVACAKVVAPTLHNAACREQLEAAAKNVARAVNSLCEVCNEASNDPKLKADLLAAARDVSKSLTDMLEHVKLSSREHANRTSTELSPVENVIIGTDILVSTHDPQEMVRHARTLGQTTAQLIQSIKGEA--DQQQDADMKRHLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRKAAEELREITTTAANTPAMKRGLIQRLEFCSKQAASAATQCISAAQNAVQHSQDHQTKETLLQDCKRVADTIPRLVTSLKTTRAQPDDPNAQLNLIEAAEQFIEPALQVSKSSRALQPTVTDIPSATQLSKGALHLGQCVSELHSVAQRARDACGGQELESALEEVRKLHDVLDDTRQAAIAGQLRPLPGQTVENTADELRKSAKNVGIALSQLLS-----SVLHNQR----SY--------AGAAGRDTALALGDFTRSVHGVAATTQ-----------------NPAIIDCADDVVTSSARLIEQAQRTLQGASNPEALTQAGREVTGALSATVDCIPGQREVDVALRNVSELSEILSMSEFPPSSRPYATL---QSELKQVAEQLSSAGGEIVVSYSSPALLAESSQNFAANYRDLLSVSMEMAGQTQEE---------EVRSHMIESLRHVSTQSCSLLSTAKSIAADPGQPNAKNLLHAAARGVTESINQLV-DASIQSAPGQKECDNAMRNIEALRLMLDYPHEPINELGYFDCVEQATGKS-RNLGYAISEMINNAKQSQHVEFSQSVNNVNDSIQGLIESSSQAAYLIGVSHPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSQQSTKPQ----MISALTVIAKHTSYLCSICRQASMNTSNPVAKNEFIVLAKQVATATSDLVQDIKAIEEQSAGGSR---ERLVDPLLEAVKAVRQYASSSEFSSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQLSMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAV---NAQGLSQRRDNNLHGFSGQTMNSASELIDKLEPIRMAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIVHSQQQMSLIQQTRSVVESAITLVQSAKESAGNPRATHAHPRLDDAIDGTREAIQELQQTVEKINAETGIVTGLMEQVNRSITRLTDKRQSLLNASYSDTFVDYQTRMVARAKEIASLANEM--NAKSSVEPSALPQLAVDMTQNYQQLTQDSVGASTTTSSPDVAMRIRTTVIDLGRSVSSMIQSSAGGARPNDAGAQKEIARSAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGDLDTTIMFATAGTLHSDGDGS------FADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNAVSTITQLAEAVKRGACSLGSTQPDSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATV--------------EAISQEIRAMHSPPPVGNTQVG----------PEDLIRVTMNVTAATAKAVAAGTSNLQADIVSAANLGRRAIS------EMLIVCRSVAWNCAETEELRSRTLEAGTAVGESYRDLLSGI---LHNCSADDRMHLSRRVAKCVTDLVAMAR 2271          
BLAST of Talin-1 vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 700/2275 (30.77%), Postives = 1194/2275 (52.48%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXX----XXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAK--KSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNL--VNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            L + I   +V K +  +P   ++  C  IR+ + EAQ   P  YGL+L  DD KKG+WL+  K L +Y+L+ GDT+EY+ + R L IR +DGT KT+ VDDS  VS++++T+C ++GI NYDEYSL+ D +      + T ++KR  ++ +D +K++KLK+K HT+D LNWL+  ++LR+QG+EESE+LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G+++  K KPGFLDL+E LPKEY KN    EK+IF  H   ++++E+EAK  Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KESV++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     + K +  SV+    +IR  A     S++M S                  +  ++Q             +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G D ASQ W    +D S+  +  ++ A+ A  A ++    G     +          I+      S     L +LME             DE  +G++L+ AAK LA A ++++K A P   + R    + +  AA  VG+AS +LLQQI E                   ++ DQ +Q+ L++LAK+VAN    L+ + K +A ++E+ + Q KV+ AAT+  L+ SQL++ T++VAPTI   VCQEQLI + + V+K+++  VE+S+ AT  E L      AA  V +AL+ L++H+R+       +     A + I +V      S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK    + D    +  LREA E   + T        I++++++ L  AA++AA   T  I  +  AA   K+ A+  ++    + +++QI  L+  ++ ++  P    AQL LI A ++++ P  ++  + K   PT+SD +    L+Q       A  EL+    +A   C  L++  AL  ++ LE++++  K S     L PLP E  ++ +  L  S +   SA  Q          + E T G ++Y         G  AR+++ AL  L  AARGVAA          N +  L + A L    + ++   +  +    A + P D D   R  Q +  +S AL+  ++ LPGQRD+D   + +     +   ++ P    +  N    ++ L +     NQ+ NELV A       + K   K    +++ ++    +      + D         +  +   +  +S     LL   K +  +P++  ++ QL  A + + DSIN+L++ + T   PGQKECD  +  LE++  +L+NP   ++   YF+C+D +++ + + L +++  I    K+ N  +F DS+   + ++C L E  AQ AYLVGV D  S  G KGL D + F + ++ I   CQ + +P  T  Q    ++S A  +A+++  LC A +  +   S P  K +     K    + + L+  ++ ++  FN++NR++ +  +G + + V  L     + +FA   A IS E   +  PI AA   +L+++  +IQ +++L  +  +   +   +   + ++D++K LI+ ++E APGQ+ECD+A+ +L+  I++   + +  +    +   R   S E+    + +++ ++ + I  ++ A + +  QL    S+     E ++ + I  A++    Q     L+   T+ E++ Q+L   K++GGN KA      ++E  Q + E+ +DL + L +++   G V  +V +IT+S  K+++      +  F + Q+ M+     +     ++ + +N+   +  L  L   LT  + DL    + A  T  N+  G  +++ V  +G     LV     ++  P+ + +   L    +++ +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++ E ++    + +    ++  +  LV + KL+VS        L ++A     T   LA+ VK+G   L S   +  + L+ + ++V  +L   +   +  +G P+ DP    LK   K  +  +TSLLK +K+++D   K  +A++  I
Sbjct:    4 LSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRD-VGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG--EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQFNKMGKVETGSVALP-AIIRSGAG-GPESMKMGS------------------MPQAKQ------------HITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAVQASLDEFDALPPLGTDSASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME-------------DEGGNGQQLLGAAKNLACAVSDMLKTAQPSSTEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDADQHFQDMLMQLAKAVANAAAALVLKAKNVAQKSEDSAQQNKVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEHLLKQVGAAATGVTQALNELLQHIRQYASGGQPIGRHGEATDRILDVTDNIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMAT-NAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQIPQLVQGLRSSQAQPDSPSAQLALIGASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTMVRGLERDMQEAKASAAEGKLRPLPGETLEKCSQDLGSSTKAVSSAIAQL---------LSEATQGNENY--------TGMAARDVAQALRSLASAARGVAA----------NTEDPLARNAMLDCTGDVMDKSASLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSVNCLPGQRDVDNAIRTVGEASKKLLSDKFPA---SGKNFQEAQANLNEAAAGLNQSANELVQASRGTTQDLAKASGKFGQDFNQFLQAGVDMAGQSQSKED---------QTQVVTNLKTISMSSSKLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLIS-MCTQQAPGQKECDNALRELETVGGMLENPTEAVNDLGYFDCIDSVMENS-KVLGEAMAGISHNAKNSNLPEFGDSVSSASKALCGLTEAAAQGAYLVGVSDPNSHAGQKGLVDPSQFARAKQSIQMACQNLVDPACTQSQ----VLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKAIDGAFNQENRQKCKEATGPLIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPITAAAKAMLESSTGLIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLSNCIREVDKASLAAISQ--QLTPRDDISHEALHEQMAASVHEISNLIEPVAIAARADASQLGHKVSQMVSYFEPLIMAAIGTASKILNSQQQMNVLDQTKTLAESALQMLYTAKETGGNHKAAHTQEALEESVQMMKEAVDDLGSTLAEVASAAGAVGGMVNSITQSINKMEDGPAFEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPDE--LGGLANQLTTEFGDLASEAKCAAMTAENDEIGSHIKKQVTELGYTCTGLVSKAGALQCSPNDSYTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNRENAETFADHRYYIE---HILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLISATKAAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATI 2151          
BLAST of Talin-1 vs. Ensembl Zebrafish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 703/2276 (30.89%), Postives = 1191/2276 (52.33%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIV-APTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXX----XXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAK--KSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNL--VNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            L + I   +V K +  +P   ++  C  IR+ + EAQ   P  YGL+L  DD KKG+WL+  K L +Y+L+ GDT+EY+ + R L IR +DGT KT+ VDDS  VS++++T+C ++GI NYDEYSL+ D +      + T ++KR  ++ +D +K++KLK+K HT+D LNWL+  ++LR+QG+EESE+LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G+++  K KPGFLDL+E LPKEY KN    EK+IF  H   ++++E+EAK  Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KESV++VDEKTKE+I  W LT+I++WAAS      DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     + K +  SV+    +IR  A     S++M S                  +  ++Q             +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G D ASQ W    +D S+  +  ++ A+ A  A ++    G     +          I+      S     L +LME             DE  +G++L+ AAK LA A ++++K A P   + R    + +  AA  VG+AS +LLQQI E                   ++ DQ +Q+ L++LAK+VAN    L+ + K +A ++E+ + Q KV+ AAT+  L+ SQL++ T++V APTI   VCQEQLI + + V+K+++  VE+S+ AT  E L      AA  V +AL+ L++H+R+       +     A + I +V      S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK    + D    +  LREA E   + T        I++++++ L  AA++AA   T  I  +  AA   K+ A+  ++    + +++QI  L+  ++ ++  P    AQL LI A ++++ P  ++  + K   PT+SD +    L+Q       A  EL+    +A   C  L++  AL  ++ LE++++  K S     L PLP E  ++ +  L  S +   SA  Q          + E T G ++Y         G  AR+++ AL  L  AARGVAA          N +  L + A L    + ++   +  +    A + P D D   R  Q +  +S AL+  ++ LPGQRD+D   + +     +   ++ P    +  N    ++ L +     NQ+ NELV A       + K   K    +++ ++       D   +S S       ++  +   +  +S     LL   K +  +P++  ++ QL  A + + DSIN+L++ + T   PGQKECD  +  LE++  +L+NP   ++   YF+C+D +++ + + L +++  I    K+ N  +F DS+   + ++C L E  AQ AYLVGV D  S  G KGL D + F + ++ I   CQ + +P  T  Q    ++S A  +A+++  LC A +  +   S P  K +     K    + + L+  ++ L+  FN++NR++ +  +G + + V  L     + +FA   A IS E   +  PI AA   +L+++  +IQ +++L  +  +   +   +   + ++D++K LI+ ++E APGQ+ECD+A+ +L+  I++   + +  +    +   R   S E+    + +++ ++ + I  ++ A + +  QL    S+     E ++ + I  A++    Q     L+   T+ E++ Q+L   K++GGN KA      ++E  Q + E+ +DL + L +++   G V  +V +IT+S  K+++      +  F + Q+ M+     +     ++ + +N+   +  L  L   LT  + DL    + A  T  N+  G  +++ V  +G     LV     ++  P+ + +   L    +++ +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R  ++  +  LV + KL+VS        L ++A     T   LA+ VK+G   L S   +  + L+ + ++V  +L   +   +  +G P+ DP    LK   K  +  +TSLLK +K+++D   K  +A++  I
Sbjct:    4 LSLKIGVGNVVKTMQFEPSTVVYDACRIIRERVPEAQLGQPSDYGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTLEYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRD-VGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEESEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYVKNKG--EKRIFQAHKNCQNMTEIEAKVNYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVIQEWSLTNIKRWAAS----PKDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQFNKMGKVETGSVALP-AIIRSGAG-GPESMKMGS------------------MPQAKQ------------HITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAVQASLDEFDALPPLGTDSASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME-------------DEGGNGQQLLGAAKNLACAVSDMLKTAQPSSTEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDADQHFQDMLMQLAKAVANAAAALVLKAKNVAQKSEDSAQQNKVIAAATQCALSTSQLVACTRVVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASHGATGDEHLLKQVGAAATGVTQALNELLQHIRQYASGGQPIGRHGEATDRILDVTDNIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMAT-NAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQIPQLVQGLRSSQAQPDSPSAQLALIGASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTMVRGLERDMQEAKASAAEGKLRPLPGETLEKCSQDLGSSTKAVSSAIAQL---------LSEATQGNENY--------TGMAARDVAQALRSLASAARGVAA----------NTEDPLARNAMLDCTGDVMDKSASLIEETKRAIAKPGDPDSQQRLAQVAKAVSQALNRSVNCLPGQRDVDNAIRTVGEASKKLLSDKFPA---SGKNFQEAQANLNEAAAGLNQSANELVQASRGTTQDLAKASGKFGQDFNQFLQAG----VDMAGQSQS-----KEDQTQVVTNLKTISMSSSKLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLIS-MCTQQAPGQKECDNALRELETVGGMLENPTEAVNDLGYFDCIDSVMENS-KVLGEAMAGISHNAKNSNLPEFGDSVSSASKALCGLTEAAAQGAYLVGVSDPNSHAGQKGLVDPSQFARAKQSIQMACQNLVDPACTQSQ----VLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKEATGPLIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPITAAAKAMLESSTGLIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLSNCIREVDKASLAAISQ--QLTPRDDISHEALHEQMAASVHEISNLIEPVAIAARADASQLGHKVSQMVSYFEPLIMAAIGTASKILNSQQQMNVLDQTKTLAESALQMLYTAKETGGNHKAAHTQEALEESVQMMKEAVDDLGSTLAEVASAAGAVGGMVNSITQSINKMEDGPAFEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPDE--LGGLANQLTTEFGDLASEAKCAAMTAENDEIGSHIKKQVTELGYTCTGLVSKAGALQCSPNDSYTKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREN------AETFADHREHILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLISATKAAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATI 2145          
BLAST of Talin-1 vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 702/2291 (30.64%), Postives = 1178/2291 (51.42%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHI-ESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDES-DSALH---HLSSNRD--HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFE-SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQT-DLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKML----DICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   ++ +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +++ K++KLK K HT+D LNWL+  ++ R+QG+EESE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K K GFLDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLGV KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEE+ M EE+++P K+ I++     V + +  SV+   ++                  S SV +        E +NM       G   +P   +TT  MH   M      Q+  + ++  ++  +Q+ +D L    + P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SG +L+ AA+ L  A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    ++ + K +A  +E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V++   AT   EL      AA  V +AL  L+ H+R    + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E         KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++I  L        AA T T   + + +A+ K+ A++ ++    R +++ I  L+  ++ ++  P+D  AQL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+     A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  A E + AL  L  AARGVAA+               +      ++++  E ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I E+ K    E   P  +    +    +S+L  T  D NQ+  ++V A             R +  ++ +       D FDE  D+ +    H     D   +   +  +S     LL   K +  +P     +  L  A + + DSIN+L+T  + N  PGQ+ECD  +  LE++R +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F D +   + ++C L E   Q +YLVGV D  S+ G+ GL D   F +  + I   CQ + +PD++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR++    +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++  +++ +++L+ +  +   +   +   + ++D++K LI+ I++ APGQKECD A+  + K I    D +   +   S+ + R  E S E+ Q  L S++ ++ H I  ++ A K E  QL    S+       +V++ +  A++T D  Q  N+ L+   T+ E++ Q+L A K+ GGNPKA+  H  I E AQ + E+ +DLL  L++ + + G V+ +V++I  S  K+ E      +  F   Q+ M+     I      + T       S S+   L  L   +T  Y  L    + A AT   E  G Q++  VQ +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  SA   N + +  S    F   R +++  +  LV + K +VS        L ++A   A T   L + VK+G   +     +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASEYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGDILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKD-EGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQ-RGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGIL-----------------RSGSVGA--------ETLNM-------GTMPAPQQQITTGQMHLGHMPPLSAAQQALVGTINTSMQAVQQAQDDLEEVEELPPLGDDMASKMWIQNKMDESKHDIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGHDLMRAARTLTGAVSDLLKAVEPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMNLAKAVANAAAMMVLKAKNVAQVSEDSVMQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSATSDGELLKAVSAAAGIVTQALSDLLTHVRNYATRGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EVEVDVNNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQKLREAAEGLRVAT-NAAAQNAIKKKLITRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSCRAVADHIPQLVQGVRGSQGQPEDGSAQLALIIASKNFLQPGSKMVSSAKSSVPTVTDQAAAMQLGQCAKNLATTLAELRTAAQTAHEACGPMEIDSALIAVQTLKNELQDAKMAASEGQLKPLPGESLEKCAQDLGGTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAASETAQALKTLAQAARGVAATTS-------------DPAGAAAMLDSAREVMEGSAKLISEAKEALVAPGDAEIQQRLAQVAKAVSHSLNACVNCLPGQKDVDMALKSIGEASKKLLVETLPPCSK----SFQEAQSDLNQTAADLNQSAGDVVHAS------------RGTTTQLADASGKF-SDNFDEFLDAGIEMAGHTPGKDDQLQVIGNLKNISMASSKLLLAAKSLSVDPGAGNAKNLLAAAARSVTDSINQLITMCTQNA-PGQRECDNALRELEAVRGLLDNPNEPVNDLSYFDCIESVMENS-KVLGESMAGISHNCKTGDVPAFGDCVGGASKALCGLTEAAGQASYLVGVSDPSSQAGHPGLVDPIQFARANQAIQMACQNLVDPDSSPSQ----VLSAATIVAKHTSALCNACRLASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENREKCRIATAPLIEAVDNLTIFASNPEFASVPAQISREGSAAQEPIIQSARSMLDSSTHLLKTARSLVMNPKDPPTWSLLAGHSRTVSDSIKSLITAIRDKAPGQKECDSAIDNINKCI---RDIEQASLAAVSQNLPRRDEVSSEALQEQLTSSVQEVGHLIEPITTAAKGEAAQLGHKVSQLVSYFTPLVSASMGIASKTLDHQQQMNL-LDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMREAVDDLLLTLNEAASEVGMVSGMVDSIADSMGKLGEGTPPEPEGSFVEYQTTMVRYSKAIAVSAQEMIT------KSVSSPEDLCSLASQVTADYSQLAVQGRLASATAEPEEIGFQIKTSVQELGHGCIVLVQKAGALQISPTDSFTKRELIECARAVTEKVSMVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFA-SAGTLNAENDSDS----FADHRENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDPETQVVLINAVKDVAKALAELISATKCAAGKAADDPSMFQLKSAAKVMVTNVTSLLKTVKAVEDEASRGTRALEATI 2152          
BLAST of Talin-1 vs. Ensembl Zebrafish
Match: tln2a (talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263])

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 700/2290 (30.57%), Postives = 1176/2290 (51.35%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDES-DSALH---HLSSNRD--HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFE-SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQT-DLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKML----DICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   ++ +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +++ K++KLK K HT+D LNWL+  ++ R+QG+EESE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K K GFLDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLGV KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEE+ M EE+++P K+ I++     V + +  SV+   ++                  S SV +        E +NM       G   +P   +TT  MH   M      Q+  + ++  ++  +Q+ +D L    + P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SG +L+ AA+ L  A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    ++ + K +A  +E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V++   AT   EL      AA  V +AL  L+ H+R    + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E         KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++I  L        AA T T   + + +A+ K+ A++ ++    R +++ I  L+  ++ ++  P+D  AQL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+     A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  A E + AL  L  AARGVAA+               +      ++++  E ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +     LP     + +    +S+L  T  D NQ+  ++V A             R +  ++ +       D FDE  D+ +    H     D   +   +  +S     LL   K +  +P     +  L  A + + DSIN+L+T  + N  PGQ+ECD  +  LE++R +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F D +   + ++C L E   Q +YLVGV D  S+ G+ GL D   F +  + I   CQ + +PD++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR++    +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++  +++ +++L+ +  +   +   +   + ++D++K LI+ I++ APGQKECD A+  + K I    D +   +   S+ + R  E S E+ Q  L S++ ++ H I  ++ A K E  QL    S+       +V++ +  A++T D  Q  N+ L+   T+ E++ Q+L A K+ GGNPKA+  H  I E AQ + E+ +DLL  L++ + + G V+ +V++I  S  K+ E      +  F   Q+ M+     I      + T       S S+   L  L   +T  Y  L    + A AT   E  G Q++  VQ +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  SA   N + +  S    F   R +++  +  LV + K +VS        L ++A   A T   L + VK+G   +     +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASEYGLFLSDEDPRKGIWLEGGRTLDYYMLRNGDILEYKKKQRPQKVKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKD-EGTGTLKKDRTLLREERKMEKLKAKLHTDDDLNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEHKHKTGFLDLKEFLPKEYIKQ-RGAEKKIFQEHKGCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEEATMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGIL-----------------RSGSVGA--------ETLNM-------GTMPAPQQQITTGQMHLGHMPPLSAAQQALVGTINTSMQAVQQAQDDLEEVEELPPLGDDMASKMWIQNKMDESKHDIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGHDLMRAARTLTGAVSDLLKAVEPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMNLAKAVANAAAMMVLKAKNVAQVSEDSVMQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVEGCVKACLSATSDGELLKAVSAAAGIVTQALSDLLTHVRNYATRGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EVEVDVNNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQKLREAAEGLRVAT-NAAAQNAIKKKLITRLENAAKQAAAAATQTIAASQNAAASNKNTAAHQQLVQSCRAVADHIPQLVQGVRGSQGQPEDGSAQLALIIASKNFLQPGSKMVSSAKSSVPTVTDQAAAMQLGQCAKNLATTLAELRTAAQTAHEACGPMEIDSALIAVQTLKNELQDAKMAASEGQLKPLPGESLEKCAQDLGGTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAASETAQALKTLAQAARGVAATTS-------------DPAGAAAMLDSAREVMEGSAKLISEAKEALVAPGDAEIQQRLAQVAKAVSHSLNACVNCLPGQKDVDMALKSIGEASKKL---LLP---PCSKSFQEAQSDLNQTAADLNQSAGDVVHAS------------RGTTTQLADASGKF-SDNFDEFLDAGIEMAGHTPGKDDQLQVIGNLKNISMASSKLLLAAKSLSVDPGAGNAKNLLAAAARSVTDSINQLITMCTQNA-PGQRECDNALRELEAVRGLLDNPNEPVNDLSYFDCIESVMENS-KVLGESMAGISHNCKTGDVPAFGDCVGGASKALCGLTEAAGQASYLVGVSDPSSQAGHPGLVDPIQFARANQAIQMACQNLVDPDSSPSQ----VLSAATIVAKHTSALCNACRLASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENREKCRIATAPLIEAVDNLTIFASNPEFASVPAQISREGSAAQEPIIQSARSMLDSSTHLLKTARSLVMNPKDPPTWSLLAGHSRTVSDSIKSLITAIRDKAPGQKECDSAIDNINKCI---RDIEQASLAAVSQNLPRRDEVSSEALQEQLTSSVQEVGHLIEPITTAAKGEAAQLGHKVSQLVSYFTPLVSASMGIASKTLDHQQQMNL-LDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMREAVDDLLLTLNEAASEVGMVSGMVDSIADSMGKLGEGTPPEPEGSFVEYQTTMVRYSKAIAVSAQEMIT------KSVSSPEDLCSLASQVTADYSQLAVQGRLASATAEPEEIGFQIKTSVQELGHGCIVLVQKAGALQISPTDSFTKRELIECARAVTEKVSMVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFA-SAGTLNAENDSDS----FADHRENILKTAKALVEDTKNLVSGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASIGPDDPETQVVLINAVKDVAKALAELISATKCAAGKAADDPSMFQLKSAAKVMVTNVTSLLKTVKAVEDEASRGTRALEATI 2149          
BLAST of Talin-1 vs. Ensembl Zebrafish
Match: mast1a (microtubule associated serine/threonine kinase 1a [Source:ZFIN;Acc:ZDB-GENE-121214-221])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 323/614 (52.61%), Postives = 417/614 (67.92%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQ---TDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGSGLGSXXXXXXNDETIEHCEXXXXXXXXXXXXXGTVFHAFPSCSPRFSR 11391
            ++PRS+SL+P RS   Y+ +I ++NHVYKERFPKAT QM ERL+  +E    EN +   + +   +H QI +  ++ L  +    IT+ YF+EL +NLEKLL E   +   S L  +  +V+ L  II+RPARLLEC+EF+P+EFY LLE AE++ +  Q    D+P+YIIS+LGL +DP +   + +N     + G                        + E+++S E        P ESDF+ IKLISNGAYGAV+LVR ++T++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV ++C+FETR++LCM+MEYVEGGD ATL+K+IG LP ++ARMYFAETVLALEY+HN+GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMNLTT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG +I+  IEWP   D  +P +A +LI+ LL+ +PLVRLG  G  EVK+H FFS +DW GLLRQKA FIP L+ E+DTSYFD R+ RY+H +  D+ D             +DE +E                      F SCSPRFS+
Sbjct:  131 MRPRSRSLSPGRSSSCYDNEIVMMNHVYKERFPKATAQMEERLADFIESYSPENVLPLADGVLSFIHHQIAELSRNCLTKSREGLITTVYFYELQENLEKLLHEAYERSESSELTFITELVKKLFIIISRPARLLECLEFNPEEFYHLLEAAEDHAKEGQLMKADIPRYIISQLGLTRDPLE---DMVNLESYDSEGP----------------------HTPETDDSAEGKLKAIKPPCESDFQTIKLISNGAYGAVYLVRHRETRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNIGALPVDMARMYFAETVLALEYIHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKMGLMNLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVITDYIEWPNG-DEALPADAQSLISSLLQTNPLVRLGTGGAFEVKQHSFFSGLDWNGLLRQKAEFIPHLESEEDTSYFDTRSERYRHINSYDEDD-----------TNDDEPVE-------------------IRQFSSCSPRFSK 688          

HSP 2 Score: 98.5969 bits (244), Expect = 1.930e-19
Identity = 44/99 (44.44%), Postives = 67/99 (67.68%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            I I R  + +GF +RAIRV+ G+++VY++HH++  V+  G A +AGL  GDLITH+NG S+ G  HTEVV +I++SG  +++   P   + I+  GP R
Sbjct:  952 ITIQRSGKKYGFTLRAIRVYIGDTDVYSVHHIVWHVEDGGPAQEAGLCAGDLITHVNGESVHGLVHTEVVELILKSGNKVTVTTTPFENTSIKV-GPAR 1049          
BLAST of Talin-1 vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 928.317 bits (2398), Expect = 0.000e+0
Identity = 681/2286 (29.79%), Postives = 1182/2286 (51.71%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSA--AKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSR----TISRTFE-----SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQ+     +GL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG  K + VDDS TV EL++T+C+++GI NY+EYSLI + M+     ++T ++K+  ++ +D++K++KLK K HTED LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K KPGFL+L+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++           ++ +    K  +   ++    ++  S                  +T ++G   S    LTT  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SGE+L+ AA+ LA A ++L+ A  P   +     R+ +  AA ++G+AS +LL+QI E                    E D+ +Q+ L+ LAK+VAN    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V + + AT+  EL      AA+ V +AL+ L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L  AA++AA   T  I  S +A  + K+ A++ ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTV+D +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS       S+             ++++  + ++ + +L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + LP    +  +    +SEL     D NQ+  E+V A             + S D           D F ++   +   + N+D    +   +  +S     LL   K +  +      +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +L+NP  P S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q AYLVG+ D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR +    +  +   V  L     + +FA   A IS E   +Q PI  + +T+L+++  +I+ +++L  +  +   + + +   + ++D++K LI++I++ APGQ+ECD           Q+ DS  + ++   +    ++S+        S E+ Q  L S + ++ H I+ ++ A + E  QL    ++  +  E +V + +   ++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +DL+  L++ + + G V  +V++I ++ +K+ E         F + Q+    + Y      T       S +    L  L   +T  Y +L    + A AT   +  G Q++  +Q +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++      KE F   R +++  +  LV + KL+VS        L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +E  +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETME-EKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQ-----------QQQITRPGKPELGTVALPAIIRSGSS----------------GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTETDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGE-------------------NEADERFQDVLMNLAKAVANAAAMLVLKAKNVAQVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELLKQVSAAASVVSQALNDLLQHVRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHIPQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNAVQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAASTSDPQAASD-------------MLDSARDVMEGSANLIQEAKQALVAPGDAEIQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGESSKKLLVDSLP---PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQD----------FDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLENPNEPASDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFASNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECD-----------QSIDSINRFIRDIEQASLASVSQDLAMRDDISLEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEPTGTFVDYQTT--GVKYSKAIAVTAQEMMTKSVTNPEELGGLASQVTSDYGNLAVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMFATAGTLNAEN------KESFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2152          
BLAST of Talin-1 vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 924.08 bits (2387), Expect = 0.000e+0
Identity = 711/2453 (28.98%), Postives = 1244/2453 (50.71%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQ--EELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSA--AKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSR----TISRTFE-----SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPV-TDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR----IPVETVVSKLNELIK 7308
              L+I +   +V K +  +P   ++  C  IR+ + EAQ+     +GL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG  K + VDDS TV EL++T+C+++GI NY+EYSLI + M+     ++T ++K+  ++ +D++K++KLK K HTED LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K KPGFL+L+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++           ++ +    K  +   ++    ++  S                  +T ++G   S    LTT  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SGE+L+ AA+ LA A ++L+ A  P   +     R+ +  AA ++G+AS +LL+QI E                    E D+ +Q  + L+ LAK+VAN    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V + + AT+  EL      AA+ V +AL+ L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L  AA++AA   T  I  S +A  + K+ A++ ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTV+D +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS       S+             ++++  + ++ + +L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + LP    +  +    +SEL     D NQ+  E+V A             + S D           D F ++   +   + N+D    +   +  +S     LL   K +  +      +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +L+NP  P S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q AYLVG+ D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR +    +  +   V  L     + +FA   A IS E   +Q PI  + +T+L+++  +I+ +++L  +  +   + + +   + ++D++K LI++I++ APGQ+ECD           Q+ DS  + ++   +    ++S+        S E+ Q  L S + ++ H I+ ++ A + E  QL    ++  +  E +V + +   ++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +DL+  L++ + + G V  +V++I ++ +K+ E         F + Q+    + Y      T       S +    L  L   +T  Y +L    + A AT   +  G Q++  +Q +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++      KE F   R +++  +  LV + KL+VS        L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +E  +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +E+ +ACK  + +  V  D++++      +    Y E+L++    L  P+ ET+    I  + + + + ELI+
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETME-EKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQ-----------QQQITRPGKPELGTVALPAIIRSGSS----------------GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTETDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGE-------------------NEADERFQVFDVLMNLAKAVANAAAMLVLKAKNVAQVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELLKQVSAAASVVSQALNDLLQHVRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHIPQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNAVQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAASTSDPQAASD-------------MLDSARDVMEGSANLIQEAKQALVAPGDAEIQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGESSKKLLVDSLP---PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQD----------FDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLENPNEPASDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFASNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECD-----------QSIDSINRFIRDIEQASLASVSQDLAMRDDISLEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEPTGTFVDYQTT--GVKYSKAIAVTAQEMMTKSVTNPEELGGLASQVTSDYGNLAVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMFATAGTLNAEN------KESFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------EHIKQELTVFQSKDIPEKTS-----------SPEESIRMTKGITTATAKAVAAGNS-----CRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTRQRAFRYGTECTFAYLEMLEHVLSILQKPSLETKQQLSIFSKRIAAAVTELIQ 2289          
BLAST of Talin-1 vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 706/2451 (28.80%), Postives = 1236/2451 (50.43%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSA--AKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSR----TISRTFE-----SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPV-TDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR----IPVETVVSKLNELIK 7308
              L+I +   +V K +  +P   ++  C  IR+ + EAQ+     +GL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG  K + VDDS TV EL++T+C+++GI NY+EYSLI + M+     ++T ++K+  ++ +D++K++KLK K HTED LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K KPGFL+L+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++           ++ +    K  +   ++    ++  S                  +T ++G   S    LTT  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SGE+L+ AA+ LA A ++L+ A  P   +     R+ +  AA ++G+AS +LL+QI E                    E D+ +Q+ L+ LAK+VAN    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V + + AT+  EL      AA+ V +AL+ L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L  AA++AA   T  I  S +A  + K+ A++ ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTV+D +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS       S+             ++++  + ++ + +L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + LP    +  +    +SEL     D NQ+  E+V A             + S D           D F ++   +   + N+D    +   +  +S     LL   K +  +      +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +L+NP  P S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q AYLVG+ D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR +    +  +   V  L     + +FA   A IS E   +Q PI  + +T+L+++  +I+ +++L  +  +   + + +   + ++D++K LI++I++ APGQ+ECD           Q+ DS  + ++   +    ++S+        S E+ Q  L S + ++ H I+ ++ A + E  QL    ++  +  E +V + +   ++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +DL+  L++ + + G V  +V++I ++ +K+ E         F + Q             TT +                      +Y         A+A  + E  G Q++  +Q +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++      KE F   R +++  +  LV + KL+VS        L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +E  +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +E+ +ACK  + +  V  D++++      +    Y E+L++    L  P+ ET+    I  + + + + ELI+
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETME-EKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQ-----------QQQITRPGKPELGTVALPAIIRSGSS----------------GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTETDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGE-------------------NEADERFQDVLMNLAKAVANAAAMLVLKAKNVAQVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELLKQVSAAASVVSQALNDLLQHVRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHIPQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNAVQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAASTSDPQAASD-------------MLDSARDVMEGSANLIQEAKQALVAPGDAEIQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGESSKKLLVDSLP---PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQD----------FDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLENPNEPASDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFASNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECD-----------QSIDSINRFIRDIEQASLASVSQDLAMRDDISLEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEPTGTFVDYQ-------------TTGV----------------------KYSK-------AIAVTAQEMVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMFATAGTLNAEN------KESFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------EHIKQELTVFQSKDIPEKTS-----------SPEESIRMTKGITTATAKAVAAGNS-----CRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTRQRAFRYGTECTFAYLEMLEHVLSILQKPSLETKQQLSIFSKRIAAAVTELIQ 2247          
BLAST of Talin-1 vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 707/2444 (28.93%), Postives = 1235/2444 (50.53%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSA--AKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQN--ILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPV-TDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR----IPVETVVSKLNELIK 7308
              L+I +   +V K +  +P   ++  C  IR+ + EAQ+     +GL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG  K + VDDS TV EL++T+C+++GI NY+EYSLI + M+     ++T ++K+  ++ +D++K++KLK K HTED LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K KPGFL+L+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++           ++ +    K  +   ++    ++  S                  +T ++G   S    LTT  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SGE+L+ AA+ LA A ++L+ A  P   +     R+ +  AA ++G+AS +LL+QI E                    E D+ +Q+ L+ LAK+VAN    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V + + AT+  EL      AA+ V +AL+ L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L  AA++AA   T  I  S +A  + K+ A++ ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTV+D +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS       S+             ++++  + ++ + +L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + LP    +  +    +SEL     D NQ+  E+V A             + S D           D F ++   +   + N+D    +   +  +S     LL   K +  +      +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +L+NP  P S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q AYLVG+ D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR +    +  +   V  L     + +FA   A IS E   +Q PI  + +T+L+++  +I+ +++L  +  +   + + +   + ++D++K LI++I++ APGQ+ECD           Q+ DS  + ++   +    +   + + ++   L+ +  Q+ H +            QLAR F       E +V + +   ++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +DL+  L++ + + G V  +V++I ++ +K+ E         F + Q+    + Y      T       S +    L  L   +T  Y +L    + A AT   +  G Q++  +Q +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++      KE F   R +++  +  LV + KL+VS        L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +E  +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +E+ +ACK  + +  V  D++++      +    Y E+L++    L  P+ ET+    I  + + + + ELI+
Sbjct:    8 LSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETME-EKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQ-----------QQQITRPGKPELGTVALPAIIRSGSS----------------GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTETDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGE-------------------NEADERFQDVLMNLAKAVANAAAMLVLKAKNVAQVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELLKQVSAAASVVSQALNDLLQHVRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHIPQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNAVQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAASTSDPQAASD-------------MLDSARDVMEGSANLIQEAKQALVAPGDAEIQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGESSKKLLVDSLP---PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQD----------FDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLENPNEPASDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFASNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECD-----------QSIDSINRFIRDIEQASLASVSQDLAMRDDISLEVSAAQLGHKVT-----------QLARYF-------EPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAFHTHDAIAEAAQLMKEAVDDLMITLNEAASEVGMVGGMVDSIAEAMSKLDEGTPPEPTGTFVDYQTT--GVKYSKAIAVTAQEMMTKSVTNPEELGGLASQVTSDYGNLAVQGRMAAATAEPKEVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMFATAGTLNAEN------KESFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------EHIKQELTVFQSKDIPEKTS-----------SPEESIRMTKGITTATAKAVAAGNS-----CRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTRQRAFRYGTECTFAYLEMLEHVLSILQKPSLETKQQLSIFSKRIAAAVTELIQ 2266          
BLAST of Talin-1 vs. Ensembl Xenopus
Match: TLN2 (talin 2 [Source:NCBI gene;Acc:100144637])

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 588/1916 (30.69%), Postives = 1011/1916 (52.77%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSA--AKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSR----TISRTFE-----SEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPK 5724
              L+I +   +V K +  +P   ++  C  IR+ + EAQ+     +GL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG  K + VDDS TV EL++T+C+++GI NY+EYSLI + M+     ++T ++K+  ++ +D++K++KLK K HTED LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K KPGFL+L+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++           ++ +    K  +   ++    ++  S                  +T ++G   S    LTT  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SGE+L+ AA+ LA A ++L+ A  P   +     R+ +  AA ++G+AS +LL+QI E                    E D+ +Q+ L+ LAK+VAN    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V + + AT+  EL      AA+ V +AL+ L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L  AA++AA   T  I  S +A  + K+ A++ ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTV+D +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS       S+             ++++  + ++ + +L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + LP    +  +    +SEL     D NQ+  E+V A             + S D           D F ++   +   + N+D    +   +  +S     LL   K +  +      +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +L+NP  P S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q AYLVG+ D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR +    +  +   V  L     + +FA   A IS E   +Q PI  + +T+L+++  +I+ +++L  +  +   + + +   + ++D++K LI++I++ APGQ+ECD           Q+ DS  + ++   +    ++S+        S E+ Q  L S + ++ H I+ ++ A + E  QL    ++  +  E +V + +   ++    Q     L+   T+ E++ Q+L A K+ GGNPK
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVSEAQSGQALDFGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDVLEYKKKHRPQKIRMLDGAAKMILVDDSKTVGELLVTICSRIGITNYEEYSLIRETME-EKKEEQTGTLKKDRTLLRDEKKMEKLKAKLHTEDELNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQAQIQFGPHVESKHKPGFLELKEFLPKEYMKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQ-----------QQQITRPGKPELGTVALPAIIRSGSS----------------GPETFNVGSMPSAQQQLTTGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAHSDLSQVDNLPPLGHDMASRVWIQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTETDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGEKLLGAARTLAGAVSDLLTAVQPSSGEP----RQTVLTAAGSIGQASGELLRQIGE-------------------NEADERFQDVLMNLAKAVANAAAMLVLKAKNVAQVTEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVHACHSATEDIELLKQVSAAASVVSQALNDLLQHVRQFASRGEPIGRYDQATDTIMSVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMDNSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEAAAKQAAAAATQTIAASQNASLSNKNTAAHQQLVQSCKTVADHIPQLVQGVRSSQAQAEDLSAQLTLIVSSQNFLQPGSKMVASAKAAVPTVTDQAAAMQLSQCAKNLATSLAELRTAAQKAHEACGPMEIDSALNAVQTLKNELQDAKMAASDRQLKPLPGETLEKCAQDLGSTSKTVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAASTSDPQAASD-------------MLDSARDVMEGSANLIQEAKQALVAPGDAEIQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGESSKKLLVDSLP---PSTKSFQEAQSELNQAAEDLNQSAGEVVHASRGQSGELAAASGKFSQD----------FDEFLDAGIEMAGQTQNKDDQMQVIGSLKTISMASSKLLLAAKSLSVDSGAPSAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLENPNEPASDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVSVASKALCGLTEAAVQAAYLVGISDPNSQAGQQGLVDPIQFARANQAIQMACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKTLDGDFSEENRNKCSIATSPLISAVENLTAFASNPEFASIPAQISSEGARAQEPILVSAVTMLESSSSLIKTARSLAINPKDPPTWSSLAGHSRIVSDSIKSLITSIRDKAPGQRECD-----------QSIDSINRFIRDIEQASLASVSQDLAMRDDISLEALQEQLTSVVQEIGHLIDPITTAARGEAAQLGHKVTQLARYFEPLVLAAVGLVSKVLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPK 1790          

HSP 2 Score: 91.6633 bits (226), Expect = 4.228e-17
Identity = 97/419 (23.15%), Postives = 186/419 (44.39%), Query Frame = 1
Query: 6073 AVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPV-TDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR----IPVETVVSKLNELIK 7308
            A+A  + E  G Q++  +Q +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++      KE F   R +++  +  LV + KL+VS        L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +E  +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +E+ +ACK  + +  V  D++++      +    Y E+L++    L  P+ ET+    I  + + + + ELI+
Sbjct: 1816 AIAVTAQEMVGFQIKSRIQDLGHGCIFLVQKAGALQICPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITASSAVSGIIADLDTTIMFATAGTLNAEN------KESFADHRENILKTAKALVEDTKLLVSGAASSQEKLAQAAQSSANTITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALGDLIEATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------EHIKQELTVFQSKDIPEKTS-----------SPEESIRMTKGITTATAKAVAAGNS-----CRQEDVIATANLSRKAVSEMLTACKQAVYHPDVNADTRQRAFRYGTECTFAYLEMLEHVLSILQKPSLETKQQLSIFSKRIAAAVTELIQ 2198          
BLAST of Talin-1 vs. Ensembl Mouse
Match: Tln1 (talin 1 [Source:MGI Symbol;Acc:MGI:1099832])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 696/2283 (30.49%), Postives = 1176/2283 (51.51%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK---VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKK-MRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRS------RTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQ--IDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAID 6819
            L + I   +V K +  +P   ++  C  IR+ I EA    P  +GL+L  DD KKG+WL+  K L +Y+L+ GDT+EYR + R L IR +DGT KT+ VDDS TV+++++T+C ++GI N+DEYSL+ + M+     + T ++++  ++ +D++K++KLK+K HT+D LNWL+  ++LR+QG+EE E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G ++  K K GFLDL++ LPKEY K  +  E+KIF  H     +SE+EAK +Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+   +              M S AS         + +Q           +G        +T+  MH   M      Q+    ++  ++  +Q  +  L      P +G+D AS+ W    +D S+  +  ++ A+ A  A V+    G          +  E     +  + + I+ +L  +   ++  A     L DE  +G  L+ AAK LA A + L+++A P   + R    + +  AA  VG+AS +LLQQI E                   ++ D  +Q+ L++LAK+VA+    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++ TK+VAPTI   VCQEQL+ +   V+KA++  V +S  AT+  +L      AA  V +AL+ L++H++           +  A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK      D    +  LREA E   + T        I+++++  L  AA++AA + T  I  +  AA   +AS      +    + ++ QI  L+  ++ ++  P    AQL LIAA + ++ P  ++  + K   PT+ D +    L+Q       A  EL+    +A   C  L++ +AL  ++ LE++L+ IK +     L PLP E  ++    L  S +   SA  +   ++           G ++Y  +   DVAG         L  L  AARGVAA           +D  ++ +    +++   + +  A  L+ EAK +   P D +   R  Q +  ++ AL+ C+  LPGQRD+D   + +     +   + LP    +       +S L +     NQA  ELV A      ++G  + +  +  R  +  +  +    + +  A      +R  + + +  +S     LL   K +  +P +  ++ QL  A + + DSIN+L+T + T   PGQKECD  + +LE++R +L+NPV PI+   YF CLD +++ + + L +++  I    K+ N  +F D+I   + ++C   E  AQ AYLVGV D  S+ G +GL + T F +  + I   CQ++  P  T  Q    ++S A  +A+++  LC + +  +   + P  K +     K    + + L+  ++ L+ +F E+NR +  + +  + + V  L     + +F+   A IS E + +  PI  +  T+L++A  +IQ ++AL  +  +   +   +   + ++D++K LI+++++ APGQ EC+            A +S ++ +   S      +   R   S+E+    + +A+ ++ H I  L+ A + E  QL    S+  Q  E +  + + AA++T         L+   T+ E++ QLL   K++GGNPK  + H+Q  ++E  Q + E+ EDL   L++ +   G V  +V++IT++  ++ E  +   +  F + Q+ M+     +     ++ + +N+   +  L PL   LT  Y  L    + A     NE  G  ++  VQ +G    +LV     ++  PS   +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +   +RE     E F   R  ++  +  LV + K++V         L ++A     T   LA+ VK+G   L +   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   K  +A++
Sbjct:    4 LSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKD-EGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVK--QKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAI--------------MRSGASGP-------ENFQ-----------VGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG----------DPAETDYTAVGCAVTTISSNLTEMSRGVKLLAAL---LEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT-NAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEI---------AQGNENYAGIAARDVAG--------GLRSLAQAARGVAAL---------TSDPAVQAI----VLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLP---PSTGTFQEAQSRLNEAAAGLNQAATELVQA------SRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQ--EDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENS-KVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQ----VLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECE--------TAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPK-QAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEE--LGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTL---NREGA---ETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALE 2147          
BLAST of Talin-1 vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 933.324 bits (2411), Expect = 0.000e+0
Identity = 692/2281 (30.34%), Postives = 1187/2281 (52.04%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDV-SGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSS------NRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++   +  R+  +E   V       + SS                            +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A     L D+DV SGE+L+ AA+ LA A ++L+KA  P   + R    + +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ ++  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS          ND      A   ++++  + ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       ++  +   +  +S     LL   K +  +P     +  L  A + + +SIN+L+  + T   PGQKECD  +  LE+++ +L+NP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +FA   A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +D++  L++ + + G V  +V+ I ++ +K+ E      K  F + Q+ ++   Y      T       S +    L  L   +T  Y  L    Q A AT   E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S+  +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    6 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQ--QFNRTGKAEHGSVALPAVMRSGSS--------------------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAA----LMDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPR----QTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS---------TNDPE----AAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGEASKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIM-LCTQQAPGQKECDNALRELETVKGMLENPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK--YSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------GETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2153          
BLAST of Talin-1 vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 692/2281 (30.34%), Postives = 1187/2281 (52.04%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDV-SGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSS------NRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++   +  R+  +E   V       + SS                            +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A     L D+DV SGE+L+ AA+ LA A ++L+KA  P   + R    + +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ ++  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS          ND      A   ++++  + ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       ++  +   +  +S     LL   K +  +P     +  L  A + + +SIN+L+  + T   PGQKECD  +  LE+++ +L+NP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +FA   A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +D++  L++ + + G V  +V+ I ++ +K+ E      K  F + Q+ ++   Y      T       S +    L  L   +T  Y  L    Q A AT   E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S+  +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQ--QFNRTGKAEHGSVALPAVMRSGSS--------------------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAA----LMDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPR----QTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS---------TNDPE----AAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGEASKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIM-LCTQQAPGQKECDNALRELETVKGMLENPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK--YSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------GETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2151          
BLAST of Talin-1 vs. Ensembl Mouse
Match: Tln2 (talin 2 [Source:MGI Symbol;Acc:MGI:1917799])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 692/2281 (30.34%), Postives = 1187/2281 (52.04%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDV-SGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSS------NRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++   +  R+  +E   V       + SS                            +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A     L D+DV SGE+L+ AA+ LA A ++L+KA  P   + R    + +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ ++  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS          ND      A   ++++  + ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       ++  +   +  +S     LL   K +  +P     +  L  A + + +SIN+L+  + T   PGQKECD  +  LE+++ +L+NP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +FA   A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +D++  L++ + + G V  +V+ I ++ +K+ E      K  F + Q+ ++   Y      T       S +    L  L   +T  Y  L    Q A AT   E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S+  +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQ--QFNRTGKAEHGSVALPAVMRSGSS--------------------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAA----LMDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPR----QTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS---------TNDPE----AAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGEASKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIM-LCTQQAPGQKECDNALRELETVKGMLENPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK--YSKAIAVTAQEMMTKSVTNPEELGGLASQMTTDYGHLALQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------GETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2151          
BLAST of Talin-1 vs. Ensembl Mouse
Match: Mast4 (microtubule associated serine/threonine kinase family member 4 [Source:MGI Symbol;Acc:MGI:1918885])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 313/555 (56.40%), Postives = 400/555 (72.07%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            ++PRS+SL+P RSP   + +I ++NHVYKERFPKAT QM ERL  ++     ++ +   + +    H QI++  +D L+ ++   ITS YFFEL   L+KLL+E   +     LA ++ +V+ +L +IARPARLLEC+EFDP+EFY LLE AE + +    ++TD+P+YIIS+LGL+KDP     EE+      +  + E        S               SN SL L       P+ESDFE IKLISNGAYGAV+ VR K++++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV +YC+FETR++LCM+MEYVEGGD ATL+K++GPLP ++ARMYFAETVLALEYLHN+GIVHRDLKPDNLL+T  GHIKLTDFGLSKVGLM++TT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG +IS EI WP+  D   P +A  LIT LL+++PL RLG  G +EVK+H FF  +DW  LLRQKA FIP L+ EDDTSYFD R+ +Y H
Sbjct:  173 MRPRSRSLSPGRSPACCDHEIIMMNHVYKERFPKATAQMEERLKEIITSYSPDHVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFFELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLEAAEGHAKEGQGIKTDIPRYIISQLGLNKDPL----EEMAQLGNYDSRTAETPEMDESVSS--------------SNTSLRLR----RKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEINWPEK-DEAPPPDAQELITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLRQKAEFIPQLESEDDTSYFDTRSEKYHH 704          

HSP 2 Score: 111.694 bits (278), Expect = 2.180e-23
Identity = 48/99 (48.48%), Postives = 70/99 (70.71%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            IVIH   +N+GF IRAIRV+ G+S++YT+HH++  V+    A+QAGL+ GDLITHING  + G  HTEV+ ++++SG  +S+   P   + I+T GP R
Sbjct:  966 IVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVWNVEEGSPAYQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSGNKVSITTTPFENTSIKT-GPAR 1063          
BLAST of Talin-1 vs. UniProt/SwissProt
Match: sp|Q9Y490|TLN1_HUMAN (Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3)

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 725/2432 (29.81%), Postives = 1223/2432 (50.29%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK---VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKK-MRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRS------RTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQ--IDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVT-DSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETR 7263
            L + I   +V K +  +P   ++  C  IR+ I EA    P  +GL+L  DD KKG+WL+  K L +Y+L+ GDT+EYR + R L IR +DGT KT+ VDDS TV+++++T+C ++GI N+DEYSL+ + M+     + T ++++  ++ +D++K++KLK+K HT+D LNWL+  ++LR+QG+EE E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G ++  K K GFLDL++ LPKEY K  +  E+KIF  H     +SE+EAK +Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+   +              M S AS         + +Q           +G        +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G+D AS+ W    +D S+  +  ++ A+ A  A V+    G          +  E     +  + + I+ +L  +   ++  A     L DE  SG  L+ AAK LA A + L+++A P   + R    + +  AA  VG+AS +LLQQI E                   ++ D  +Q+ L++LAK+VA+    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++ TK+VAPTI   VCQEQL+ +   V+KA++  V +S  AT+  +L      AA  V +AL+ L++H++           +  A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK      D    +  LREA E   + T        I+++++  L  AA++AA + T  I  +  AA   +AS      +    + ++ QI  L+  ++ ++  P    AQL LIAA + ++ P  ++  + K   PT+ D +    L+Q       A  EL+    +A   C  L++ +AL  ++ LE++L+ +K +     L PLP E  ++    L  S +   SA  Q          + E   G ++Y  +   DVAG         L  L  AARGVAA           +D  ++ +    +++   + +  A  L+ EAK +   P D +   R  Q +  ++ AL+ C+  LPGQRD+D   + +     +   + LP    +       +S L +     NQA  ELV A      ++G  + +  +  R  +  +  +    + +  A      +R  + + +  +S     LL   K +  +P    ++ QL  A + + DSIN+L+T + T   PGQKECD  +  LE++R +L+NPV PI+   YF CLD +++ + + L +++  I    K+ N  +F D+I   + ++C   E  AQ AYLVGV D  S+ G +GL + T F +  + I   CQ++  P  T  Q    ++S A  +A+++  LC + +  +   + P  K +     K    + + L+  ++ L+  F E+NR +  + +  + + V  L     + +F+   A IS E + +  PI  +  T+L++A  +IQ ++AL  +  +   +   +   + ++D++K LI+++++ APGQ EC+            A +S ++ +   S      +   R   S+E+    + +A+ ++ H I  L+ A + E  QL    S+  Q  E +  + + AA++T         L+   T+ E++ QLL   K++GGNPK  + H+Q  ++E  Q + E+ EDL   L++ +   G V  +V++IT++  ++ E  +   +  F + Q+ M+     +     ++ + +N+   +  L PL   LT  Y  L    + A     NE  G  ++  VQ +G    +LV     ++  PS A +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +   +RE     E F   R  ++  +  LV + K++V         L ++A     T   LA+ VK+G   L +   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   K  +A++                   I +E +   SP    + S            PE+  R+   +     K +   +       RQE++   +    +   ++  ACK    +  V  D + + L+   +    Y ELL +  L L  P+ E +
Sbjct:    4 LSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELME-EKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVK--QKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAI--------------MRSGASGP-------ENFQ-----------VGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG----------DPAETDYTAVGCAVTTISSNLTEMSRGVKLLAAL---LEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDTDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT-NAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQL---------LGEVAQGNENYAGIAARDVAG--------GLRSLAQAARGVAAL---------TSDPAVQAI----VLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLP---PSTGTFQEAQSRLNEAAAGLNQAATELVQA------SRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQ--EDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPNLKSQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENS-KVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQ----VLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECE--------TAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPK-QAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEE--LGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTL---NREGT---ETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALE--------------ATTEHIRQELAVFCSPEPPAKTST-----------PEDFIRMTKGITMATAKAVAAGNS-----CRQEDVIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELK 2266          
BLAST of Talin-1 vs. UniProt/SwissProt
Match: sp|P26039|TLN1_MOUSE (Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2)

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 696/2283 (30.49%), Postives = 1176/2283 (51.51%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFK---VCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKK-MRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRS------RTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQ--IDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAID 6819
            L + I   +V K +  +P   ++  C  IR+ I EA    P  +GL+L  DD KKG+WL+  K L +Y+L+ GDT+EYR + R L IR +DGT KT+ VDDS TV+++++T+C ++GI N+DEYSL+ + M+     + T ++++  ++ +D++K++KLK+K HT+D LNWL+  ++LR+QG+EE E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G ++  K K GFLDL++ LPKEY K  +  E+KIF  H     +SE+EAK +Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+   +              M S AS         + +Q           +G        +T+  MH   M      Q+    ++  ++  +Q  +  L      P +G+D AS+ W    +D S+  +  ++ A+ A  A V+    G          +  E     +  + + I+ +L  +   ++  A     L DE  +G  L+ AAK LA A + L+++A P   + R    + +  AA  VG+AS +LLQQI E                   ++ D  +Q+ L++LAK+VA+    L+ + K +A   E+   Q +V+ AAT+  L+ SQL++ TK+VAPTI   VCQEQL+ +   V+KA++  V +S  AT+  +L      AA  V +AL+ L++H++           +  A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK      D    +  LREA E   + T        I+++++  L  AA++AA + T  I  +  AA   +AS      +    + ++ QI  L+  ++ ++  P    AQL LIAA + ++ P  ++  + K   PT+ D +    L+Q       A  EL+    +A   C  L++ +AL  ++ LE++L+ IK +     L PLP E  ++    L  S +   SA  +   ++           G ++Y  +   DVAG         L  L  AARGVAA           +D  ++ +    +++   + +  A  L+ EAK +   P D +   R  Q +  ++ AL+ C+  LPGQRD+D   + +     +   + LP    +       +S L +     NQA  ELV A      ++G  + +  +  R  +  +  +    + +  A      +R  + + +  +S     LL   K +  +P +  ++ QL  A + + DSIN+L+T + T   PGQKECD  + +LE++R +L+NPV PI+   YF CLD +++ + + L +++  I    K+ N  +F D+I   + ++C   E  AQ AYLVGV D  S+ G +GL + T F +  + I   CQ++  P  T  Q    ++S A  +A+++  LC + +  +   + P  K +     K    + + L+  ++ L+ +F E+NR +  + +  + + V  L     + +F+   A IS E + +  PI  +  T+L++A  +IQ ++AL  +  +   +   +   + ++D++K LI+++++ APGQ EC+            A +S ++ +   S      +   R   S+E+    + +A+ ++ H I  L+ A + E  QL    S+  Q  E +  + + AA++T         L+   T+ E++ QLL   K++GGNPK  + H+Q  ++E  Q + E+ EDL   L++ +   G V  +V++IT++  ++ E  +   +  F + Q+ M+     +     ++ + +N+   +  L PL   LT  Y  L    + A     NE  G  ++  VQ +G    +LV     ++  PS   +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +   +RE     E F   R  ++  +  LV + K++V         L ++A     T   LA+ VK+G   L +   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   K  +A++
Sbjct:    4 LSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGLFLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKD-EGTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVK--QKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQYNRVGKVEHGSVALPAI--------------MRSGASGP-------ENFQ-----------VGSMPPAQQQITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNLTAG----------DPAETDYTAVGCAVTTISSNLTEMSRGVKLLAAL---LEDEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDTDPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT-NAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEIKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEI---------AQGNENYAGIAARDVAG--------GLRSLAQAARGVAAL---------TSDPAVQAI----VLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLP---PSTGTFQEAQSRLNEAAAGLNQAATELVQA------SRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQ--EDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENS-KVLGEAMTGISQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQ----VLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECE--------TAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPK-QAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEE--LGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTL---NREGA---ETFADHREGILKTAKVLVEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALE 2147          
BLAST of Talin-1 vs. UniProt/SwissProt
Match: sp|P54939|TLN1_CHICK (Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2)

HSP 1 Score: 959.518 bits (2479), Expect = 0.000e+0
Identity = 734/2449 (29.97%), Postives = 1252/2449 (51.12%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLI--NTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK---SSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRD---HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQ--IDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLD----ICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVT-DSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPV----ETVVSKLNELIK 7308
            L + I   +V K +  +P   ++  C  IR+ + EAQ   P  +GL+L  +D KKG+WL+  K L +Y+L+ GDT+EY+ + R L IR +DGT KT+ VDDS TV++++ T+C ++GI NYDEYSL+ + M+     + T ++K+  ++ +D++K++KLK+K HT+D LNWL+  ++LR+QGI+++E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G ++  K KPGFL+L++ LPKEY K  +  E+KIF  H    ++SE+EAK +Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+   ++        N  V    QA   + S      +   +  ++Q               T +++  M   +  Q        D+ +T+             P +G+D AS+ W    +D S+  +  +  A+ A  A V+    G     +          I+      S     L +LME             DE  +G +L+ AAK LA A ++L+K A P   + R    + +  AA  VG+ S +LLQQI E                   ++ D  +Q+ L++LAK+VA+    L+ + K +A + E+ + Q +V+ AAT+  L+ SQL++ TK+VAPTI   VCQEQLI + + V+K+ +  VE+S  AT  ++L      AA  V +AL+ L++H+++       +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK      D    +  LREA E   + T        I+++++  L  AA++AA + T  I      +A+ K+ A+  ++    + +++QI  L+  ++ ++  P    AQL LIAA ++++ P  ++  + K   PT++D +    L+Q       A  EL+    +A   C  L++ +AL  ++ LE++LK  K +     L PLP E  ++ A  L  S +   SA             + E   G ++Y         G  ARE++ AL  L  AARGVAA+       S+   +N    A L+  ++ ++    A +L+ EA+   + P D D   R  Q +  +S AL+ C++ LPGQRD+D   + +     +   +  P    +N      +S+L       NQ+ NELV A      +      +   D           + F ++   +  LS  ++    + + +  +S     LL   K +  +P +  ++ QL  A + + DSIN+L+T + T   PGQKECD  +  LE+++ +L+NP   ++   YF CLD +++ + + L +S+  I    K+    +F +SI   + ++C L E  AQ AYLVGV D  S+ G +GL D T F +  + I   CQ + +P  T  Q    ++S A  +A+++  LC   +  +   + P  K +     K    + + L+  ++ L+  FNE+NR+   + +  + + V  L     + +FA   A IS E + +  PI  +  T+L+++  +IQ +++L  +  +   +   +   + ++D++K LI+ +++ APGQ+ECDEA+ +L + +++   + +  +    +   R   S+E+  N + +A+ ++ + I  ++ A + E  QL    S+  Q  E ++ + I AA++T   Q     L+   T+ E++ Q+L   K++GGNPK  + H+Q  ++E  Q + E+ EDL   L++ +   G V  +V++IT++  ++ E  +   +  F + Q+ M+     I   +  + T  ++N +       L  L   LT  Y  L +  + A  T  NE  G  ++  VQ +G    +LV     ++  PS A +   L    +++ +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R  ++  +  LV + K++V         L ++A     T   LA  VK+G   L S   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   K  +A++  I                I +E +   SP    ++S            PE+  R+   +     K +   +       RQE++   +    +   ++  ACK    +  V+ D +++ L    +  + Y ELL++  + L  PT E +  +    + V S + ELI+
Sbjct:    4 LSLKISIGNVVKTMQFEPSTMVYDACRMIRERVPEAQMGQPNDFGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTMEYKKKQRPLKIRMLDGTVKTVMVDDSKTVTDMLTTICARIGITNYDEYSLVREIME-EKKEEVTGTLKKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGIDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPKEYIK--QKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVLQQQFNRVGKAELGSVALPAIMRTGAGGPENFQVGTMPQAQMQITSGQMHRGHMPPLTSAQQA-------------LTGTINSSMQAVNAAQATL-----DDFETL-------------PPLGQDAASKAWRKNKMDESKHEIHSQADAITAGTASVVNLTAGDPADTDYTAVGCAVTTISSNLTEMSKGVKLLAALME-------------DEGGNGRQLLQAAKNLASAVSDLLKTAQPASAEPR----QNLLQAAGLVGQTSGELLQQIGE-------------------SDTDPRFQDMLMQLAKAVASAAAALVLKAKNVAQKTEDSALQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLIEAGKLVAKSAEGCVEASKAATNDDQLLKQVGVAATAVTQALNDLLQHIKQHATGGQPIGRYDQATDTILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGETDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMAT-NAAAQNAIKKKLVHKLEHAAKQAAASATQTIAAAQHAAASNKNPAAQQQLVQSCKVVADQIPMLVQGVRGSQSQPDSPSAQLALIAASQNFLQPGGKMVAAAKATVPTITDQASAMQLSQCAKNLAAALAELRTAAQKAQEACGPLEIDSALGLVQSLERDLKEAKAAARDGKLKPLPGETMEKCAQDLGNSTKAVTSAIAHL---------LGEVAQGNENY--------TGIAAREVAQALRSLSQAARGVAAN------SSDPQAQN----AMLECASDVMD---KANNLIEEARKAVAKPGDPDSQQRLVQVAKAVSQALNRCVNCLPGQRDVDAAIRMVGEASKRLLSDSFP---PSNKTFQEAQSQLNRAAAGLNQSANELVQASRGTPQDLAKSSGKFGQD----------FNEFLQAGVEMASLSPTKEDQAQVVSNLKSISMSSSKLLLAAKALSADPTSPNLKSQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRELETVKELLENPTQTVNDMSYFSCLDSVMENS-KVLGESMAGISQNAKNSKLPEFGESISAASKALCGLTEAAAQAAYLVGVSDPNSQAGQQGLVDPTQFARANQAIQMACQNLVDPACTQSQ----VLSAATIVAKHTSALCNTCRLASSRTANPVAKRQFVQPAKEVANSTANLVKTIKALDGAFNEENRERCRAATAPLIEAVDNLTAFASNPEFATVPAQISPEGRRAMEPIVTSAKTMLESSAGLIQTARSLAVNPKDPPQWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIDVLNRCMREVDQASLAAISQ--QLAPREGISQEALHNQMITAVQEINNLIEPVASAARAEASQLGHKVSQMAQYFEPLILAAIGAASKTPNHQQQMNLLDQTKTLAESALQMLYTAKEAGGNPK-QAAHTQEALEEAVQMMKEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGTFVDYQTTMVKTAKAIAVTVQEMVTKSTTNPDE------LGILANQLTNDYGQLAQQAKPAALTAENEEIGSHIKRRVQELGHGCAALVTKAGALQCSPSDAYTKKELIESARKVSEKVSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREN------SETFADHREGILKTAKALVEDTKVLVQNATASQEKLAQAAQSSVSTITRLAEVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLIGATKAAAGKAGDDPAVYQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATI--------------EHIRQELAVFSSPVPPAQVST-----------PEDFIRMTKGITMATAKAVAAGNS-----CRQEDVIATANLSRRAIADMLRACKEAAYHPEVSADVRQRALRFGKECADGYLELLEHVLVILQKPTHELKQQLAGYSKRVASSVTELIQ 2284          
BLAST of Talin-1 vs. UniProt/SwissProt
Match: sp|Q9Y4G6|TLN2_HUMAN (Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 717/2424 (29.58%), Postives = 1234/2424 (50.91%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMI------MSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDS-KKQTLNTVDQLVENYTELLKNFKLYLTNPTKE 7257
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++   +  R+  +E   V       + SS                            +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A   D   DE  SGE+L+ AA+ LA A ++L+KA  P   + R    + +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ A+  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS               +  A   ++++  + ++ +  L+ EAK    +P D ++  R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       + + +      +S     LL   K +  +P     +  L  A + + +SIN+L+T + T   PGQKECD  +  LE+++ +LDNP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +F    A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA   H  I E AQ + E+ +D++  L++ + + G V  +V+ I ++ +K+ E      K  F + Q+ ++   Y      T       S +    L  L   +T  Y  L    Q A AT   E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S   +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I                I +E +  +S     + S           +PEE  R+   +     K +   +       RQE++   +    K  +++ +ACK    +  V+D  + + L    +    Y +LL++  + L  PT E
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQ--QFNRTGKAEHGSVALPAVMRSGSS--------------------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMD---DEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPR----QTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS-------------TTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK--YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------SETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATKGAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI--------------ECIKQELTVFQSKDVPEKTS-----------SPEESIRMTKGITMATAKAVAAGNS-----CRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPE 2265          
BLAST of Talin-1 vs. UniProt/SwissProt
Match: sp|Q71LX4|TLN2_MOUSE (Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3)

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 599/1917 (31.25%), Postives = 1022/1917 (53.31%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDV-SGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSS------NRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHS 5742
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  +D +KG+WL+  +TL +Y+L+ GD +EY+ + R   IR +DG+ KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     + T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++E+E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF +H    ++SE+EAK KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ K+SV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P           +KRS++ ++      KA   + ++    ++  S                  +T ++G   SP   +    MH   M      Q+  + ++  ++  +Q+ +D L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + ++  A     L D+DV SGE+L+ AA+ LA A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  V +   AT   EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     E   KL+ AAK LA++T  ++++AK    + +  + +  LREA E   V T        I++++++ L VAA++AA   T  I  S +AA   K+ ++  ++    + +++ I  L+  ++ ++   +D  AQL LI + ++++ P  ++  S K   PTVSD +    L+Q       +  EL+    +A   C  +++ +AL  ++ L+  L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAAS          ND      A   ++++  + ++ +  L+ EAK    +P D +   R  Q +  +S +L+ C++ LPGQ+D+D+  K I     +   + LP    +       +SEL     D NQ+  E+V A             + S             D FDE   A   ++       ++  +   +  +S     LL   K +  +P     +  L  A + + +SIN+L+  + T   PGQKECD  +  LE+++ +L+NP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E  AQ AYLVG+ D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+EDNR +    +  + + V  L     + +FA   A IS E  ++Q PI  +  T+L+++  +I+ +++L  +  +   +   +     ++D++K LI++I++ APGQ+ECD ++  + + I+    + +  +     T  R   S E+ Q  L S + ++ H I+ ++ A + E  QL    ++     E ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPKA  VH+
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIE-EKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSP-----------KKRSTILQQQFNRTGKAEHGSVALPAVMRSGSS----------------GPETFNVGSMPSPQQQVMVGQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------DPADTDYTAVGCAITTISSNLTEMSKGVKLLAA----LMDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATSDSELLKQVSAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNPSAQQQLVQSCKAVADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAAESQLKPLPGETLEKCAQDLGSTSKGVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKTLAQAARGVAAS---------TNDPE----AAHAMLDSARDVMEGSAMLIQEAKQALIAPGDTESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGEASKKLLVDSLP---PSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFS-------------DDFDEFLDAGIEMAGQAQTKEDQMQVIGNLKNISMASSKLLLAAKSLSVDPGAPNAKNLLAAAARAVTESINQLIM-LCTQQAPGQKECDNALRELETVKGMLENPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQ----VLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKCRIATTPLIEAVENLTAFASNPEFASIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQASLAAVSQSLAT--RDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGVASKMLDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKA--VHT 1794          

HSP 2 Score: 85.8853 bits (211), Expect = 1.057e-14
Identity = 67/254 (26.38%), Postives = 124/254 (48.82%), Query Frame = 1
Query: 6073 AVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            A+A  + E  G Q++  VQ +G   I LV+     +V P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R +++  +  LV + KL+VS      + L ++A   A T   LA  VK+G   L S+  +  + L+ + ++V  +L   +   +  +  P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct: 1815 AIAVTAQEMIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAEN------GETFADHRENILKTAKALVEDTKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSNDPETQVVLINAIKDVAKALSDLIGATKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2062          
BLAST of Talin-1 vs. TrEMBL
Match: A0A504YNR7 (Talin OS=Fasciola gigantica OX=46835 GN=FGIG_00042 PE=4 SV=1)

HSP 1 Score: 1498.03 bits (3877), Expect = 0.000e+0
Identity = 989/2894 (34.17%), Postives = 1590/2894 (54.94%), Query Frame = 1
Query:   28 MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREA-QTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLIS--DKMDFSPGIDKTLSMKRG----ISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH--VPKQKRSSVSE-------EDVVIRKKAHMANSSVRMNSQASDSVCSQ-----DCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPE----IGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQ------GLATIXXXXXXXX-XXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQ--------DQLTDEDV------SGEELIAAAKRLADAFTNLIKAAYPVEDQK------------------------------RSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAE-NPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNK-----ATQSEELQDLTVQ--------AANQVQEALDTLMKHLRXXXXXXXXXXXX---XXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQN---LENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKL--AQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIE-SKKHQFAENRLPIQQNNNINLS-----------------NCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVE------ICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFP--NDKIKLSDKTKITLLAVSELMTGVQNL-------NQNFNEDNRKEVESLSGKVQDNVAELVQLLLSY-KFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALIS---SEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR-------------PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQ---NDD-------REYYSVKEL-------------------FKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAI--------DNAIIXXXXXXXXXXXXXXGISREA--SPVES----PTSTNRLSIGSDITVSPRF-APEEINRLIPS-LANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLR-NGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKET---RIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYN----HDSHTSLHHHQAPF-IQLPINTRDPSEVDLDT---AKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEI--CKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAA---SKPLSTGCSPTWG--------------------DRMSTSTRKVANSTGQLLLNLKP-TVIQNKSQIEKIHTHGNQIKKNTDLL 8016
            M+  N +  LR+H   + VTK +  D + T+ Q CE IR  +RE+ QT   K +GL+LPH+D KKGLWLDN++TL+HYIL+ GDT+EYR R RWL+IRTMDGT K L VDDS +V+ELML +CTK+GIYN++EYSL+   D+ D     D++ +++R     ++I +DQEK++KLK+K HT+D ++WLNPSQSLRQQGI+E EVLLLKR+YFFSDMNVD+RDP+QL+LLY QLKDA++ GTHPV+L EAI LA +QCQVQ G+Y  +KFKP FLDL++ LPKEY K  +++EKKIF QH++   LSEV+AK +YC  CRS KTYGITFFLVKE++ GKNKLIPRLLGV K+ V+++DE+TKE++ TWPLTSI +WAAS + FTMDFGEYSPD+ YTAQT +GE+ISQLIAGY+DII K++KAKDH G   DEES MYEEN+   +A IV+H  +P  +     E       E ++ R      + S++M++    +  SQ     D      +  +++       R  SP + +   +  +   +    Q+  ++++ ++++T+Q  K+QL I   G      +G DE S++W+  ++  S+ ++ DE+GAMNAAVAQ LRSA       G+   +          + +  MQ SF ++T+H P+ +++++  A  +        DQ  +  V      S + L++AA+ +ADAFT+L+++A P+                                   S +RK I +AA+ VGEAS+DLL+ +  +    +    E    + ++TEE++LYQ+ LL LAK+VAN T  L+ + K +A +   +P  Q++V+ AAT+TGL  SQL++ TK++APTI Q  CQ+QL  +  +VS A+  VV++S       A Q  ++Q  +VQ        AA +V++ALD L  HL K   K    D      LAYEN+Q+  +      +LV++ARRLAQAT  MI++I+ +A       P+ + +L  AAKQLA+ATT LI+ AK C+ + D++ L+  LREA E   V+ Y+   A  +  ++I  L  AAR   T  T L+N S  A K+SR + ++V +D + ++  I   I++I+E+R +P D + Q+ELI AC  ++ P E L +S++ + PTVSDP++Q AL+ S  Q V A E L+ C+ +   + +HL +  AL +L RL     +I+ S+++  L+PLPDEK ++   LL  SV+   ++  + ++ +E             ++Q+   +   D+ G  A  L+ A+  LV A RGV A   F++ +SE +      +  A+  +  +  ++V+ A +LV  A  +   +D    A  A+V                R L  L  H E S+     E R    +N+ INLS                   +S+LT    +FNQA  +L+S+ S     +  ++   +YD++ +      +  V    P             N+D + NG++ +S+    L+ +  ++   P+   +R + Q A + + +SI++LLT  +T + P  ++C+  + RL+++RP+L+NP  P++ + Y++C+D +  K++ PLADSL+N+  + +D+  Q+F  ++  CA+S+C L+EETAQ AYL+G+ D RS+ G   L +   FL+ Q+EI E C  IC+P  T RQ    +IS + ++A +++ LCEA  ++    P  + + +L++ T+ T+ +++ L+    N+       N  + E NR+   + +  V  NV+ LV LL +  +FAG AA +++EA+ESQ P+ +AG+  L+ A  V++ ++ LI+   +  +E  F  +SS+ KDL++++K L S +++ APGQ+EC   L  +A L++    +KM  M++  +   R   +EE +Q  L ++   +      L RA + E EQL          L  + ++ I AA+++ L      YLEH  T+LEA++QL+   + +GGNP+A  +H+ +D+  +GV++SCEDLL ALD I+ +QG+V+T+++T+ ++ A+ +E   +P  +RF + Q++ML I   M  L   I   A   S++  L PL   LTQ Y ++C+ C+GA ATL + +   +L+  V+ VG  S  LV +TT  R              S    I++L  + + L  ++ ++I LL      TQAC Q+   +  I +D+DT+ILF  S  +    +DD        EY+S  EL                   F   R S++  +  LV + + +VS    D   L  +A         LAN VK G   +        +ELL + ++V  +L S  + A         DP+   ++   + +++ IT+LL+ +K+++D   +  QA+        D A            +   G    A  +PV S    P+  N  ++ +  ++  R+ AP+++ R     + +   K++  S+ +      Q ++   + +   V  +L +A K LLR +    +++   + T  +L E + ELL   K  L    +     RIP  T   ++ +L   L + +  LREGPRLVMYFR SSPEWRDV+EK+IGRHVAYHH +V +Y+      +H S++     + ++LP +T + +     T   A+++I+    +L     +PD   KD  S      +L     +  + + L+ +++ I    ++   +           ++++ + VS A + +C+ +   S+ L   CS   G                    +R+    RKVA ++ QLL+  K   +    + I+K+   G  +K+ TD L
Sbjct:   10 MVGDNRSLALRVHFPKSGVTKTMVFDAQMTVGQACEHIRAQMRESDQTDGTKDHGLFLPHEDNKKGLWLDNARTLEHYILRNGDTVEYRYRYRWLYIRTMDGTRKKLCVDDSKSVAELMLMICTKMGIYNHEEYSLVREHDENDR----DRSSTLRRQGTGMVTIGRDQEKMEKLKRKLHTDDDMDWLNPSQSLRQQGIDEREVLLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAIRLAAIQCQVQFGDYVPEKFKPNFLDLKDFLPKEYAKL-RSLEKKIFQQHAEMIGLSEVDAKFEYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGVTKDKVIRLDERTKEVLKTWPLTSISRWAASLHAFTMDFGEYSPDDCYTAQTSEGEQISQLIAGYVDIITKKQKAKDHAGFQGDEESAMYEENVRAERATIVQHQRMPPTRGPRAKEGLLNGTAEPLISRDM----DDSIQMSAVHRINGWSQQHIIGDGMSTVVDGQSIATSGVQPPRQMSPDNFMIGGTHIFHYQEMTPAQRALLVTINEDVETLQAAKEQLQIGPAGERVLLGVGSDETSRRWLSESLGASQAKVTDEMGAMNAAVAQALRSANRAEAYDGIPPAQAGLGASSDPGDDLMMMQQSFRVVTIHFPAFVDDVKRVAVLRREAGAIRADQTGEPTVAEQTEESTQNLLSAARYVADAFTDLLESARPLASGHTREVMDGTDDTATGSHAVITTTTTTTGGPVSSSSRKAIIEAASRVGEASNDLLRHVMNESGDDV---LESTTHLQLLTEEERLYQDHLLSLAKAVANATAGLVVKAKNLATQPNLDPEAQQRVIAAATQTGLCTSQLVACTKVLAPTIHQPSCQQQLSEAAREVSWAVDGVVQASRAVGLTLADQPPQIQH-SVQMAVTDTETAATEVRDALDALNAHLLKASAKAYSGDALDNFQLAYENLQQ--NHAGGGQRLVASARRLAQATAQMIADIKAQA-ELSGDDPDRQSRLFAAAKQLADATTNLIEVAKVCSANPDDIMLQNELREAAENLNVIAYSA-AAELLHTRLIRSLQAAARATVTGATQLVNVSQVAGKRSRGNTYQVISDAKAVNGMIPRTIISIRESRANPDDPMTQMELIGACERFVQPCEALIRSSRSIAPTVSDPTVQAALDNSTAQLVSAVETLRACLGRLAPLSRHLQIDGALARLARLSVEAAAIETSLQQGTLVPLPDEKVEDCFHLLSMSVQDGSASTRELQSIIEGL-----------AHQDPDIVNRPDICGMPATSLASAMAGLVQATRGVVAHEGFDSLDSELSPSMGPAVESARRAVTQDTRQSVQLAYELVKAASDARIASDTHQTATLATVLSHSEQLSAQLLDALSRCLRGLPGHREISEATHLIERR----RNDLINLSQSAPTRKVRLVEPSEYERAQSDLTRAAVEFNQATGDLLSSYSPGTFRRTTRRFTGAYDQLTDKGVELSLTGVPCTPPGQP--------QVNQD-LVNGLVTVSDQSHALMTQASRVCARPEEQDLRSRFQAAARDVTESISQLLTICTTGVTPDHRDCEVALRRLDALRPLLENPNRPVNQQAYYDCVDSVA-KSLSPLADSLRNMSNSARDQQTQEFGSAVRQCANSMCQLVEETAQAAYLIGLADPRSEPGKPSLVNTQLFLRTQQEIQEVCDAICSPSVTNRQ----VISLSTEMARSAKVLCEACSSVSAQTPSVDARQQLNNLTRETMQSITALIQHQGNMVNTSGATNGEWAEANRQTTLASAQAVSSNVSRLVHLLTTGPQFAGHAARVTDEARESQVPVCSAGLASLNAAQSVLRAAQNLITNARTSQSEMAFKGFSSASKDLSESIKTLASAMRDHAPGQRECQHVLNNIAHLMQDLQQAKMASMENHLQ--PRRELNEEGFQKQLATSTRALLDAAPALGRAARSEAEQLGHAALLVDSYLPGLTSNAIAAASRSPLSSTQLTYLEHACTVLEATDQLVTVARDAGGNPRAAHLHNPLDDAVRGVMDSCEDLLVALDDIASRQGHVSTLIDTLNRALAQTEEIIQVPVDARFSDYQARMLRIARHMEQLNQAIQLRARQPSSEGELTPLAHTLTQEYQEMCQTCKGAAATLPDAHQADELRAAVRAVGLASADLVHATTGSRLRGSDVHGGQQMFLSRNRGIADLDKRAELLDFKLRELIALLDLRGPNTQACLQSASTVSGIIADLDTTILFASSGTLHPPIHDDVDALLSGDEYHSRYELTGPDALDRRGGPGSQSTESFGPIRESIVRTARALVDDTQNLVSGTGEDQARLASTAHTAVERVTQLANVVKRGAAVIGPGQPDTQVELLSACRDVATALRSVFQSASQLPARTVDDPVVNEVRTNAQLTVSGITALLQKVKAIEDDERRGLQALTLAAKYCRDQASQLAPTVTNAGGDSTTGTETAAILTPVSSRKSAPSVANMSAVSNTSSLIARYLAPDDLARAASGPVQSAVSKVILASNTQ-----SQGDVLATAAATRDVVTDLVAATKALLRFSEAAPETRSACVVTSKELSEEFAELLDALKATLLPSCRAADRERIPNST--RRIADLSHSLLNLLGTLREGPRLVMYFRASSPEWRDVAEKFIGRHVAYHHHYVPNYSIAGPGYTHRSVYIRPTCYPLRLPHDTTEANATADSTEAEAESRIQLAIQQLEQALTSPDESSKDSAS------LLRVAHSVALAAQNLIRTARSIGLVPASEPAERARHAPHRSASLWRTELTVSLATQHMCQLSLLCSEALRAECSAQGGVGKANADELFGTSMRLVPSRERLLAEVRKVAAASAQLLMWAKARKLTYGANDIQKLQAAGQSVKETTDRL 2842          
BLAST of Talin-1 vs. TrEMBL
Match: A0A4E0S2C9 (Talin OS=Fasciola hepatica OX=6192 GN=D915_001787 PE=4 SV=1)

HSP 1 Score: 1493.02 bits (3864), Expect = 0.000e+0
Identity = 993/2903 (34.21%), Postives = 1593/2903 (54.87%), Query Frame = 1
Query:   28 MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREA-QTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLIS--DKMDFSPGIDKTLSMKRG----ISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH--VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQ----EDINMSRQTSSLG--------------------RTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPE----IGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQ------GLATIXXXXXXXX-XXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQ--------DQLTDEDV------SGEELIAAAKRLADAFTNLIKAAYPVEDQK------------------------------RSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAE-NPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKAT-----QSEELQDLTVQ--------AANQVQEALDTLMKHLRXXXXXXXXXXXX---XXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQN---LENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKL--AQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQ---------MDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFA--ENRLPIQQNNNINLS---NCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVE------ICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFP--NDKIKLSDKTKITLLAVSELMTGVQNL-------NQNFNEDNRKEVESLSGKVQDNVAELVQLLLSY-KFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALIS---SEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR-------------PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQ---NDD-------REYYSVKEL-------------------FKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAI--------DNAIIXXXXXXXXXXXXXXGISREA--SPVES----PTSTNRLSIGSDITVSPRF-APEEINRLI--PSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLR-NGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKET---RIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYN----HDSHTSLHHHQAPF-IQLPINTRDPSEVDLDT---AKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEI--CKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAA---SKPLSTGCSPTWG--------------------DRMSTSTRKVANSTGQLLLNLKP-TVIQNKSQIEKIHTHGNQIKKNTDLL 8016
            M+  N +  LR+H   + VTK +  D + T+ Q CE IR  +RE+ QT   K +GL+LPH+D KKGLWLDN++TL+HYIL+ GDT+EYR R RWL+IRTMDGT K L VDDS +V+ELML +CTK+GIYN++EYSL+   D+ D     D++ +++R     ++I +DQEK++KLK+K HT+D ++WLNPSQSLRQQGI+E EVLLLKR+YFFSDMNVD+RDP+QL+LLY QLKDA++ GTHPV+L EAI LA +QCQVQ G+Y  +KFKP FLDL++ LPKEY K  +++EKKIF QH++   LSEV+AK +YC  CRS KTYGITFFLVKE++ GKNKLIPRLLGV K+ V+++DE+TKE++ TWPLTSI +WAAS + FTMDFGEYSPD+ YTAQT +GE+ISQLIAGY+DII K++KAKDH G   DEES MYEEN+   +A IV+H  +P  +           R K  + N         +D + S+D  D  Q      IN   Q   +G                    R  SP + +   +  +   +    Q+  ++++ ++++T+Q  K+QL I   G      +G DE S++W+  ++  S+ ++ DE+GAMNAAVAQ LRSA       G+   +          + +  MQ SF ++T+H P+ +++++  A  +        DQ  +  V      S + L++AA+ +ADAFT+L+++A P+                                   S +RK I +AA+ VGEAS+DLL+ +  +    +    E    + ++TEE++LYQ+ LL LAK+VAN T  L+ + K +A +   +P  Q++V+ AAT+TGL  SQL++ TK++APTI Q  CQ+QL  +  +VS A+  VV++S         Q  ++Q  +VQ        AA +V++ALD L  HL K   K    D      LAYEN+Q+  +      +LV++ARRLAQAT  MI++I+ +A       P+ + +L  AAKQLA+ATT LI+ AK C+ + D++ L+  LREA E   V+ Y+   A  +  ++I  L  AAR   T  T L+N S  A K+SR + ++V +D + ++  I   I++I+E+R +P D + Q+ELI AC  ++ P E L +S++ + PTVSDP++Q AL+ S  Q V A E L+ C+ +   + +HL +  AL +L RL     +I+ S+++  L+PLPDEK ++   LL  SV+   ++  + ++ +E             ++Q+   +   D+ G  A  L+ A+  LV A RGV A   F++ +SE +      +  A+  +  +  ++V+ A +LV  A  +   +D          +  ++Q S +L DALS CL  LPG R++   +  IE +++         P ++   +  S     +S+LT    +FNQA  +L+S+ S     +  ++   +YD++ +      +  V    P             N+D + NG++ +S+    L+ +  ++   P+   +R + Q A + + +SI++LLT  +T + P  ++C+  + RL+++RP+L+NP  P++ + Y++C+D +  K++ PLADSL+N+  + +D+  Q+F  ++  CA+S+C L+EETAQ AYL+G+ D RS+ G   L +   FL+ Q+EI E C  IC+P  T RQ    MIS + ++A +++ LCEA  ++    P  + + +L++ T+ T+ +++ L+    N+       N  + E NR+   + +  V  NV+ LV LL +  +FAG AA +++EA+ESQ P+ +AG+  L+ A  V++ ++ LI+   +  +E  F  +SS+ KDL++++K L S +++ APGQ+EC   L  +  L++    +KM  M++  +   R   +EE +Q  L ++   +      L RA + E EQL          L  + ++ I AA+++ L      YLEH  T+LEA++QL+   + +GGNP+A  +H+ +D+  +GV++SCEDLL ALD I+ +QG+V+T+++T+ ++ A+ +E   +P  +RF + Q+++L I   M  L   I   A   S++  L PL   LTQ Y ++C+ C+GA ATL + +   +L+  V+ VG  S  LV +TT  R              S    I++L  + + L  ++ ++I LL      TQAC Q+   +  I +D+DT+ILF  S  +    +DD        EY+S  EL                   F   R S++  +  LV + + +VS    D   L  +A         LAN VK G   +        +ELL + ++V   L S  + A         DP+   ++   + +++ ITSLL+ +K+++D   +  QA+        D A            +   G    A  +PV S    P+  N  ++ +  ++  R+ AP+++ R    P  + V   IL  ++        Q ++   + +   V  +L +A K LLR +    +++   + T  +L E + ELL   K  L    +     RIP  T   ++ +L   L + ++ LREGPRLVMYFR SSPEWRDV+EK+IGRHVAYHH +V +Y+      +H S++     + ++LP  T + +     T   A+++I+    +L     +PD   KD  S      +L     +  + + L+ +++ I    ++   +           ++++ + VS A + +C+ +   S+ L   C+   G                    +R+    RKVA ++ QLL+  K   +    + ++K+   G  +K+ TD L
Sbjct:   45 MVGDNRSLALRVHFPKSGVTKTMVFDAQMTVGQACEHIRAQMRESDQTDGTKDHGLFLPHEDNKKGLWLDNARTLEHYILRNGDTVEYRYRYRWLYIRTMDGTRKKLCVDDSKSVAELMLMICTKMGIYNHEEYSLVREHDENDR----DRSSTLRRQGTGMVTIGRDQEKMEKLKRKLHTDDDMDWLNPSQSLRQQGIDEREVLLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAIRLAAIQCQVQFGDYVPEKFKPNFLDLKDFLPKEYAKL-RSLEKKIFQQHAEMIGLSEVDAKFEYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGVTKDKVIRLDERTKEVLKTWPLTSISRWAASLHAFTMDFGEYSPDDCYTAQTSEGEQISQLIAGYVDIITKKQKAKDHAGFQGDEESAMYEENVRAERATIVQHQRMPPTRGP---------RAKDGLLNG-------IADPLISRDMDDSIQMSAVHRINGWSQQHIIGDGMSTVVDGQSIATSGVQPPRQMSPDNFMIGGTHIFHYQEMTPAQRALLVTINEDVETLQAAKEQLQIGPAGERVLLGVGSDETSRRWLSESLGASQAKVTDEMGAMNAAVAQALRSANRAEAYDGIPPAQAGLGASSDPGDDLMMMQQSFRVVTIHFPAFVDDVKRVAVLRREAGAIRADQTGEPTVAEQTEESTQNLLSAARYVADAFTDLLESARPLASGHTREVMDGTDDTATGSHAVITTTTTTTGGPVSSSSRKAIIEAASRVGEASNDLLRHVMNESGDDV---LESTTHLQLLTEEERLYQDHLLSLAKAVANATAGLVVKAKNLATQPNLDPEAQQRVIAAATQTGLCTSQLVACTKVLAPTIHQPSCQQQLSEAAREVSWAVDGVVQASRAVGLTLVDQPPQIQH-SVQMAVTDTETAATEVRDALDALNAHLLKASAKAYSGDALDNFQLAYENLQQ--NHAGGGQRLVASARRLAQATAQMIADIKAQA-ELSGDDPDRQSRLFAAAKQLADATTNLIEVAKVCSANPDDIMLQNELREAAENLNVIAYSA-AAELLHTRLIRSLQAAARATVTGATQLVNVSQVAGKRSRGNPYQVISDAKAVNGMIPRTIISIRESRANPDDPMTQMELIGACERFVQPCEALVRSSRSIAPTVSDPTVQAALDNSTAQLVSAVETLRACLGRLAPLSRHLQIDGALARLARLSVEAAAIETSLQQGTLVPLPDEKVEDCFHLLSMSVQDGSASTRELQSIIEGL-----------AHQDPDIINRPDICGMPATSLASAMAGLVQATRGVVAHEGFDSLDSELSPSMGPAVESARRAVTQDTRQSVQLAYELVKAASDARIASDTHQTATLATVLSHSEQLSAQLLDALSRCLRGLPGHREISEATHLIERRRNDLISLSQSAPTRKVRLVEPSEYERAQSDLTRAAVEFNQATGDLLSSYSPGTFRRTTRRFTGAYDQLTDKGVELSLTGVPCTPPGQP--------QVNQD-LVNGLVTVSDQSHALMTQASRVCARPEEQDLRSRFQAAARDVTESISQLLTICTTGVTPDHRDCEIALRRLDALRPLLENPNRPVNQQAYYDCVDSVA-KSLSPLADSLRNMSNSARDQQTQEFGSAVRQCANSMCQLVEETAQAAYLIGLADPRSEPGKPSLVNTQLFLRTQQEIQEVCDAICSPSVTNRQ----MISLSTEMARSAKVLCEACSSVSAQTPSVDARQQLNNLTRETMQSITALIQHQGNMVNTSGATNGEWAEANRQTTLASAQAVSSNVSRLVHLLTTGPQFAGHAARVTDEARESQVPLCSAGLASLNAAQSVLRAAQNLITNARTSQSEMAFKGFSSASKDLSESIKTLASAMRDHAPGQRECQHVLNNIVHLMQDLQQAKMASMENHLQ--PRRELNEEGFQKQLATSARALLDAAPALGRAARSEAEQLGHAALLVDSYLPGLTSNAIAAASRSPLSSTQLTYLEHACTVLEATDQLVTVARDAGGNPRAAHLHNPLDDAVRGVMDSCEDLLVALDDIASRQGHVSTLIDTLNRALAQTEEIIQVPVDARFSDYQARLLRIARHMEQLNQAIQLRARQPSSEGELTPLAHTLTQEYQEMCQTCKGAAATLPDAHQADELRAAVRAVGLASADLVHATTGSRLRGSDVHGGQQMFLSRNRGIADLDKRAELLDFKLRELIALLDLRGPNTQACLQSASTVSGIIADLDTTILFASSGTLHPPIHDDVDALLSGDEYHSRYELTGPGALDRRGGSGSQSTESFGPIRESIVRTARALVDDTQNLVSGTGEDQARLASTAHTAVERVTQLANVVKRGAAVIGPGQPDTQVELLSACRDVATGLRSVFQSASQLPARTVDDPVVNEVRNNAQLTVSGITSLLQKVKAIEDDERRGLQALILAAKYCRDQASQLAPTTTSAGGDSTTGTETAAILTPVSSRKSAPSVANMSAVSNTSSLIARYLAPDDLARAASGPVQSAVSKAILASNTQS------QGDVLATAAATRDVVTDLVAATKALLRFSEAAPETRSACVVTSRELSEEFAELLDALKATLLPSCRAADRERIPNST--RRIADLSHSLLNLLDTLREGPRLVMYFRASSPEWRDVAEKFIGRHVAYHHHYVPNYSIAGPGFTHRSVYIRPTCYPLRLPHATTEANATADSTEAEAESRIQSAIQQLEHALTSPDESSKDSAS------LLRVAHSVALAAQNLIRTARSIGLVPASEPAERARHAPHRSASLWRTELTVSLATQHMCQLSLLCSEALRAECAAQGGVGKANADELFGTSMRLVPSRERLLAEVRKVAAASAQLLMWAKAHKLTYGANDVQKLQAAGQSVKETTDRL 2877          
BLAST of Talin-1 vs. TrEMBL
Match: A0A0X3P9U1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR147538 PE=4 SV=1)

HSP 1 Score: 1439.48 bits (3725), Expect = 0.000e+0
Identity = 988/2859 (34.56%), Postives = 1537/2859 (53.76%), Query Frame = 1
Query:   25 PMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQT-KSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKR----GISINXXXXXXX-XXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQED-IN--MSRQTSSLGRTQSPSS-------------------SLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPE----IGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXX------IAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEE------------------LIAAAKRLADAFTNLIKAAYPVEDQKRS-------------------LNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAE-NPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQS--EELQDLTVQ--------------AANQVQEALDTLMKHLRXXXXXXXXXXXX---XXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRC---VVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK-------SSPPDNDQ--MDRAQQASVR-------XXXXXXXXXXXXPGQRDLDMLSKHIESKKH---QFAENRLPIQQN--NNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTI--MISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLL-SYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISS-----EANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSN-IYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTD---ISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTE----------VRPSV--ASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSA----------DIQNDDR----EYYSV------------KELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDI-----TVSPRFAPEEINRLI--PSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVT-DSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHD----SHTSLHHHQAPFIQLPINTRDP---SEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCE-----AASKPLSTGCSPT--------WGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTD 8010
            PM   +    LRIH+ DADVTK +  D   T+ Q C+ IR+ IRE     +PK YGL+LPH+D KKGLWLD+S++L+HYIL+ GDT+EY+ R RWL+IRTMDGT KTL+VDDS T+SELML +CTK+GIYNY+EY L+ D  +     D+T+++++    G+S      +   KL+++ HT+D + WLNPSQSLRQQGI E E+LLL+R+YFFSDMNVD+RDP+QL+LLY QLKDA++NGTHPVTL EA+ LA +QCQV+LGNY+ +KFK GFLDL++ LPKE+ K  K +EKKIF QH+    +S+VEA+ KYC  CRS KTYGITFFLVKEK+ GKN+LIPRLLG+ ++SVV++DE+TKE++  WPLTSI KWAAS N FTMDFGEYSPDEYYTAQT +GE+ISQLIAGYIDIILK++KA+DH G+  DEES MYEEN+   +A IV+      R SV   D   R +    N++    S+  DS   +   + Y  D +N  M      L   +SP S                   +  T++ HY+       Q+  ++++ +N++ +++ K  L I +        IG DEAS++W+  ++  S+ ++AD++GAMNAAVAQ +RSA     +                  +  MQ SF ++TVH P+ +++++  A  + +        EE                  L+ AA+ +AD+F+ L+KAA P+  Q+++                    +RK I +AAN VGEAS+D L+ + +    Q     +    +    EE++ YQ+ELL LAK VAN T  L+ + K +A +   +P  Q+ VV AAT+TGL  SQL++ TK++APTI Q  CQ+QL  S  +VS A+  VV+++  A QS  ++ Q+L+ +              AA +V+  LD L  HL K+  +  + DN      AYE +Q     + D  ++V+AARRL+Q +  MI++++ +A  +    PE + KL  AAKQLA+ATT LI+ AK C+   D    +  L+++ +  +VV Y +  A  +  +V+  L  AAR   T  THL+NTS  AAKKSRA+N+ +  D R ++     L+ AI+  R  P D LAQLELI AC+  ++P   L++S++ M PTVSDPSLQ+ L  S++Q V+A E L+ C+ +A  + + L +  AL +L RL +  +  ++S    +L  LPD+K ++   +L   VR    A NQ    +ES      VY   +G D  +     D  G  + +L+ AL  LV A R +AA+            K +      + +++C+ + + A  LV E++       S  P+     + R  + + +       L+ AL+ CL  LPGQR++   S  ++ ++H   +FAE+   I+ +  + I+ ++ R++ T    +FNQA  EL S  + N   +   +   +YD +V+    L      E  +           I N ++ +S+  + LL+  +++  EP+   +R +L  A K + DSIN LL   ++ L PG  +CD  + RLE++RP+L+ P  PI+   Y EC++ +   TV PLAD L+ I  AV + N  KF   +    DS+C+L+EETAQ AYL+G+   +SK G K   D   F  IQ+EI + C+ I +P  T RQD + ++S A  I+ N R LC+A  +I    +   ++ +L   T+  + +++EL+      + +++E+ ++   + +  V  +V++LV+ +    +FAG  A I+ EA+ESQ P+  AGI+ LD    V+  SK +++S     E+ +  F+ +S++  DL+D +KHL+S +K  APGQ EC +AL  +A+L++     +M IM    R   R   + E +Q  L +++  +      L RA   E E+L         LL  +V+S + +A++      S  IYL H  T+LE+SEQL+ A K++GGNP++  +H+ I++  +  IESCEDLL+A+D I  +   +  ++  + +S + V + A +P  + F + Q++ML +   M   T     +S  A++ +    L P+  NL Q Y +LC  C+ A  TL +     QL+  V+ VG  + +L++S T            R  V  +SS  NL      ++ R+ ++I LL +   GTQAC Q    +  I +D+DT+ILF  S           D+ N DR    E +S+            ++ F   R S+   +  LV + + +VS    D N L  S          LA  VK G   L        + LL   +E  VS+ +    A    G    DP++++L+  G    N+   L+ +  S+D  + +  +A+  A      +         G    AS VE  ++ N+    S +      VS   APEE++R +  P    V   +L  SS       +Q++    + +      +L  ACK L+R   V+ ++++ T + V Q+   + +LL   K  +    ++ R  +     ++  L   L +    L+EGPRLVMYFR SSPEWRDV+EK++GRHVA+HH +V  Y  D    + T +  HQ   +Q+ +++       E     A+ +I     +L D  LN      ++ +   V  +LS  K I  +  E + + +       +T     +      + +S + VS A + LCE     +AS+P     +P           +R+  + R+VA+++ +LL   +       +++  +   G  +K+ TD
Sbjct:   10 PMTGDSRRLALRIHVPDADVTKTLVFDALMTVGQACDQIRQQIREIDGLDNPKDYGLFLPHEDSKKGLWLDHSRSLEHYILRNGDTVEYKYRYRWLYIRTMDGTRKTLRVDDSKTLSELMLPICTKMGIYNYEEYLLVRDVDEAEK--DRTMTLRKSHQTGMSGTLRDAEKMDKLRRELHTDDDVTWLNPSQSLRQQGIGEKEILLLRRRYFFSDMNVDARDPVQLNLLYVQLKDAILNGTHPVTLDEAVYLAAIQCQVELGNYNPEKFKSGFLDLKDFLPKEFLK-VKGLEKKIFQQHATLNGISDVEARVKYCHFCRSLKTYGITFFLVKEKMKGKNRLIPRLLGITRDSVVRLDERTKEVVKVWPLTSILKWAASPNAFTMDFGEYSPDEYYTAQTSEGEQISQLIAGYIDIILKKQKARDHQGLQGDEESAMYEENVRAERAKIVQSA----RRSVGPAD---RDR----NAATDGVSETIDSQRVETQMNGYTGDQLNGYMGTTERHLITLESPVSIDGQSVVSRQRNDNQDDFMTGGTHTYHYQTMTP--VQRALMLTIDENMEVLEQGKQMLDIGSPSERVLLNIGHDEASKRWLDESMGASQVKVADDVGAMNAAVAQAVRSANRADAVLSQTAGYEVGAGSDPGDDLMMMQQSFRVVTVHFPAFVDDVKRVAVLRRETGALQAEAEENPETREYITMRAENSAQNLLGAARTVADSFSELLKAATPLATQQQTDYEISSTVQYSDHAVPVGGSSRKAILEAANRVGEASNDFLRFVIQDGEEQAMATDDTGTGLRSFAEEERAYQDELLGLAKEVANATAGLVVKAKHLATQTNLDPEHQQDVVFAATQTGLCTSQLVACTKVLAPTIRQPTCQQQLSESAREVSVAVDGVVKAARGAGQSVYDQQQNLSPEESAEVNEAVRDVDDAATEVRNTLDRLNAHLLKESVRPYRGDNLDLFQAAYEALQR----ETDGQRMVAAARRLSQVSAQMIADVKTQA-EQADGDPERQTKLFAAAKQLADATTDLINHAKVCSTAPDSEPNQTKLKQSADELVVVAYAS-AAELLNARVMRSLQAAARAVVTASTHLVNTSRCAAKKSRANNYHILEDARVVNELTPKLVAAIRYVRSHPDDPLAQLELICACQQVVEPCSILARSSRSMAPTVSDPSLQSTLELSMSQMVVAVETLRACLGRAAPIARQLQMDGALARLLRLIRESEETESSARAGSLTALPDDKVEDRFQMLSLGVRDGIDAGNQIGAAVESLTSAYSVYPSASGRDQEE-----DWLGSSSNQLASALADLVQATRCIAAA-------DMATTKGVAGEVLTEFLHSCVLSTQIAYQLVCESRKLEVLEPSQTPETQAALLQRNTEVNTKCRDYITDLTAALTGCLRGLPGQREISEASIMVKRRRHDLVRFAEDPTIIEFHDADQISPADTRTDFTGAAVEFNQATVELTSCYTPNNFKRSSLRFAGAYDNLVDRGLRLSRSKPPEDITG--------KEIVNELVQISDKSEILLEDAQQVCNEPEIQPLRNRLHSAAKSVTDSINHLLNLSTSGLAPGATDCDAALRRLEALRPLLEQPTRPINQHIYHECIETVAQSTV-PLADGLRGISNAVNENNADKFSVHVQQTTDSICLLIEETAQAAYLIGIAHPKSKPGTKSPVDRALFEGIQREIQDACKAITSPQVTERQDRARVVSLANDISSNLRTLCDACTSISAQATSAEERRQLKTLTQDMMQSITELV----KRSADWSEEGKRATANNAHLVNTHVSQLVRFVTCGPQFAGHPARITAEARESQQPLCTAGISCLDAGKSVLIASKHMVNSAQTKNESADSSFMNFSAASHDLSDGIKHLVSVLKSHAPGQAECQQALENIARLLRDLQRDEMAIMD--DRFPQRHDNTAEGFQKQLTTSVRAVMEMAPTLGRAATSEAERLGHSVRELDALLPGIVSSALGSASRAPPGCPSQLIYLGHTRTLLESSEQLVLAAKEAGGNPRSVHLHAPIEDAVRAQIESCEDLLSAVDSIVSQHDFMEKLMAVLNQSQSVVDQPARVPRDAHFTDYQARMLRLARHMEQQTQSAVIVSRRADATAE---LPPVANNLAQDYAELCLVCRDASETLPDGRQSDQLRSAVKNVGNATRALIQSATSGAFARTRDGPGRQLVEESSSQRNLDYAAGLMNDRLRELIALLEAQGPGTQACLQGASTVSGIIADLDTTILFASSGTLHPPIHDDFDVANLDRRRAGERFSLTIRGADDFGHEAQDNFISIRESINRAADALVEDTRSLVSGAGEDQNRLAGSTHLAVRNISQLAEVVKQGASILGPGQLDNQVALLEGAKETAVSVRTLFLTASQLHGRQKPDPVYEDLRLSGDAVQNSAAKLVTLANSIDSESTRGTKALIAA--TKFCHQMADHVSTMGAELSASQVEMNSAVNQCGSASTLLSTTSLVSRYMAPEELSRAVAGPMQLVVSKAVLASSSR------KQDDGLTAANTARHALIDLVQACKGLVRQQEVSKEARQSTKSAVKQIASEFAKLLDGVKCVIHADNEKDRERISLAAGRIAALSSQLLNIAEGLKEGPRLVMYFRASSPEWRDVAEKFLGRHVAFHHHYVPCYGKDGSSVTSTRVASHQTSCLQMRLDSVGRVVVGEGASSEAEKRIDAALQRLED-GLNRART-HEQATTPSVQPILSMTKSIALAAREFIQAVR-TSSGAGETPKTSRSGSETATLGRSELSVSVATEYLCELARFCSASRPEGPTAAPVDDPVKIMPSRERLLAAIRQVASTSAELLYAARSRRQLPPTRLSAVQATGKAVKEQTD 2805          
BLAST of Talin-1 vs. TrEMBL
Match: A0A5K4FCV3 (Putative talin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 949/2696 (35.20%), Postives = 1502/2696 (55.71%), Query Frame = 1
Query:   28 MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREA-QTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGI-------SINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH--VPKQKRSSVSEEDVVIRKKAHMANSSV--------RMNSQASDSVCSQDCTDFYQED-----------INMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGP-------EIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXX--------XXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQ--LTDEDVSGEELIA------------AAKRLADAFTNLIKAA------------YPVEDQK---------------RSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVE-AENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQ--SEELQDL------TVQAANQVQEALDTLMKHL---RXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAAS-----IEFENQESENNDKNLEKLAQLQIVNNCL----EAVKAARDLVIEAKSSPPDNDQM--DRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLS----------NCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVE------ICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTS------------------FLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPN--DKIKLSDKTKITLLAVSELM-----TGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAI----ISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSE---ANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVAS----------------SISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSAD----IQND------DREYYSVK---------------------------------ELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITS-QSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNA--IIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLI--PSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVD-QLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSY 7452
            ML  + +  LR+H+  A +TK    D + T+ Q CE IR  +RE+ QT   K YGL+LPH+D KKGLWLDNS+TL+HYIL+ GDTIEYR R RWL+IRTMDGT KTLKVDDS TV+ELML +CTK+GIYNY+EY L  D+ +     ++T ++KR         ++ +DQEK++KLK+K HT+D + WLNPSQSLRQQG++E E+LLLKR+YFFSDMNVD+RDP+QL+LLY QLKDA++ GTHPV+L EA+ LAG+QCQVQ GNY A+KFKP FLDL++ LPKEY K  +++EKKIF QH++   LSE+EAK KYC  CRS KTYGITFFLVKE++ GKNKLIPRLLG+ K+SVV++DEKTKE++  WPLTSI KWAAS + FTMDFGEYSPDEYYTAQT +GE+ISQLIAGYIDIILK++KA DH G+  DEES MYEEN+   +A IV+H  VP           V +R K  + N  V          N  AS  + +      +Q++              S  T++  R  SP + +T  +  +   +    QK  +I++ ++L+T+Q  K+ L I   GP        +G DEAS++W+  ++  S+ ++ DE+GAMNAAVAQ LRSA    + + +  ++           + +  MQ SF ++T+H P+ +++++  A  + +      D +G+ +IA            AA+ +ADAFT+L+++A            YP  D                  S +RK I +AA+ VG AS+DLL+ +    +      +    + +++T+E+++YQ++LL LAK+VAN T  L+ + KV+A +   +P  Q++V+ + T+TGL  SQL++ TK++APTI Q  CQ+QL  +  +V+ A+  VV++S  A    SE+ Q +      T  AA +V++ALD L  HL        + D L++F  +YE++++      D  ++V++ARRLAQAT  MI++I+ +A  E     + +++L +AAKQLA+ATT LI++AK C+ + D + L+  LR+A +    + Y+     + Q ++I +L  AAR   T  T L+N S +A K SR +++++ ND R ++N I   ++ I+E+R +P D +A LELI AC  ++ P   + +S+K + PT+SDPS+Q AL  S +Q   A E L  C+ +     +HL L  AL +L RL   +  I+ S+ +  L P+P++K ++   L+  SV     +A +  + + S   +       DS   L   ++AGQ A  L+ A+  LVHA RG+ A      I   N  +  +     + A +Q +   +    E V+A +D  I   +  P N       +QQ + +L + L+ CL  LPG R++   +  IE K+ Q  +   P    N INL+            +++LT    +FNQA  +L+S+ S     +  ++   +YD + +      ICN +       S++       N D + NG++ +S+    L+++  ++  +P+   +R + Q A + + +SI++LLT  ++ + P Q+EC+  I RL+S RP+L NP  P++   Y++C+D  + K+++PLA+SL+ +  + +D+   +F  ++  CA+SVC L+EETAQTAYL+G+ D   +I N+ ++  TS                  F+Q QKEI   C  IC P+   RQ    +IS + ++A +++ LCEA   +     N   + +L++ TK T+ +++ L+     T   ++N  ++E NR++  + +  V  NVA LV+L+ +     D       I+   KE+Q P+  AG+  L+    V++ ++ L+S+     +E  F+A+SS+ KDL++++K L + ++E+APGQ+EC      + KL+ +  D+++  M++  R   R   +EE +Q  + +++  +      + RA   E EQL R        L  +V+  I AA+++ L     +YL+H  T+LEA+ QL+   K SGGNP+A  +H  ++E  +G+++SCE+ L  LD ++ +QG+V+T+++T+ ++ A+ +E   +P  +RF + Q++ML I   M+ L   I   A   ++   +APL  NLTQ Y ++C+ C+GA ATL + N   QL+  V+ VG   ISL+++T+  RP +                  SI  L  + + L  ++ ++I LL     GTQAC Q+   +  I SD+DT+ILF  S      +++D      D E+   +                                 E F   R S+   +  LV + + +VS    D   L  +A  IA+     LA+ VK G   +        +ELL S ++V  +L S    +    G P  DP++  ++   +  I+ +  LL+ LKS+++   +  ++++ A      +       +   G+    S  +S   +  ++ GS   ++   AP+++ R    P  + V   IL  ++   + I++       S +      +L +A K LLR   +    + +   V  +L E +  LL   K  L  P K     V  +  ++ ++   L + V+ LREGPRL+MYFR SSPEWRDV+EK+IGRHVAYHH +V +Y
Sbjct:    1 MLGDSRSLVLRVHLPKAGITKTTAFDAQMTVGQACERIRAQVRESDQTDGAKDYGLFLPHEDNKKGLWLDNSRTLEHYILRNGDTIEYRYRYRWLYIRTMDGTRKTLKVDDSKTVAELMLMICTKMGIYNYEEYLLARDRDETDR--ERTNTLKRSTGHHHHTGTLMRDQEKMEKLKRKLHTDDDMEWLNPSQSLRQQGVDEKEILLLKRRYFFSDMNVDARDPVQLNLLYVQLKDAILKGTHPVSLEEAVYLAGIQCQVQFGNYVAEKFKPNFLDLKDFLPKEYAK-IRSLEKKIFQQHAELCGLSEIEAKVKYCQFCRSLKTYGITFFLVKERIKGKNKLIPRLLGITKDSVVRLDEKTKEVLKIWPLTSICKWAASPHAFTMDFGEYSPDEYYTAQTSEGEQISQLIAGYIDIILKKQKATDHPGLQGDEESAMYEENVQAERATIVQHQRVP-----------VRVRGKDQLVNGVVEKPFDHHQHRNDLASHQIHTNGVWSIHQQNNLVGDENSTVIDGQSILTATTTRQMSPDNFMTGGTHIFHYQEMSPAQKSLLITINEDLETLQAAKEHLDI---GPPTERHLLNVGTDEASKRWLSESMGASQAKVTDEVGAMNAAVAQALRSANRAESTDINAVQQGQPLDQIHDPGDDLMMMQQSFRVVTIHFPAFVDDLKRVAVLRRESGALKADQTGQPIIAEKTEESTQNLLSAARHVADAFTDLLQSARPLAMGQTHEEIYPTSDDGTYQANHVITQQQGPVSSSSRKAIIEAASRVGAASNDLLRHVMHGGDDDDLFNT----NYLILTDEERIYQDQLLGLAKAVANATAGLVVKAKVLASQITSDPEAQQRVIASVTQTGLCTSQLVACTKVLAPTIHQPTCQQQLSEAGREVTWAVDGVVQASRAAVHVPSEDPQMVQQSIIETETAATEVRDALDQLNAHLLKGSYKGYQGDALNSFQTSYEDLKQ--YYTTDGQRMVASARRLAQATALMIADIKAQA-EESGDDSDRQNRLFHAAKQLADATTNLINAAKACSSNPDNIQLQTELRDAADELYTLAYSAGGEQF-QTRLIHNLQSAARATVTGATQLVNISQAATKYSRGNSYQLHNDTRNVTNLIPKTVITIRESRANPDDPMALLELIGACERFVQPCTAMVRSSKSLAPTLSDPSIQAALENSNSQLASALETLITCLIKVAPFARHLQLDGALTRLTRLSDEVAEIETSLMQGTLTPIPEQKVEDCCHLVNISVHDGTESAKKLDSIINSMAKM-------DSAV-LNQPELAGQSADRLASAMTGLVHATRGIIADQNSLIINGSNSNNNTSAAESTRRAVIQDIRQAVQLSYELVRAVKDTRIACDAKQPANAATVQSHSQQLTTQLIETLTRCLRGLPGHREISEATYLIEQKRSQLIQYSQP----NQINLTARFVEPNEYQRKQTDLTQAAVEFNQATGDLLSSYSPGSFKRTTRRFTGAYDCLTDKGIELSICNEI------PSNNQQFEPVVNTD-LLNGLINVSDQSYVLMNEASRVCGQPEAENLRGKFQSAARDVTESISQLLTICTSGVSPDQRECEAAIRRLDSFRPLLLNPNRPLNQHSYYDCVD-TVAKSLEPLAESLRTMSTSARDQKLNEFSFAVRQCANSVCQLVEETAQTAYLIGLAD---RIENRRVSGATSISSGISSPPGSSLIDLDLFIQSQKEIQSACNAICEPNVNNRQ----VISLSTEMARSAKTLCEACSQLASQTTNVDTRQRLNNITKQTMQSITSLIQHRGSTVATDVNGEWSESNRQQTLANAQAVSANVANLVKLITTEPRLVDLTTSQERITNTTKETQRPVCVAGLESLNATQTVLRAAQNLLSTSRMGPSENTFMAFSSASKDLSNSIKVLANAMRENAPGQRECQCVFNNIKKLLHELQDARIASMEN--RLPPRRELNEEGFQRQVATSVRALLDSAPAVGRAASSEAEQLGRTILTWDFYLPGLVSGSIAAASRSPLSSTQLVYLDHACTVLEAASQLVTVAKDSGGNPRAVHLHDSLNESVRGLVDSCEEFLTILDDVASRQGHVSTLIDTLNRAQAQAEEIIQVPMDARFSDYQTRMLRIARHMDQLNQAIQLRARQPASDGEIAPLAHNLTQEYQEMCQTCKGAAATLPDVNQADQLRSAVRGVGTACISLIQATSASRPDIYGSGTTTGGQHLLLTRNKSIVELDRRAEFLDSKLRNLINLLEIHGPGTQACLQSASTVSGIISDLDTTILFASSGTLHPPVRDDFDAIWTDNEFGHSRLTADRGHSLALSNNTDGTSIPSRAGSRSEMHNVENFTPLRESIARTARALVDDTQSLVSGTGEDQARLANTA-HIAVERITELADVVKRGAAVIGPGQPDTQVELLTSCRDVATALRSVFLSSGKVQGRPSLDPIYDEVRSNAQVVISNVGQLLQTLKSVEEDERRGIRSLELAANYCREQAKLLPSSKDPEGLLTPNSSRKSGPRSTSVASGSSSLIARYLAPDDLARAAGGPVQSAVSKAILANNTQIHRDIVQ------TSSATRDAVADLVAAAKCLLRYSDIPPETRSSCAIVTRELAEEFAALLDALKNGLYIPRKSGPENVSNIARRIADISHSLINLVDSLREGPRLIMYFRASSPEWRDVAEKFIGRHVAYHHHYVSNY 2635          
BLAST of Talin-1 vs. TrEMBL
Match: A0A0X3PHC1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR147538 PE=4 SV=1)

HSP 1 Score: 1431 bits (3703), Expect = 0.000e+0
Identity = 987/2859 (34.52%), Postives = 1535/2859 (53.69%), Query Frame = 1
Query:   25 PMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQT-KSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKR----GISINXXXXXXX-XXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQED-IN--MSRQTSSLGRTQSPSS-------------------SLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPE----IGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXX------IAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEE------------------LIAAAKRLADAFTNLIKAAYPVEDQKRS-------------------LNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAE-NPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQS--EELQDLTVQ--------------AANQVQEALDTLMKHLRXXXXXXXXXXXX---XXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRC---VVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK-------SSPPDNDQ--MDRAQQASVR-------XXXXXXXXXXXXPGQRDLDMLSKHIESKKH---QFAENRLPIQQN--NNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTI--MISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLL-SYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISS-----EANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSN-IYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTD---ISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTE----------VRPSV--ASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSA----------DIQNDDR----EYYSV------------KELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDI-----TVSPRFAPEEINRLI--PSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVT-DSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHD----SHTSLHHHQAPFIQLPINTRDP---SEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCE-----AASKPLSTGCSPT--------WGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTD 8010
            PM   +    LRIH+ DADVTK +  D   T+ Q C+ IR+ IRE     +PK YGL+LPH+D KKGLWLD+S++L+HYIL+ GDT+EY+ R RWL+IRTMDGT KTL+VDDS T+SELML +CTK+GIYNY+EY L+ D  +     D+T+++++    G+S      +   KL+++ HT+D + WLNPSQSLRQQGI E E+LLL+R+YFFSDMNVD+RDP+QL+LLY QLKDA++NGTHPVTL EA+ LA +QCQV+LGNY+ +KFK GFLDL++ LPKE+ K  K +EKKIF QH+    +S+VEA+ KYC  CRS KTYGITFFLVKEK+ GKN+LIPRLLG+ ++SVV++DE+TKE++  WPLTSI KWAAS N FTMDFGEYSPDEYYTAQT +GE+ISQLIAGYIDIILK++KA+DH G+  DEES MYEEN+   +A IV+      R SV   D   R +    N++    S+  DS   +   + Y  D +N  M      L   +SP S                   +  T++ HY+       Q+  ++++ +N++ +++ K  L I +        IG DEAS++W+  ++  S+ ++AD++GAMNAAVAQ +RSA     +                  +  MQ SF ++TVH P+ +++++  A  + +        EE                  L+ AA+ +AD+F+ L+KAA P+  Q+++                    +RK I +AAN VGEAS+D L+ + +    Q     +    +    EE++ YQ+ELL LAK VAN T  L+ + K +A +   +P  Q+ VV AAT+TGL  SQL++ TK++APTI Q  CQ+QL  S  +VS A+  VV+++  A QS  ++ Q+L+ +              AA +V+  LD L  HL K+  +  + DN      AYE +Q     + D  ++V+AARRL+Q +  MI++++ +A  +    PE + KL  AAKQLA+ATT LI+ AK C+   D    +  L+++ +  +VV Y +  A  +  +V+  L  AAR   T  THL+NTS  AAKKSRA+N+ +  D R ++     L+ AI+  R  P D LAQLELI AC+  ++P   L++S++ M PTVSDPSLQ+ L  S++Q V+A E L+ C+ +A  + + L +  AL +L RL +  +  ++S    +L  LPD+K ++   +L   VR    A NQ    +ES      VY   +G D  +     D  G  + +L+ AL  LV A R +AA+            K +      + +++C+ + + A  LV E++       S  P+     + R  + + +       L+ AL+ CL  LPGQR++   S  ++ ++H   +FAE+   I+ +  + I+ ++ R++ T    +FNQA  EL S  + N   +   +   +YD +V+    L      E  +           I N ++ +S+  + LL+  +++  EP+   +R +L  A K + DSIN LL   ++ L PG  +CD  + RLE++RP+L+ P  PI+   Y EC++ +   TV PLAD L+ I  AV + N  KF   +    DS+C+L+EETAQ AYL+G+   +SK G K   D   F  IQ+EI + C+ I +P  T RQ    ++S A  I+ N R LC+A  +I    +   ++ +L   T+  + +++EL+      + +++E+ ++   + +  V  +V++LV+ +    +FAG  A I+ EA+ESQ P+  AGI+ LD    V+  SK +++S     E+ +  F+ +S++  DL+D +KHL+S +K  APGQ EC +AL  +A+L++     +M IM    R   R   + E +Q  L +++  +      L RA   E E+L         LL  +V+S + +A++      S  IYL H  T+LE+SEQL+ A K++GGNP++  +H+ I++  +  IESCEDLL+A+D I  +   +  ++  + +S + V + A +P  + F + Q++ML +   M   T     +S  A++ +    L P+  NL Q Y +LC  C+ A  TL +     QL+  V+ VG  + +L++S T            R  V  +SS  NL      ++ R+ ++I LL +   GTQAC Q    +  I +D+DT+ILF  S           D+ N DR    E +S+            ++ F   R S+   +  LV + + +VS    D N L  S          LA  VK G   L        + LL   +E  VS+ +    A    G    DP++++L+  G    N+   L+ +  S+D  + +  +A+  A      +         G    AS VE  ++ N+    S +      VS   APEE++R +  P    V   +L  SS       +Q++    + +      +L  ACK L+R   V+ ++++ T + V Q+   + +LL   K  +    ++ R  +     ++  L   L +    L+EGPRLVMYFR SSPEWRDV+EK++GRHVA+HH +V  Y  D    + T +  HQ   +Q+ +++       E     A+ +I     +L D  LN      ++ +   V  +LS  K I  +  E + + +       +T     +      + +S + VS A + LCE     +AS+P     +P           +R+  + R+VA+++ +LL   +       +++  +   G  +K+ TD
Sbjct:   10 PMTGDSRRLALRIHVPDADVTKTLVFDALMTVGQACDQIRQQIREIDGLDNPKDYGLFLPHEDSKKGLWLDHSRSLEHYILRNGDTVEYKYRYRWLYIRTMDGTRKTLRVDDSKTLSELMLPICTKMGIYNYEEYLLVRDVDEAEK--DRTMTLRKSHQTGMSGTLRDAEKMDKLRRELHTDDDVTWLNPSQSLRQQGIGEKEILLLRRRYFFSDMNVDARDPVQLNLLYVQLKDAILNGTHPVTLDEAVYLAAIQCQVELGNYNPEKFKSGFLDLKDFLPKEFLK-VKGLEKKIFQQHATLNGISDVEARVKYCHFCRSLKTYGITFFLVKEKMKGKNRLIPRLLGITRDSVVRLDERTKEVVKVWPLTSILKWAASPNAFTMDFGEYSPDEYYTAQTSEGEQISQLIAGYIDIILKKQKARDHQGLQGDEESAMYEENVRAERAKIVQSA----RRSVGPAD---RDR----NAATDGVSETIDSQRVETQMNGYTGDQLNGYMGTTERHLITLESPVSIDGQSVVSRQRNDNQDDFMTGGTHTYHYQTMTP--VQRALMLTIDENMEVLEQGKQMLDIGSPSERVLLNIGHDEASKRWLDESMGASQVKVADDVGAMNAAVAQAVRSANRADAVLSQTAGYEVGAGSDPGDDLMMMQQSFRVVTVHFPAFVDDVKRVAVLRRETGALQAEAEENPETREYITMRAENSAQNLLGAARTVADSFSELLKAATPLATQQQTDYEISSTVQYSDHAVPVGGSSRKAILEAANRVGEASNDFLRFVIQDGEEQAMATDDTGTGLRSFAEEERAYQDELLGLAKEVANATAGLVVKAKHLATQTNLDPEHQQDVVFAATQTGLCTSQLVACTKVLAPTIRQPTCQQQLSESAREVSVAVDGVVKAARGAGQSVYDQQQNLSPEESAEVNEAVRDVDDAATEVRNTLDRLNAHLLKESVRPYRGDNLDLFQAAYEALQR----ETDGQRMVAAARRLSQVSAQMIADVKTQA-EQADGDPERQTKLFAAAKQLADATTDLINHAKVCSTAPDSEPNQTKLKQSADELVVVAYAS-AAELLNARVMRSLQAAARAVVTASTHLVNTSRCAAKKSRANNYHILEDARVVNELTPKLVAAIRYVRSHPDDPLAQLELICACQQVVEPCSILARSSRSMAPTVSDPSLQSTLELSMSQMVVAVETLRACLGRAAPIARQLQMDGALARLLRLIRESEETESSARAGSLTALPDDKVEDRFQMLSLGVRDGIDAGNQIGAAVESLTSAYSVYPSASGRDQEE-----DWLGSSSNQLASALADLVQATRCIAAA-------DMATTKGVAGEVLTEFLHSCVLSTQIAYQLVCESRKLEVLEPSQTPETQAALLQRNTEVNTKCRDYITDLTAALTGCLRGLPGQREISEASIMVKRRRHDLVRFAEDPTIIEFHDADQISPADTRTDFTGAAVEFNQATVELTSCYTPNNFKRSSLRFAGAYDNLVDRGLRLSRSKPPEDITG--------KEIVNELVQISDKSEILLEDAQQVCNEPEIQPLRNRLHSAAKSVTDSINHLLNLSTSGLAPGATDCDAALRRLEALRPLLEQPTRPINQHIYHECIETVAQSTV-PLADGLRGISNAVNENNADKFSVHVQQTTDSICLLIEETAQAAYLIGIAHPKSKPGTKSPVDRALFEGIQREIQDACKAITSPQVTERQ----VVSLANDISSNLRTLCDACTSISAQATSAEERRQLKTLTQDMMQSITELV----KRSADWSEEGKRATANNAHLVNTHVSQLVRFVTCGPQFAGHPARITAEARESQQPLCTAGISCLDAGKSVLIASKHMVNSAQTKNESADSSFMNFSAASHDLSDGIKHLVSVLKSHAPGQAECQQALENIARLLRDLQRDEMAIMD--DRFPQRHDNTAEGFQKQLTTSVRAVMEMAPTLGRAATSEAERLGHSVRELDALLPGIVSSALGSASRAPPGCPSQLIYLGHTRTLLESSEQLVLAAKEAGGNPRSVHLHAPIEDAVRAQIESCEDLLSAVDSIVSQHDFMEKLMAVLNQSQSVVDQPARVPRDAHFTDYQARMLRLARHMEQQTQSAVIVSRRADATAE---LPPVANNLAQDYAELCLVCRDASETLPDGRQSDQLRSAVKNVGNATRALIQSATSGAFARTRDGPGRQLVEESSSQRNLDYAAGLMNDRLRELIALLEAQGPGTQACLQGASTVSGIIADLDTTILFASSGTLHPPIHDDFDVANLDRRRAGERFSLTIRGADDFGHEAQDNFISIRESINRAADALVEDTRSLVSGAGEDQNRLAGSTHLAVRNISQLAEVVKQGASILGPGQLDNQVALLEGAKETAVSVRTLFLTASQLHGRQKPDPVYEDLRLSGDAVQNSAAKLVTLANSIDSESTRGTKALIAA--TKFCHQMADHVSTMGAELSASQVEMNSAVNQCGSASTLLSTTSLVSRYMAPEELSRAVAGPMQLVVSKAVLASSSR------KQDDGLTAANTARHALIDLVQACKGLVRQQEVSKEARQSTKSAVKQIASEFAKLLDGVKCVIHADNEKDRERISLAAGRIAALSSQLLNIAEGLKEGPRLVMYFRASSPEWRDVAEKFLGRHVAFHHHYVPCYGKDGSSVTSTRVASHQTSCLQMRLDSVGRVVVGEGASSEAEKRIDAALQRLED-GLNRART-HEQATTPSVQPILSMTKSIALAAREFIQAVR-TSSGAGETPKTSRSGSETATLGRSELSVSVATEYLCELARFCSASRPEGPTAAPVDDPVKIMPSRERLLAAIRQVASTSAELLYAARSRRQLPPTRLSAVQATGKAVKEQTD 2801          
BLAST of Talin-1 vs. Ensembl Cavefish
Match: tln1 (talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48])

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 693/2278 (30.42%), Postives = 1172/2278 (51.45%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAK--KSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK---SSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNL--VNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISN--LQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            L + I   +V K +  +P   ++  C  IR+ + EAQ   P  YGL+L  +D KKG+WL+  K L +Y+L+ GDT++Y+ + R L IR +DGT KT+ VDDS  VS++++T+C ++GI NYDEYSL+ D +      + T ++KR  ++ +D +K++KLK+K HT+D LNWL+  ++LR+QG+EE+E+LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G+++  K KPGFLDL+E LPKEY KN    EKKIF  H   ++++E+EAK  Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KESV++VDEKTKE++  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     V K +  SV+    VI +       S +M S                  I  ++Q             +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G D ASQ W    +D S+  +  ++ A+ A  A ++    G     +          I+      S     L +LME             DE  +G++L+ AA+ LA A ++++K A P   + R    + +  AA  VG+AS +LLQQI E                   ++ DQ +Q+ L++LAK+VAN    L+ + K +A + E+ + Q +V+ AAT+  L+ SQL++ T++VAPTI   VCQEQLI + + V+K+++  VE+S  AT  E L      AA  V +AL+ L++H+++       +     A + I    + +  S  D  ++V  AR LAQAT+ +++ I  KA  E     E   KL++AAK LA+AT  ++++AK    + D    +  LREA E   + T        I++++++ L  AA++AA   T  I  +  AA   K+ A+  ++    + +++QI  L+  ++ ++  P    AQL LI + ++++ P  ++  + K   PT+SD +    L+Q       A  EL+    +A   C  L++  AL  ++ LE++++  K +     L PLP E  ++ +  L  + +   SA  Q          + E   G ++Y  L   DVA       + A             +   E+ ++ N        A L    + ++  K+A +L+ E K   + P D D   R  Q +  LS AL+  ++ LPGQRD+D   + +     +   ++ P    +  +    ++ L       NQ+ NELV A       + K   K    +   +E       D   +S S       ++  +   +  +S     LL   K +  +P++  ++ QL  A + + DSIN+L+T + T   PGQKECD  +  LE++R +L+NP   ++   YF+C+D +++ + + L +++  I    K+ N  +F D++   + ++C L E   Q AYLVGV D  S  G KGL D   F + ++ I   CQ + +P  T  Q    ++S A  +A+++  LC A +  +   S P  K +     K    + + L+  ++ L+  FN++NR++ ++ +G + + V  L     + +FA   A IS E   +  PI AA  T+L+++  +IQ +++L  +  +   +   +   + ++D++K LI+ +++ APGQ+ECDEA+ +L   I++   + +  +    +   R   S E+    + +++ ++ H I+ ++ A + +  QL    S+     E ++ + I  A++    Q     L+   T+ E++ Q+L   K++GGNPKA      ++E  Q + E+ +DL   L + +   G V  +V+TIT++  ++++ A+ PE S F + Q+ M+                                              A+A    E  G  +++ V  +G     LV     ++ S   SI+   L    +++ +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R  ++  +  LV + KL+VS        L ++A     T   LA+ VK+G   L S   +  + L+ + ++V  +L   +   +  +G P+ DP    LK   K  +  +TSLLK +K+++D   K  +A++  I
Sbjct:    4 LSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQLGQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVRD-IGEEKKEETTGTLKRDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKPGFLDLKEFLPKEYIKNKG--EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVMQEWSLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKSTVMQQQFNKVGKVETGSVAMP--VIMRSGAGGQGSFQMGS------------------IPQAKQ------------QITSGQMHTGHMPPLTSAQQALTGTINSSMQAVQAAQASLDDFDALPPLGTDAASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME-------------DEGGTGQQLLGAARNLACAVSDMLKTAQPASTEPR----QNLLQAAGNVGQASGELLQQIGE-------------------SDADQQFQDMLMKLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEAGKLVAKSVEGCVEASQGATGDEHLLKQVGAAATGVTQALNELLQHIKQYASGGQPIGRHGEATDRILDVTENIFSSMGDAGEMVRQARILAQATSDLVNAI--KADAEGETDLENSRKLLSAAKLLADATARMVEAAKGAAANPDSEEQQQKLREAAEGLRMAT-NAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASSNKNPAAQQQLVQSCKVVADQIPQLVQGVRGSQAQPDSPSAQLALIGSSQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTAAQKAQEACGPLEIDNALTVVRGLERDIQEAKAAAAEGKLRPLPGETLEKCSQDLGSNTKAVSSAVAQL---------LSEAAQGNENYTGLAARDVAQALRSLAAAA----------RGVAATTEDPQARN--------AMLDCTGDVMD--KSA-NLIEETKRAVAKPGDPDCQQRLAQVAKALSQALNRSVNCLPGQRDVDNAIRTVGEASKKLLSDQFPA---SGKSFQEAQAGLNQAAAGLNQSANELVQASRGTTQDLAKASGKFGKDFSHFLEAG----VDMAGQSQS-----KEDQTQVVTNLKTISMSSSKLLLAAKALSTDPNSPNLKNQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRELETVRGMLENPTEAVNDLGYFDCIDSVMENS-KVLGEAMAGISHNAKNSNLPEFGDAVSSASKALCGLTEAATQGAYLVGVSDPNSHAGQKGLVDPAQFAKAKQSIQMACQNLVDPACTQSQ----VLSAATIVAKHTSALCNACRLASSKTSNPVAKRQFVQSAKEVANSTANLVKSIKALDGAFNQENRQKCKAATGPLIEAVDNLTAFASNPEFASVPAQISPEGLAAMEPIVAAAKTMLESSTGMIQTARSLAVNPKDPPKWSVLAGHSRTVSDSIKKLITNMRDKAPGQRECDEAIEVLNNCIREVDQASLAAISQ--QLTPRDDISHEALHEQMAASVQEISHLIDPVAIAARSDASQLGHKVSQMASYFEPLIMAAIGTASKILNSQQQMSVLDQTKTLAESALQILYTAKEAGGNPKAAHTQEALEEAVQMMKEAVDDLGGTLTEAAGAAGAVGGMVDTITQAINRMEDQAVEPEGS-FVDYQTTMVKTAK------------------------------------------AIAVTVQEMIGSHIKKQVTELGYSCTGLVTKAGALQCSPNDSITKKELIDSARKVSEKVSHVLAALQAGNRGTQACITAASAVAGIIADLDTTIMFATAGTLNREN------AETFADHREHILKTAKVLVEDTKLLVSGAGASQEKLAQAAQSSVNTITKLADVVKLGAASLGSEDPETQVVLINAVKDVAKALGDLIRATKAAAGKPHDDPAMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATI 2107          
BLAST of Talin-1 vs. Ensembl Cavefish
Match: tln2b (talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1])

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 680/2284 (29.77%), Postives = 1161/2284 (50.83%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNL-VNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIA--NGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESM-VNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQ----AKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  DD +KG+WL++ +TL +Y+L+ GD +EY+ + R   I+ +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI ++ +     D   ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG+EESE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG+Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EK+IF  H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLG+ KESV++VDE+TK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G+D DEES M EE+++P K+ I++     V + +  SV+   ++                  S S+   D       + NM       G   +P   +TT  MH   M    + Q+  + ++  ++  +Q+ +  L   +  P +G+D AS+ W+   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             DE  SG+ L+ AA+ L  A ++L++A  P   + R    + +  AA ++G+AS DLL+Q+ E E                    D+ +Q+ ++ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++ TK+V+PTI   VCQEQL+ +   V ++++  V++ + A++  EL      AA  V +AL  L++H+R      + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++++ L        AA T T     + +A+ K+ AS+ ++ +  + +++ I  L+  ++ ++  P+D  AQL LI A + ++ P  ++  S+K   PTV+D +    L+Q          EL+    +A   C  L++ +AL  ++ L+  L+  K +     L PLP +  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAA                E+ +   ++++    ++ +  L+ EA     SP D +   R  Q +  +S +L+ C++ LPGQ+D+DM  + I      +A + L +Q      L  C     +   + N+ V       S  L V  G  K    +D              D       H  S  D I     +  +S     LL   K +  +P     +  L  A + + +SIN+L+T + T   PGQKECD  +  LE++R +LDNP  P+S   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   Q +YLVGV D  S+ G++GL D   F +  + I   CQ++ +P ++  Q    ++S A  +A+++  LC A +  +   + P  +       K      + L+  ++ L+ +F+++NR+     +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++ ++++ +++L+ +  +   +   +   + ++D++K LI+ I++ APGQ+ECD ++  + K I+    + +  +        R   S E+ Q  + SA+ ++ H I  +S A + E  QL    ++ +   E + V S   A+   D  Q  NI L+   T+ E+S Q+L A K+ GGNPKA+  H  I E AQ + E+ +D++  L++ + + G V  +VE+I ++  ++ E         F + Q+ M+                                              A+A  + E  G Q++  VQ +G   I LV+    ++ S   S +  +    A+T  + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++ E       F   R +++  +  LV + KL+V+        L ++A   A T   L + VK+G   + S   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAIKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQEQGEERKE-DGMGTLKKERTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKRIFQDHKSCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDERTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLDGDEESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGIM-----------------RSGSIGGPD-------NFNM-------GSMPAPQQQITTGQMHRGHMPPLSLAQQALMGTINSSMQAVQQAQADLGEVDNLPPLGQDRASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DEVGSGQNLMCAARTLTGAVSDLLRAVEPASGEPR----QTVLTAAGSIGQASGDLLRQMGEGET-------------------DERFQDIMMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVITAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGRLVERSVEGCVKACHAASEEAELLRQVNGAAGAVSQALSDLLQHVRHYASCGEPIGRYDQATDTIMTVTESIFTSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAHPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAASNKNTASHQQLVHSCKAVADHIPQLVQGMRSSQAQPEDLSAQLTLIIASQSFLQPGSKMVTSSKSAIPTVTDQAAAMQLSQCAKNLATCLAELRTAAQKAHEACGPLEIDSALNAVQTLKNELQDAKMAAFDGQLKPLPGDSLEKCAQDLGSTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALRTLAQAARGVAAC-------------TAERQSAAAMLDSASHVMEGSAMLIHEAHQALISPGDAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALRSI---GEFYANSYLCVQ------LPPCSKSFQEAQTELNRTVVHSSRGTSSQLAVASG--KFSQDFDEF-----------LDAGIEMAGHTQSKDDQIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAKNLLAAAARAVTESINQLIT-LCTQQAPGQKECDNALRELEAVRGMLDNPNEPVSDLSYFDCIESVMENS-KVLGESMAGISQHCKTGDVPAFGECVGVASKALCGLTEAAGQASYLVGVSDPNSQSGHQGLVDPIQFAKANQAIQMACQSLVDPASSPSQ----VLSAATIVAKHTSALCNACRLASSKTANPVARRHFVQSAKEVANTTANLVKTIKALDGDFSDENRERCRVATTPLIEAVENLSTFASNPEFASIPAQISNEGSAAQEPILRSARSMLDSSTQLLETARSLVINPKDPPTWSILAGHSRTVSDSIKSLITAIRDKAPGQRECDHSIDSINKCIRDIEQASLAAVGQ--SLPCRDDISLEAVQEQVTSAVQEIGHLIEPISTAARGEAAQLGHKVTQLSNYFEPLIVASVGLASKHMDHQQQMNI-LDQTKTLAESSLQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEGGMVGGMVESIAEAMGRMDEGTPPEPDGTFVDYQTTMVKFSK------------------------------------------AIAITAQEMVGLQIKTRVQELGHGCIYLVQKAGALQMSPTDSFTKRELIECART--VTEKVSMVLSALQAGNKGTQACITAASSVSGIIADLDTTIMFASAGTLNAENEES------FADHRENILKTAKALVEDTKLLVAGAASSQEKLAQAAQSSAKTITQLTDVVKLGAASMGSEDPETQVVLINAVRDVAKALAELIGATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2103          
BLAST of Talin-1 vs. Ensembl Cavefish
Match: tln2a (talin-2-like [Source:NCBI gene;Acc:103042966])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 678/2291 (29.59%), Postives = 1165/2291 (50.85%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLS-MKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLV--AARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK---SSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHI-ESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDES-DSALH---HLSSNRD--HIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTI---------SRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +   P   ++  C  IR+ + EAQT     +GL+L  +D +KG+WL++ +TL +Y+L+ GD +EYR + R   ++ +DG  KT+ VDDS TV EL+LT+C+++GI NYDEYS++ +  +     D+ +S +++  ++ +D+ K++KLK K HT+D LNWL+  ++ R+QG+EESE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E  G+Q Q+Q G +   K + G LDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS KTYG++FFLVKEK+  KNKL+PRLLGV KESV++VDEKTKE++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+KK+KD  G++ DEE+ M E++++P K+ I++   +Q  S+   E   +     +  SSV                           +T ++G   SP   +TT  MH   M      Q+  + ++  ++ T+Q+ +  L    + P +G D AS+ WI   +D S+  +  ++GA+ A  A V+    G             E     +  + + I+ +L  + + ++  A     + DE  SG++L+ AA+ L  A ++L+ A  P   +     R+ + +AA ++G+AS DLL+QI E+E                    D+ +Q+ L+ LAK+VAN    ++ + K +A  +E+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQL+ + + V +++Q  V +   AT   EL      AA  V +AL  L+ H+R      + +  +  A + I    + +  S  D  ++V  AR LAQAT+ ++  ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T +      I++++I  L V      AA T       + +A+ K+ A++ ++    + +++ I  L+  ++ ++  P+D  A L LI A ++++ P  ++  S K   PTV+D +    L+Q       +  EL+   H A   C  +++ +AL  ++ L   L+  + +  +  L PLP E  ++    L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AA                     +  A + ++++  E ++ +  L+ +AK    +P D +      Q +  +S +L+ C++ LPGQ+D+D+  K I E+ K    E   P  +    +    +S+L  T    NQ+  ++V A             R +  ++ +       D FDE  D+ +    H     D   +   +  +S     LL   K +   P     +  L  A + + DSIN+L+T + T   PGQ+ECD  +  LE++  +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F + +   + ++C L E   QT+YLVGV D  S+ G +GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+ +NR +    +  + + V  L   + S +F    A IS E   +Q PI  +  ++LD++I+++  +++L+ +  +  L+   ++    ++D++K LI+ +++ APGQ+ECD            A DS  K ++   +           +R   S E+ Q  L S++ ++ H I+ +S A K E  QL    S+     E +  + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPK    H  I E AQ + E+ +DL+  L++ + + G V  +V++I ++  K+        +  F + Q+ M+     +     D+     S S+   L  L   +T  Y  L    + A AT   E  G Q++  VQ +G   ++LV+     ++ PS + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  SA   N + +  S    F + R +++  +  LV + K +VS        L  +A   A T   L   VK+G   +     +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++ AI
Sbjct:    4 LSLKICVRQCNVVKTMQFKPATAVYDACRVIRERVPEAQTGPASEFGLFLSDEDPRKGIWLESGRTLDYYMLRNGDVLEYRRKQRPQKVKMLDGAVKTVMVDDSKTVGELLLTICSRIGITNYDEYSVVRETGEERR--DEGMSTLRKDRTLLRDERKMEKLKAKLHTDDELNWLDHGRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFGGIQTQIQFGPHIEQKHRTGLLDLKEFLPKEYVKQ-RGAEKKIFQEHKACGEMTEIEAKVKYVKLARSLKTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKKSKDRFGLEGDEEATMLEDSVSPKKSTILQ---QQYNSAGRVEHGSVALPGVLRTSSV-------------------------GPETLNVGTMPSPQQQITTGQMHLGHMPPLSAAQQALVGTINTSMQTVQQVQADLEEVEELPPLGDDLASKVWIQNKVDESKHEIHSQVGAITAGTASVVNLTAG----------GPEETDYTAVGCAITTISSNLSEMSKGVKLLAAL---VEDEVGSGQDLMRAARTLTGAVSDLLNAVEPTSGEP----RQTVLNAAGSIGQASGDLLRQIGEKET-------------------DERFQDVLMNLAKAVANAAAMMVLKAKNVAQVSEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLMEAGKLVDRSVQGCVNACLSATDDGELLKAVSAAAGVVTQALADLLAHVRNYDSCGEPIGRYDQATDTIMNVTENIFSSMGDAGEMVRQARVLAQATSDLVGAMRSDA--EAEIDVDNSKKLLAAAKLLADATARMVEAAKGAAAFPENEDQQQKLREAAEGLRVAT-SAAAQNAIKKKLITRLEVRAKQAAAAATQAIAAAQNAAASNKNTAAHQQLVQSCKAVADHIPQLVQGVRGSQGQPEDDSAHLALIIASQNFLQPGSKMVASAKSSVPTVTDQAAAMQLSQCAKNLSTSLAELRTAAHMAHEACGPMEIDSALTAVQTLRNELQDARTAAVKHQLKPLPGESLEKCGQDLGSTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALKSLGQAA-------------RGVAAATADAEAAVLMLDSAREVMQGSEMLISKAKEALETPGDTESQQTLAQMARSVSHSLNSCVNCLPGQKDVDLALKSIGEASKKLLMETLPPCSK----SFQEAQSDLNQTAAGLNQSAGDVVHAS------------RGTSSQLADASGKFSED-FDEFLDAGIEMAGHTQRKDDQLQVIGNLKNISMSSSKLLLAAKSLSVNPRAANAKSLLATAARSVTDSINQLIT-MCTQHSPGQRECDNALRELEAVIVLLDNPNEPVNGLSYFDCIESVMENS-KVLGESMAGISQNCKTGDVPAFGECVGVASKALCGLTEVARQTSYLVGVSDPNSQAGQQGLVDPIQFARANQAIQMACQNLADPGSSPSQ----VLSAATIVAKHTSALCNACRLASAKTTNPVAKRHFVQSAKEVANSTAILVKTIKALDGDFSAENRDKCRVATAPLIEAVDSLTVFVSSPEFGSVPAQISREGSAAQEPILQSARSMLDSSIKLLTTARSLVLNPKDPALWSLLAAHSHTVSDSIKSLITAVRDKAPGQRECDS-----------AIDSVRKCIREMEQACLSAVSQNLPTRQDISLEALQEQLMSSVQEVGHLIDPISTAAKGEASQLGHTVSQLASYFEPLSRAAVGVASKMMHHQEQMNLLDQSRTLAESALQMLYAAKEGGGNPKVTLTHDAIAEAAQLMREAVDDLMLTLNEAASEVGIVGGMVDSIAEAMGKLGAGTPSETEGSFVDYQTVMVKFSRAIAVTAHDMI--GKSVSSPEELGSLASQVTADYGQLALHGRLAAATAEPEEVGVQIKSRVQELGHGCMALVQKAGALQICPSDSITKRELMECARTVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFA-SAGTLNTENDSDS----FAEHRENILKTAKALVEDTKNLVSGAATSPEKLARAAQSSAKTITQLTEVVKLGAASIGPDDPETQVVLINAVKDVAKALAELISATKGAAGKAAEDPSMLQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEAAI 2152          
BLAST of Talin-1 vs. Ensembl Cavefish
Match: mast2 (microtubule associated serine/threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050309-150])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 311/555 (56.04%), Postives = 405/555 (72.97%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPE-SLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            ++PRS+SL+P RSP +++ +I ++NHVYKERFPKAT QM ERL+  +     E  +   + +   +H Q+++  +D L+ +    ITS YF+EL +NLEKLL++   +     +  V  +V+ L+ IIARPARLLEC+EFDP+EFY LLE AE + +    +++D+P+YIIS+LGL +DP     EE+      + G+ E                     + E+ +S E    K+ TP+E DFE IKLISNGAYGAV LVR K+T++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVV ++C+FETR++LCM+MEYVEGGD ATL+K IG LP ++ARMYFAETVLALEYLHN+GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLM+LTT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMG+ILYEF+VGC PF+GD+ EELFG +IS EI WP++ D  +P +A +LI++LL+++PL RLG     EVK+H FF+D+DW  LLRQKA FIP L+ EDDTSYFD R+ RY H
Sbjct:  212 MRPRSRSLSPGRSPISFDHEIVMMNHVYKERFPKATAQMEERLAEFMSSSAPEKVMPLADGVLSFIHHQVIELSRDCLDKSREGLITSRYFYELQENLEKLLQDAHERSESVEVTFVTQLVKKLMIIIARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKSDIPRYIISQLGLTRDPL----EEMAQLSSYDSGNPE---------------------TPETEDSSEPQ-PKTKTPREEDFETIKLISNGAYGAVFLVRHKETRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKHIGALPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGVILYEFLVGCAPFFGDTPEELFGQVISDEIIWPEE-DEALPPDAQDLISKLLRQNPLERLGTGSAFEVKQHRFFTDLDWNSLLRQKAEFIPQLESEDDTSYFDTRSDRYHH 739          

HSP 2 Score: 117.472 bits (293), Expect = 2.966e-25
Identity = 56/126 (44.44%), Postives = 82/126 (65.08%), Query Frame = 1
Query: 12124 PAIVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPA---GKMATKHHPRKAQHLRAGKK 12492
            PAIVIHR  + +GF +RAIRV+ G++++YT+HH++  V+  G A +AGLREGDLITH+NG  + G  HTEVV +I++SG  +S+   P   + I+  GP R      KMA ++   K +  +  KK
Sbjct: 1009 PAIVIHRAGKKYGFTLRAIRVYMGDTDIYTVHHMVWHVEEGGPAHEAGLREGDLITHVNGEPVHGLVHTEVVELILKSGTKVSISATPFENTSIKV-GPARKTSSKSKMARRNKKTKTKEGQDSKK 1133          
BLAST of Talin-1 vs. Ensembl Cavefish
Match: mast3b (microtubule associated serine/threonine kinase 3b [Source:ZFIN;Acc:ZDB-GENE-111209-1])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 301/561 (53.65%), Postives = 402/561 (71.66%), Query Frame = 1
Query: 9565 IKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC-PESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSM------TPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            I+PRS+SL+P R+ G+++ +  ++NHVYKERFPKAT QM +RL  ++ +   ++T+   + +   +  Q+++ V+D L+ ++   +TS YF EL + LEKLL E   +   E +  +  +V+ +L II+RPARLLEC+EFDP+EFY LLE AE + +    ++TD+P+YII++LGL++DP D  S+                                  + +  ++   LS +KS+       P ESDFE IKLISNGAYGAV+LVR K T++RFAMKKI + NL+LRNQ++Q+F ERDI+TFA++PFVV ++C+FETR++LCM+MEYVEGGD A L+K++GPLP ++AR+YFAETVLALEYLH++GIVHRDLKPDNLLIT  GHIKLTDFGLSK+GLMN+TT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMGIILYEF+VGC PF+GD+ EELFG ++S +I WP D D  +P +A ++IT LL + PL RLG  G  EVK+H FF+ +DW  LLRQKA FIP L+ EDDTSYFD R+ RY H
Sbjct:  167 IRPRSRSLSPGRTSGSFDNETVMMNHVYKERFPKATAQMEDRLLDIVRQCSPDSTLPLGDGVLGFIQHQLVELVRDCLDKSHKGLVTSLYFLELQEKLEKLLHEALERSESEEVTIITQLVKKILIIISRPARLLECLEFDPEEFYHLLEAAEGHAKVGQGIKTDIPRYIINQLGLNRDPLDEVSQ----------------------------------LEEHYDSGPSLSPNKSVLTPPRRKPLESDFETIKLISNGAYGAVYLVRHKDTRQRFAMKKINRQNLILRNQIQQVFVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCANLLKNMGPLPVDMARLYFAETVLALEYLHSYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMNMTTNLYEGHIEKDTREFIDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVVSDDIIWP-DGDDALPVDAQDMITRLLWQSPLERLGTGGATEVKQHTFFTRLDWNSLLRQKAEFIPQLEGEDDTSYFDTRSDRYHH 692          

HSP 2 Score: 99.7525 bits (247), Expect = 5.944e-20
Identity = 45/112 (40.18%), Postives = 72/112 (64.29%), Query Frame = 1
Query: 12124 PAIVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPA---GKMATK 12450
            P I IH   + +GF ++ IRV+ G S++YT+HH++  V+    A +AGLR GDLITH+NG S+ G  HTE++ ++++SG  ++L+   +  + I+  GP R     GKMA +
Sbjct:  931 PPIFIHSSGKKYGFTLQTIRVYMGNSDIYTIHHMVSSVEEGSPAHEAGLRAGDLITHVNGESVQGLVHTEMMELLLKSGNKVALQTTALEDTTIKV-GPARKTSCKGKMARR 1041          
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003776.1 (pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 gene:ENSPMAG00000003436.1 transcript:ENSPMAT00000003776.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 492/1602 (30.71%), Postives = 827/1602 (51.62%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYL---PHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSS--LTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLV--AARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAP--SFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNP 4803
              L+I +   +V K +  +P   ++  C  IR+ + EAQ   P +  L L   P       L + ++ T   +     D +EYR + R L +R +DGT KT  VDDS TV +++L VC ++GI NY+EYSL+ +  +    +D T ++K+  S+ +D++K++KLK+K HT+D +NWL+  ++LR+QG+E+SE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+   A E AG Q Q+Q G ++  K KPGFLDL+E LPKEY K  +  EK++F +H K + ++E+EAK +Y    RS KTYG++FFLVKEK+ GKNKL+PRL G+ KESV++VDE+TKE+I  WPLT++++WAAS   FT+DFG+YS D YY+ QT +GE+I+QLIAGYIDIILK+KK+KD  G + DEES M E++++P K+ +++          +   + + +   +A  +V       +                      SLGR   P ++  +T+ +MH   +      Q+  + ++  ++  +Q+  + L   +  P +G+D+AS+ W    +D ++  +  ++ A+NA+ A  +    G A   +          I+      S     L +L EE             E   G  L+ AA+ L D  ++L+K   P   +     R+ +  AA+ VG +S++LL+QI +Q                     DQ +Q+ L +LAK+VAN    L+ + K +A +A++ + Q +V+ AAT+  L+ SQL++ TK+V PT++  VCQEQL+ S + V++A++  V SS +AT+ +EL      AA  V +ALD L++H++        +  +  A + I    + +  S  +  ++V  AR LAQAT+ +I+ I++ A  E  +  E   KL+ AAK LA+AT  ++++AK    + +    +  L+EA E   V T        I+++++  L V      AA +      T  +A+ K+ A+  ++    + +++ +  L+   + ++  P    AQL LI A  +++ P  ++  + K   PTV+D +    L Q          EL+    +A   C  L++ +AL+ ++ LE  L+  K +     L PLP E  +  A  L  + +  GS+  Q         V+   + G ++Y  +   D A    +  + A     ++A                     +K  Q  ++ +  + +  A   + EAK +   P D     R  Q +  +S AL  C+  LPGQ+D+D   + +     +   + +P    +  +    +  L D     N + +ELV A   S   ++   +K    + R ++    +      + D            +   +  +S     LL   K +  +P+    + QL  A + + DSIN+L+T + T   PGQ ECD  +  LE+++ +LDNP  P++   YFEC+D +++ + + L ++++ +    K  N   F ++I   + ++C L E  +Q+AYLVGV D  S+ G  GL D   F +  + I   CQ + +P
Sbjct:    4 LSLKICVRHCNVVKTMQFEPSTVVYDACRIIRERVPEAQDGQPPATPLALSSLPSPPRPLHLPISSTATSPPHPQ---DLLEYRKKQRPLKVRMLDGTIKTAMVDDSKTVGDMLLAVCARIGITNYEEYSLVREVAE-EKAMDGTGTLKKDRSLLRDEKKMEKLKQKLHTDDDMNWLDHGRTLREQGVEDSETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEMACEFAGYQAQIQFGPHNEVKHKPGFLDLKEFLPKEYVKQ-RGAEKRLFQEHKKCESMTEIEAKVRYVRQARSLKTYGVSFFLVKEKMKGKNKLVPRLFGITKESVMRVDERTKEVIQEWPLTTVKRWAASPKSFTLDFGDYS-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDRFGTEGDEESTMLEDSVSPKKSTVIQ---------TNCNPMGMAEHGSVALPAVMRGIGGPE----------------------SLGRGVMPGANKVITSGAMHRGHLPPMSTNQQALMGTITSSMQAVQQAGNSLDEMDALPPLGQDKASKAWRQYKMDQAKHEIHSQVDAINASTASCINLTSGDAADTDYTAVGCAVVTISSNLTEMSRGVRLLAALTEE-------------EGGDGRALLQAARGLIDCISDLLKTVQPSSTEP----RQAVLTAASTVGRSSNNLLKQIGQQ-------------------GVDQQFQDVLNQLAKAVANAAAGLVLKAKTVAQKADDQALQNQVIAAATQCALSTSQLVACTKVVGPTMDSPVCQEQLMESGKLVARAVEGCVRSSQEATKDDELLRQVGGAAGAVTQALDALLQHVKLLASGGHGMGRYDCATDTIITATESIFSSTGNAGEMVKQARLLAQATSDLINAIKVDAEAEGDQ--ENSRKLLAAAKYLADATAKMVEAAKGAAANPESEEQQQRLQEAAEGLRVAT-NIAAQNAIRKKLVHRLEVAARQAAAAASQAIAAATQAAASNKNPANQQQLVGCSKNVADHVPQLVQGWRGSQSQPDSPSAQLALITASHNFLQPGTKMVAAAKASVPTVTDQASSMQLGQCAKNLATCLAELRTAAQKAQDACGTLEIDSALDLVRSLEAELQEAKVAASDGKLHPLPGETLETCAQDLGATSKTVGSSMAQ---------VMTAASQGNENYTGIAARDTAQALKQLAAAARGLAANSA---------------------DKPTQEAVLESARDLMDKASLFIQEAKKAVVRPGDPINQQRLAQVAKAVSGALGKCVGCLPGQQDVDTALRSLADHSKKLLSDTIP---RSGSSFQEAQGNLNDAAAGLNLSASELVQASRGSSQELSTASRKFGNDFSRFLDAGIDMAGQAKTKEDQV---------QVVGNLKSISMSSSKLLLAAKALCVDPNAPNAKNQLAAAARAVTDSINQLIT-MCTQQAPGQNECDNALRELETVKGMLDNPSEPVNDLSYFECIDSLMENS-KVLGEAMQGVSQNAKTSNLPAFGEAISSASKALCGLTEAASQSAYLVGVSDPNSQAGQPGLVDPGQFARANQAIQMACQNLVDP 1485          
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Match: mast2 (microtubule associated serine/threonine kinase 2 [Source:ZFIN;Acc:ZDB-GENE-050309-150])

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 311/614 (50.65%), Postives = 418/614 (68.08%), Query Frame = 1
Query: 9589 NPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSW-EPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPES-LARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLR---NVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSM---TPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGSGLGSXXXXXXNDETIEHCEXXXXXXXXXXXXXGTVFHAFPSCSPRFSRFVETE 11406
            +P RSP  Y+ +I ++NHVYKERFPKAT QM ERL  ++   + E+T+   + +   +H Q+++  +D L  +    ITS YF+EL +NLEKLL + + +   + +A +  + + LL +I+RPARLLEC+EFDP+EFY LLE AE + +    +++D+P+YIIS+LGL +DP     EE+      + G+ E                     + E++++ +   ++S+    P E DFE IKLISNGAYGAV+LVR K+T++RFAMKKI K NL+LRNQ++Q F ERDI+TFA++PFVVG++C+FET+++LCM+MEYVEGGD ATL+K++G LP ++A++YFAETVLALEYLHN+GIVHRDLKPDNLLIT  GH+KLTDFGLSK+GLM+LTT L E  + KD   F DKQV GTP+YIAPEVILRQGY K +DWWAMG+ILYEF+VGC PF+GD+ EELFG +IS EI WP+  D  +P +  +LIT LL+R+PL RLG  G  EVK+H+FF  +DW GLLRQKA F+P L+ E+DTSYFD R+ RY H    DD +             ++E +E                      F SCSPRF  +   E
Sbjct:    1 SPGRSPSVYDNEIVMMNHVYKERFPKATAQMEERLQVLVAVNDPEDTLPLADGVLSFIHHQLIELARDCLAKSRTGQITSRYFYELQENLEKLLNDAQDRSESNEVAFITQLAKRLLIVISRPARLLECLEFDPEEFYHLLEAAEGHAKEDQGIKSDIPRYIISQLGLTRDPL----EEMAQLSSCDSGNPE---------------------TPETDDATDSRAAESLPKKKPCEEDFETIKLISNGAYGAVYLVRHKETRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVGMFCSFETKRHLCMVMEYVEGGDCATLLKNLGALPVDMAQLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHVKLTDFGLSKIGLMSLTTNLYEEHIEKDTREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGVILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGED-ALPSDVQDLITGLLERNPLERLGTGGAFEVKQHQFFHSLDWDGLLRQKAEFVPQLESEEDTSYFDTRSDRYHHLDSEDDTN-------------DEEPLE-------------------MRQFSSCSPRFKVYSSME 556          

HSP 2 Score: 97.8265 bits (242), Expect = 4.668e-20
Identity = 46/101 (45.54%), Postives = 68/101 (67.33%), Query Frame = 1
Query: 12130 IVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIV--GVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWR 12426
            +VIHR  + +GF +RAIRV+ G+S+VY++HH++    V+    A +AGLR GDLITH+NG  + G  HTEVV +I++SG  +S+   P   + I+  GP R
Sbjct:  790 VVIHRAGKKYGFTLRAIRVYMGDSDVYSVHHVVWWQNVEEGSPANEAGLRAGDLITHVNGEPVHGLVHTEVVELILKSGYKVSIATTPFENTSIKV-GPAR 889          
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007752.1 (pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 gene:ENSPMAG00000006982.1 transcript:ENSPMAT00000007752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 397.127 bits (1019), Expect = 7.422e-116
Identity = 355/1209 (29.36%), Postives = 580/1209 (47.97%), Query Frame = 1
Query:  901 HSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMH-YRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAY-----------ENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNF--KVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLS-AALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRS-GSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDES--DSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLE 4461
            H +  + +E+ AK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLGV KESV++VDE+TKE++  WPLT++++WAAS   FT+DFG+Y    YY+ QT +GE+ISQLIAGYIDIILK+K+AKD  G++ DEES M EE+++P K+ I++     V K + +SV+   ++            R  +   D+V                    + G        +T+  MH   M      Q+  + ++  ++  +Q+    L   +  P +G D  SQ W    +D S+  +  ++ A+ A  A V+    G          +  +     +  + + I+ +L  + + +R  A   D   DE  +G++L+ AA+ LA A ++L+K   P   + R    + +  AA  VG+AS +LL+ I E E                    DQ +Q+ L++LAK+VAN    L+ + K +A  AE+P+ Q +V+ AAT+  L+ SQL++ TK+V PTI    CQEQL+ + + V++A++  V++S  AT+ EEL     +AA  V +AL+ L++H+R+             +Y           ENI     S  D  ++V  AR LAQAT+ +++ I+  A  EQ +  E    L+ AA+ LA+AT  ++++AK    + +    +  LREA E   V T        I++++ + L  AA++AA   T  I  +  AA  +++ N   ++    + +++ I  L+ +++E++  P    AQ  LI +   ++ P   L  S +   P+V + +    L            EL+   H+A   C   +   +AL  ++ LE  L+  K  + +  L PLP E + ES +L + S  ++ GSA  Q          +   + G++S+ +    + A       + A     + A  +A     E    +  DK+          N   EA KAA      A  S PDN Q  R  Q +  +S AL+ C++SLPGQ+D+D   ++I     +   +  P    +  +    +S LT      NQA   +V A   +         R   D           D  D     + L     ++  +   +  +S     LL   K +  +P    V+ QL  A + + DSIN LL ++ T   PGQ+ECD  + +LE
Sbjct:    3 HKECGEFNEITAKSKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGVTKESVLRVDERTKEVMQEWPLTTVKRWAASPKSFTLDFGDYQVG-YYSVQTTEGEQISQLIAGYIDIILKKKQAKDRFGLEGDEESTMLEESVSPKKSTILQQQYNRVGKVEHASVALPAIM------------RPGAGGPDTV--------------------NWGMMPVAQQQVTSGQMHKGHMPPLSSAQQALVGTITSSMQAVQQAHGDLGDMDSLPPLGDDAESQSWRRNKMDESKHEIHSQVDAITAHTASVVNLTAG----------DPADTDYTAVGCAVTTISSNLTEMSKGVRLLAALLD---DEGANGQDLMQAARGLASAVSDLLKTVDPSTAEPR----QSVLTAAGNVGQASGELLRTIGEDE-------------------ADQSFQDMLMQLAKAVANAAATLVLKAKNVAQRAEDPAQQNRVIAAATQCALSTSQLVACTKVVGPTIRSPACQEQLMEAGKLVARAVEGCVQASQDATEEEELLRQVGEAATAVTQALNDLLRHVRQYAASLTGRAGPGGSYVQATDTILTATENI---FGSMGDAGEMVRQARLLAQATSDLVNAIKADAEAEQDQ--ENVRNLLAAARVLADATARMVEAAKGAAANPENEEQQQKLREAAEGLRVATNIA-AQNAIKKKLTNRLEQAAKQAAAASTQTIAAAQHAASSNKSPNSQQQLVQSCKVVADHIPQLVQSVRESQSTPDSQQAQQSLITSSLGFLQPGNHLVASARAAVPSVENQASSNQLGTCAKNLAACLSELRAAAHKAQQACSPTEGQDSALALVRALENELEEAKTEVAQGRLKPLPGE-TLESCSLELGSASKTVGSAIAQL---------LTAASQGDESFTDHAAHEAAEALRGLAAAARGVAANTADPLAQEAALETAR-DVMDKS---------ANLLQEARKAA------ANPSDPDNQQ--RLAQVAKAVSLALNNCVNSLPGQKDVDSALRNINDASKRLQADSFP---QSGRSYHEAQSGLTQAAAGLNQATGRVVHASHGSSRELATASGRFGRD---------FSDFLDAGIEMAGLTQTKEDQVQVIGNLKNISVSSSKLLMAAKSMVIDPAAPNVKNQLASAARAVTDSIN-LLISMCTQQAPGQRECDNALRQLE 1095          
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003561.1 (pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 gene:ENSPMAG00000003167.1 transcript:ENSPMAT00000003561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.335 bits (586), Expect = 1.839e-60
Identity = 128/316 (40.51%), Postives = 185/316 (58.54%), Query Frame = 1
Query: 10267 KESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQG----YDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNII--SGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVD--WQGLLRQKALFIPVLDHEDDTSYFD 11190
            + +D++ +K+I  GA+G V LVR K TKK +AMK + K  +  R+     + ERDIM FA+SP+VV L+  F+  +YL M+MEY+ GGD+  L+ +   +P++ AR Y AE VLAL+ +H+ G +HRD+KPDN+L+   GH+KL DFG      M + T   E ++  D  +       GTPDYI+PEV+  QG    Y +  DWW++G+ LYE +VG TPFY DS    +  I+     + +P D D  +  +A NLI   L  D  VR+G  G  E+K H FF +    W+ +    A  +P L  + DTS FD
Sbjct:   72 RANDYDVVKVIGRGAFGEVQLVRHKATKKVYAMKLLSKFEMTKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDHRYLYMVMEYMPGGDLVNLMSNYD-VPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKNGHLKLADFGT----CMKMDT---EGMVRCDTAV-------GTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNALNFPDDVD--ISKDAKNLICAFLI-DREVRVGRNGVGEIKRHPFFKNDQWTWENIRETAAPVVPELVSDTDTSNFD 369          
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004595.1 (pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 gene:ENSPMAG00000004137.1 transcript:ENSPMAT00000004595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.95 bits (585), Expect = 2.046e-60
Identity = 133/339 (39.23%), Postives = 203/339 (59.88%), Query Frame = 1
Query: 10276 DFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQG----YDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGE--IEWPQDPDPCVPDNAVNLITELL-KRDPLVRLGAEGTHEVKEHEFFSDVD--WQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDD--PDPGSGLGS 11259
            D++ +K+I  GA+G V LVR K TK  +AMK + K  ++ R+     + ERDIM FA+SP++V L+ +F+  +YL M+MEY+ GGD+  L+ +   +P++ AR Y AE VLA++ +H+ G +HRD+KPDN+L+   GH+KL DFG           T ++  LNKD  +  D  V GTPDYI+PEV+  QG    Y +  DWW++G+ L+E +VG TPFY +S    +G I+  +  + +P D D  +  NA +LI   L +RD  VRLG  G  E+K H+FF +    W+ +    A  +P L  + DTS FD      +++  +D+  P P + +G+
Sbjct:   46 DYDSVKVIGRGAFGEVQLVRHKVTKSVYAMKLLNKLEMIKRSDSAFFWEERDIMAFANSPWIVQLFYSFQDDRYLYMVMEYMPGGDLVNLMSNYD-VPEKWARFYTAEVVLAVDAIHSMGYIHRDVKPDNMLLDKSGHLKLADFG-----------TCMK--LNKDGMVRCDTAV-GTPDYISPEVLRSQGGQGYYGRECDWWSVGVFLFEMLVGDTPFYAESLVGTYGKIMDHKKSLTFPVDLD--ISKNAKSLICAFLTERD--VRLGKNGFAEIKCHDFFKNDQWTWENIRETSAPVVPELSSDTDTSNFDE----IENDKSADETFPQPKAFVGN 361          
BLAST of Talin-1 vs. Ensembl Yeast
Match: KIN82 (Putative serine/threonine protein kinase; implicated in the regulation of phospholipid asymmetry through the activation of phospholipid translocases (flippases); involved in the phosphorylation of upstream inhibitory kinase Ypk1p along with Fpk1p; has a redundant role in the cellular response to mating pheromone; KIN82 has a paralog, FPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000000687])

HSP 1 Score: 234.958 bits (598), Expect = 1.241e-64
Identity = 117/308 (37.99%), Postives = 186/308 (60.39%), Query Frame = 1
Query: 10258 MTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDV--ATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVL--NKDCT-MFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAE-GTHEVKEHEFFSDVDWQGLLRQKALFIPVLD 11163
            +T +   FE I+L+  G  G V+LVRE+ T + FA+K + K  ++ R +++++  E++I+  +D PF+V LY +F+T+ YL + MEY  GG+   A   +    + +E A+ Y +E V ALEYLH  G ++RDLKP+N+L+   GH+ L+DF LS     +   T+ +S     K C+  F+     GT +Y+APEVI   G+   +DWW +GI++YE + GCTPF GD++ E F NI++ ++++P D +  V  N  +LI +LL ++   RLG++ G  ++K H FF  V W  L  Q    IP L+
Sbjct:  317 ITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPHDKE--VSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQDPPLIPALN 622          
BLAST of Talin-1 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 223.787 bits (569), Expect = 4.595e-64
Identity = 115/314 (36.62%), Postives = 192/314 (61.15%), Query Frame = 1
Query: 10273 SDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLG--AEGTHEVKEHEFFSDVDWQGLLRQKALFI------PVLDHEDDTSYFD 11190
            SDF+ ++ +  G++G VHL+R     + +A+K ++K  ++   QVE    ER +++    PF++ ++ TF+  + + M+M+Y+EGG++ +L++     P+ +A+ Y AE  LALEYLH+  I++RDLKP+N+L+   GHIK+TDFG +K  + ++T TL        C         GTPDYIAPEV+  + Y+K +DWW+ G+++YE + G TPFY  +T + + NI++ E+++P    P    +A +L+ +L+ RD   RLG    G+ +VK H +F++V W+ LL   A +I      P+   + DTS FD
Sbjct:   86 SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY-VPDVTYTL--------C---------GTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFP----PFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLL---ARYIETPYEPPIQQGQGDTSQFD 374          
BLAST of Talin-1 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 222.246 bits (565), Expect = 1.232e-63
Identity = 115/310 (37.10%), Postives = 188/310 (60.65%), Query Frame = 1
Query: 10276 DFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLG--AEGTHEVKEHEFFSDVDWQGLLRQK---ALFIPVLDHEDDTSYFD 11190
            DF+ ++ +  G++G VHL+R +   + +AMK ++K+ ++   QVE    ER +++    PF++ ++ TF+  + + MIM+Y+EGG++ +L++     P+ +A+ Y AE  LALEYLH+  I++RDLKP+N+L+   GHIK+TDFG +K  + ++T TL        C         GTPDYIAPEV+  + Y+K IDWW+ GI++YE + G TPFY  +T + +  I++ E+ +P    P   ++  +L++ L+ RD   RLG    GT +VK H +F +V W+ LL +        P+   + DTS FD
Sbjct:   86 DFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKY-VPDVTYTL--------C---------GTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFP----PFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFD 373          
BLAST of Talin-1 vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 214.927 bits (546), Expect = 2.645e-61
Identity = 113/326 (34.66%), Postives = 191/326 (58.59%), Query Frame = 1
Query: 10276 DFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLG--AEGTHEVKEHEFFSDVDWQGLLR---QKALFIPVLDHEDDTSYFDPRT-SRYQHESESDDP 11235
            DF+ ++ +  G++G VHLVR     + +A+K ++K  ++   QVE    ER ++   + PF++ ++ TF+  + + M+M+Y+EGG++ +L++     P+ +A+ Y AE +LALEYLH   I++RDLKP+N+L+   GHIK+TDFG +K  +  +T TL        C         GTPDYIAPEVI  + Y+K +DWW++G+++YE + G TPFY  +  + +  I+ G++ +P    P    + V+L+++L+  D   R+G    G+ ++K H +FS+V W+ LL    +     P+     DTS FD     +  +  + DDP
Sbjct:   69 DFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQTVTWTL--------C---------GTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYP----PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEEQLDYGIQGDDP 372          
BLAST of Talin-1 vs. Ensembl Yeast
Match: FPK1 (Ser/Thr protein kinase; phosphorylates several aminophospholipid translocase family members, regulating phospholipid translocation and membrane asymmetry; phosphorylates and inhibits upstream inhibitory kinase, Ypk1p; localizes to the cytoplasm, early endosome/TGN compartments and thplasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; FPK1 has a paralog, KIN82, that arose from the whole genome duplication [Source:SGD;Acc:S000005330])

HSP 1 Score: 228.024 bits (580), Expect = 2.957e-61
Identity = 119/305 (39.02%), Postives = 185/305 (60.66%), Query Frame = 1
Query: 10279 FEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDV--ATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGL------SKVGLM--NLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAE-GTHEVKEHEFFSDVDWQGLLRQKALFIPVL 11160
            FE I+L+  G  G V LVREKKT + +A+K + KD ++ RN+++++  E++I+  ++ PF+V LY +F++  YL + MEY  GG+   A   +    + ++ AR Y +E   ALEYLH  G ++RDLKP+N+L+   GHI L+DF L      SKV ++  +  +TL+++ +  D   F+     GT +YIAPEVI   G+   +DWW +GI++YE + G TPF GD+T E F NI+  E+ +P + +  +     +LI +LL ++   RLG + G  +VK+H FF  V W  L  Q+   IPVL
Sbjct:  496 FEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDG--FRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNE--ISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEPPLIPVL 796          
BLAST of Talin-1 vs. Ensembl Nematostella
Match: EDO47777 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL15])

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 687/2304 (29.82%), Postives = 1207/2304 (52.39%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSL-ISDKMDFSPGIDKTLSMKRGISIN--------XXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMH--YR---MSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSE-ELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSR--ASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIES-----KKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAP--SFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECD---EXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNS---NIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSR----FGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNA 6825
              L+I++V  +  K +  +PEAT+ +    IR+ + +A       YGL+   DD  KG WL+ ++++  Y LK GD +EY+++ R + I+ MDG  KTL++DDS TV +++ TVC K+GI N +E+SL +  K D     +KT ++KR +  +        +D++K+D+LKKK HTED + WL+  ++LR+QG ++S  ++++RKYF+SD NVD +DP+QL+LLY Q +D +++GTHP T  EA +L  +Q QVQ G+Y   K+K   +DL+E LPKEY K+ K ++KKI  +H K   L E++ + KY  LCR  KTYG+TFFLVKEK+ GKNKL+PRLLG+ KES+++VDEKTKE++ TWPLT++R+WAAS N FT+DFG+Y+ + YY+ QT++GE+ISQLIAGYIDIILK++K  +    D DE S M E+ +APSK   +              D    K  H +  SV +   A      Q  + +            S+G+ +       + S H  +R   + +    Q+ Y+ SL   +D++    ++L        +G D AS +W    +D SRQ +A  + A++A+ A ++    G          E  +        +  +I+ +L  L + I+  A   D   D      +L+ AA+ LA AF+ L+KAA       +   R ++ +AA  VG + + LL+ + E                    E DQ  QE LL+LA++VAN T  L+ + K +A +  + + Q KV+ AA +T +  SQL++  K+V P+I   +CQEQ++ S + V+KA++    +   A   + E  ++ + AA  V++AL+ L+K +R+  ++  + + +    ++I      + +S  +  ++V  A+ LAQAT++++S I+ +A  E     + + +L+ AAK LA+AT  L+++AK    + ++ + +  L+ A E     T  T  +  ++++++  L  AA++A    T L+  + +AA  +R  AS  ++ +  + + +QI+ L+ ++++   +P D  +QL LI   + +I P  +L   +K   PT+ +P   + L      +  +  EL+    +A   C  L++ +AL++LK L+ +LK+++ + E   L+PLP E  + SA  L  + +  GS+  Q          +     G +SY         G  AR+ + AL  L  A RGVAA                +K AQ  IV      ++ +  L+ EAK +   P D +   R  Q +  +S AL+ C++ LPGQR+++   K + +      K +F     P Q+N        + +L+ +    N A +++VSA   S N +    K   +SY  +V    +L     DE         + ++ +   +   S     LL   + +  +P+    +  L  A + + DSIN LL N   +  PGQKECD  +  ++++  ILDNPV P++   YF+CL+ +  K+ + L +++  I  ++K  +  KF  SI   +++VC L E  AQ AYLV V D  S  G  GL D   F+  ++EI++ CQ++ NPD++ ++    +++ A  +A+++  LC A K  +     P  K +     K      + L+  ++    N N+DNRK   S +  ++++V  L    LS  FA   A IS+EA+ +Q P+  AG ++ ++       +K  + +  +   +     + K + DA++ LI+ IK++APGQ+ECD   E +  +   + QA      +         RT +  + YQ  +   L +M   +  L  A K +PE +  + ++ T  L  + ++ I AA+   L++NS      L+   T+ E++ Q++ A K +GGNP+ +  H  +DE AQ + ++  DL   +++ + + G V+ +V++I+K+ ++    ++   +      F   Q +M     D+     D+   ++++ T+  L PL ++++  YDD+    +GAVAT+ N +   +++  VQ +G+  I LV+S   V+  P+   S  +L  +++++ +++  ++  LI+ + GTQAC  A   ++ I SD+DT+++F  +  +  +     +  E F   R  ++  +  LV + K +V+      ++L  +A+    +   L + VK+G   + S  S     LL + ++V  +L S +   +N SG    DP  + LK   K  ++ ++SLL  +K+++D  ++  +A++++
Sbjct:    3 LSLKINVVKNNSIKTLQFNPEATVAEALRIIREKVPDASPGKVADYGLFKQEDDPAKGKWLEPARSINFYPLKDGDMLEYKSKIRLIKIKFMDGNVKTLQIDDSHTVGQILETVCVKMGISNPEEFSLLVEGKDDEKEEAEKTSTLKRVMMKDVPIKRLEERDRKKMDQLKKKLHTEDDVQWLDHDKTLREQGTDDSHTVVMRRKYFYSDQNVDIKDPVQLNLLYVQCRDGILDGTHPCTQEEASQLGAIQIQVQFGDYEESKYK--LIDLKEVLPKEYVKS-KNIDKKIKEEHRKFNGLDELQGRYKYVQLCRGLKTYGVTFFLVKEKMKGKNKLVPRLLGITKESILRVDEKTKEVMKTWPLTTVRRWAASPNSFTLDFGDYT-ESYYSVQTNEGEKISQLIAGYIDIILKKRKGMEGYDPDFDEVSAMEEDQVAPSKGTYL--------------DRQTNKVGHASVGSVAL--PAVVRAGGQGSSRY------------SMGKMEPAQYGTVSGSAHSAHRPPMLHNLTPAQQAYMSSLSQGIDSVDTADEELKRPVNIVALGSDPASLKWKQNTLDVSRQNVASRLAALSASCASIVNVTSG----------EPGDTNYTAAGAAVHVISANLQDLSKGIKLIAGLLDNQDDS----SKLLDAARGLAGAFSLLLKAAQEGAGGDKE-KRSQLLNAAGNVGSSGAQLLEYMGE-------------------PEVDQETQETLLKLAQAVANATATLVLKAKNVASQCPDTAQQNKVIGAAKDTAMTTSQLVACVKLVVPSITSQMCQEQVVESAKQVAKAVEDTEGACKGACDPDSENMNVLIDAAQGVRDALNALLKKVREGGERPTEGEKYGETCDDILGATDRLFNSMGNAGEMVKQAKILAQATSSLVSGIKSEA--EVQDDDDNQKRLLAAAKLLADATAKLVEAAKGAARNPNDADEQEKLKRAAEDLRSAT-NTAASDALKKKLVKRLENAAKEATGQTTQLVAAAQAAAPVNRNQASQQQLMDQLKPVEDQIARLLESLRDCSNNPDDANSQLNLINVSKMFIPPVAKLVAFSKAALPTIDEPMYASQLGNFSKSTAASLNELRNAAEKAAEACGTLEVDSALKRLKALDDDLKAVERAAEEGKLVPLPGENPESSALELGATSKTVGSSMAQL---------LTAAAQGNESY--------TGIAARDTANALKNLTQAVRGVAAGTS-------------DKDAQKNIVQAARGVIQESAKLINEAKKALNNPGDPNNQQRLAQVAKGVSQALNNCVNCLPGQREVEDSIKAVSAASQALSKEEFPPTTEPYQRN--------QEKLSQSGAALNAAASDVVSASRGSPNQLATSTKNFSLSYQGLVNSGLMLAGQAPDE---------AAKEALVRNLRNTSTASSKLLLAARSLVSDPNAPNAKNALANAARAVTDSINTLL-NACMSAAPGQKECDSALRNIQAVNTILDNPVEPVNDSTYFDCLETVAGKS-KDLTEAMPVIADSIKQADYNKFDRSIKRASNAVCALTETAAQAAYLVAVADPSSVAGKPGLIDQEQFINAKQEINDACQSLLNPDSSQQR----VLAAATAVAKHTSALCNACKVASAKTHEPAAKRQFVQAAKDVANNTANLVKQIKTFAGNMNDDNRKSCASATRPLRNSVESLTAYALSPDFAPVPAKISDEARSAQVPVIMAGKSIANSGANYFNAAKLSVVNPQDTNAWQNLQQTAKQVADAMRRLITAIKDNAPGQRECDLAIEDINTVINNLDQA-----SLANISDGLEPRTEQPLQVYQERMMQNLGEMNPVVEPLGVAAKSQPENIGHLVAKMTDFLVPLCDAAIGAAS---LMKNSKRKGDLLDQTKTVAESAAQMMYATKTAGGNPQVHHAHPAVDEAAQSMHDAIYDLKNTIEQDASESGIVSGLVDSISKTLSESPYDSVDAYRRGAYEPFVVYQERMTKAMKDLVRKAQDMVGKSSTDPTK--LGPLAKDISNLYDDIAHNARGAVATVGNADVAGRIRNGVQGLGESCIGLVQSAGAVQATPTDPYSKKDLADRSRQVAEKVSHLLAALITGSRGTQACINAASTVQGIVSDLDTTVMFATAGTLNPE-----TPGETFADHREDILRTAKVLVEDTKRLVASAQASQDVLATAAESSVGSVSKLTDHVKLGAAAMGSDDSDAQQMLLNAARDVASALGSLINSTKNASGKSPNDPAMEPLKSSAKTMVSNVSSLLMTVKTVEDKTMRGTRAMESS 2169          
BLAST of Talin-1 vs. Ensembl Nematostella
Match: EDO42523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S134])

HSP 1 Score: 563.148 bits (1450), Expect = 4.099e-178
Identity = 279/555 (50.27%), Postives = 387/555 (69.73%), Query Frame = 1
Query: 9568 KPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENE---NTVSWEPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNV---QTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQH 11214
            + RS+SL+P RS G+ E ++ +LN++YKERFP A  QM  +L   +E+  +E   +    + +   V  Q+++  +D+L  +   ++TS +F+EL++ +E+LL E + K    +  VR +++ LL I++RPARLLEC+EF+P E+Y +LE     + +    + D+  Y+ ++LGLD++      +++   ++                              +S + +  +++ S  P E DF+ IKLISNGA+GAV+LVR K+T  RFA+KKI K  +L +NQVEQ+FAERDI+TFA++PFVVGL+C FET+K+LCM+MEYVEGGD A+L+K+IG LP +LARMYFAETVLA+EYLH++GIVHRD+KPDNLLIT  GHIKLTDFGLSK+GLMN TT + E  L++D   F DKQVFGTPDY+APEVILRQGY + +DWW+MGIILYEF++G  PFYGD+ EELF + +SG+IE   D +   PD+AV+LI  LL++DP  RLG+ G  EVKEH FF+ +DW  LLRQKA FIP L+ EDDTSYFD R+ RY H
Sbjct:   75 RQRSRSLSPNRSFGSQEDELQLLNNLYKERFPNAVKQMEAKLMEFVEDYTSETWGSVFGCDGVLNFVWHQVIESARDVLLQSQESSLTSRHFYELSEKMERLLYEAKQKTEVDMTPVRRLMRKLLVIVSRPARLLECLEFNPGEYYSMLEQEGQQMNSECPEKLDITNYVKARLGLDEEGRTTEPDDITDEID------------------------------DSTDPVTPTYTTSHLPTEEDFDYIKLISNGAFGAVYLVRHKETHTRFAIKKINKHAMLHKNQVEQVFAERDILTFAENPFVVGLWCCFETKKHLCMVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIKPDNLLITSLGHIKLTDFGLSKIGLMNSTTRMYEHSLDRDTKQFMDKQVFGTPDYLAPEVILRQGYGRAVDWWSMGIILYEFLMGVPPFYGDTPEELFAHTLSGDIE-GLDGEDAPPDDAVDLIRGLLEQDPTQRLGSAGALEVKEHVFFTGLDWTALLRQKAEFIPQLEGEDDTSYFDSRSERYNH 598          
BLAST of Talin-1 vs. Ensembl Nematostella
Match: EDO28503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6A2])

HSP 1 Score: 413.305 bits (1061), Expect = 5.509e-130
Identity = 206/389 (52.96%), Postives = 278/389 (71.47%), Query Frame = 1
Query: 9907 VRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNV---QTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQV-----EQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDP 11049
            VR +++ LL I++RPARLLEC+EF+P E+Y +LE     + +    + D+  Y+ ++LGLD++      +++   ++                              +S + +  +++ S  P E DF+ IKLISNGA+GAV+LVR K+T  RFA+KKI K  +L +NQV     +Q+FAERDI+TFA++PFVVGL+C FET+K+LCM+MEYVEGGD A+L+K+IG LP +LARMYFAETVLA+EYLH++GIVHRD+KPDNLLIT  GHIKLTDFGLSK+GLMN TT + E  L++D   F DKQVFGTPDY+APEVILRQGY + +DWW+MGIILYEF++G  PFYGD+ EELF + +SG+IE   D +   PD+AV+LI  LL++DP
Sbjct:    4 VRRLMRKLLVIVSRPARLLECLEFNPGEYYSMLEQEGQQMNSECPEKLDITNYVKARLGLDEEGRTTEPDDITDEID------------------------------DSTDPVTPTYTTSHLPTEEDFDYIKLISNGAFGAVYLVRHKETHTRFAIKKINKHAMLHKNQVVISMLKQVFAERDILTFAENPFVVGLWCCFETKKHLCMVMEYVEGGDCASLLKNIGALPADLARMYFAETVLAVEYLHSYGIVHRDIKPDNLLITSLGHIKLTDFGLSKIGLMNSTTRMYEHSLDRDTKQFMDKQVFGTPDYLAPEVILRQGYGRAVDWWSMGIILYEFLMGVPPFYGDTPEELFAHTLSGDIEG-LDGEDAPPDDAVDLIRGLLEQDP 361          
BLAST of Talin-1 vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 207.608 bits (527), Expect = 6.342e-58
Identity = 119/343 (34.69%), Postives = 191/343 (55.69%), Query Frame = 1
Query: 10234 LELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMT-FADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA-EGTHE-VKEHEFFSDVDWQGLLRQ--KALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGS 11247
            ++L  S +   K SDF  +K+I  G++G V L + K+  K +A+K + K  +  RN+ + I AER+++      PF+VGL+ +F+T+  L  +++YV GG++   ++     P+  AR Y AE   A+ YLH   I++RDLKP+N+L+  +GHI LTDFGL K G+    TT                   GTP+Y+APEV+ +Q YDK +DWW +G +LYE + G  PFY   T E++ NI+   +    +    +  +A +++  LL++D   RLG+ EG  E ++ H FF  ++WQ L+ +  +  + P +  + D  +FDP   R        +P PGS
Sbjct:   59 IDLGESNNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTT---------------STFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTN----ISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVR--------EPVPGS 374          
BLAST of Talin-1 vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 204.527 bits (519), Expect = 8.183e-58
Identity = 110/310 (35.48%), Postives = 182/310 (58.71%), Query Frame = 1
Query: 10273 SDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGA--EGTHEVKEHEFFSDVDWQGLLRQKAL--FIPVLDHEDDTSYFD 11190
             DFE  K +  G +G V L R+++  + +A+K +    ++   QVE +  E++I+   + PF+V L  T   + +L M++EY  GG++ T +++ G   +     + +E V A++YLH   IV+RDLKP+N+L+  +GH+KLTDFG +K             V +K  T+       GTP+Y+APE+I  +G++K +DWWA+GI++YE +VG  PF+ D+   ++  I+SG++EWP+  D     +A +LI +LL  D   RLG+   G+ +VK H++F  +DW  +L++K      P + H  DT  FD
Sbjct:   16 QDFELSKTLGTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNGTGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAK------------EVHDKTWTL------CGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSGKVEWPKHMDNT---SAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFD 304          
BLAST of Talin-1 vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 698/2291 (30.47%), Postives = 1194/2291 (52.12%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSE------DCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAP-----LTQNLTQRYDDLCRACQGAVA--TLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   I+  C  IR  + EAQT     YGL+L  +D +KG+WL++ +TL +Y+L+ GD +EY+ + R   I+ +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     D T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++++E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG+Q Q+Q G++   K KPGFLDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLG+ KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++     V + +  SV+   V            +R  S  ++S+                    +LG   SP   +T   MH   M      Q+  + ++  ++  +QK +  L   +  P +G+D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             D+   G +L+ AA+ LA A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  +++   AT+  EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++I+ L        AA T T     + +A+ K+ A++ ++    + +++ I  L+  ++ ++  P+D  AQL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+    +A   C  +++ +AL  ++ L   L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + +         G  ARE + AL  L  AARGVAASI              +  A   ++++  + ++ +  L+ EAK    SP D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + +P     N +    ++EL  T  D NQ+  E+V+A             R S  ++        HD FDE   A   ++ +     + V ++S           LL   K +  +P     +  L  A + + DSIN+L+T + T   PGQKECD  +  LE++R +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F DS+   + ++C L E   Q +YLVGV D  S+ G++GL D   F +  + I   CQ + +P+++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR   +  +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++  +++ +++L  +  +   +   +   + ++D++K LI+ I++ APGQ+ECD ++  + K I+    + + ++       SR   S E+ Q  L S + ++ H I+ +S A + E  QL    ++     E ++ + +  A++ +  Q    +L+   T+ E++ Q+L A K+ GGNPKA+  H  I E AQ + E+ +D++  L++ + + G V  +VE+I ++ AK+ E     ++  F + Q+ M+         +  I+  A    T+ + +P     L   +T  Y  L  A QG +A  T   E  G Q++  VQ +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++ E       F   R +++  +  LV + K++VS        L ++A   A T   L + VK+G   + S   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQTGQASDYGLFLSDEDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVE-EKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGV------------IRSGSIGTESL--------------------TLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DDVGGGNDLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELLKQVSAAASVVSQALADLLQHVRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHIPQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTAIQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLT-----CAA----QGNEHF--------TGIAARETAQALKTLAQAARGVAASI-------------TDPKASAAMLDSARDVMEGSALLIHEAKQALISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGEASKKLLMDAIP---PANKSFQEAQNELNQTAADLNQSAGEVVTA------------TRGSSSQLAVASGKFSHD-FDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASSKLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLIT-LCTQQAPGQKECDNALRELEAVRGMLDNPSEPVNDLSYFDCIESVMENS-KVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLVDPIQFAKANQAIQMACQNLVDPESSPSQ----VLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFASNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVSQ--NLPSRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDEGTPPEDEGSFVDYQTSMV-------KHSKAIAVTAQEMMTKSVTSPDELGALASQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFASAGTLNAENDES------FADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELISATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2151          
BLAST of Talin-1 vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 698/2291 (30.47%), Postives = 1194/2291 (52.12%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSE------DCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAP-----LTQNLTQRYDDLCRACQGAVA--TLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
              L+I +   +V K +  +P   I+  C  IR  + EAQT     YGL+L  +D +KG+WL++ +TL +Y+L+ GD +EY+ + R   I+ +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     D T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++++E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG+Q Q+Q G++   K KPGFLDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLG+ KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++     V + +  SV+   V            +R  S  ++S+                    +LG   SP   +T   MH   M      Q+  + ++  ++  +QK +  L   +  P +G+D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             D+   G +L+ AA+ LA A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  +++   AT+  EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++I+ L        AA T T     + +A+ K+ A++ ++    + +++ I  L+  ++ ++  P+D  AQL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+    +A   C  +++ +AL  ++ L   L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + +         G  ARE + AL  L  AARGVAASI              +  A   ++++  + ++ +  L+ EAK    SP D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + +P     N +    ++EL  T  D NQ+  E+V+A             R S  ++        HD FDE   A   ++ +     + V ++S           LL   K +  +P     +  L  A + + DSIN+L+T + T   PGQKECD  +  LE++R +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F DS+   + ++C L E   Q +YLVGV D  S+ G++GL D   F +  + I   CQ + +P+++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR   +  +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++  +++ +++L  +  +   +   +   + ++D++K LI+ I++ APGQ+ECD ++  + K I+    + + ++       SR   S E+ Q  L S + ++ H I+ +S A + E  QL    ++     E ++ + +  A++ +  Q    +L+   T+ E++ Q+L A K+ GGNPKA+  H  I E AQ + E+ +D++  L++ + + G V  +VE+I ++ AK+ E     ++  F + Q+ M+         +  I+  A    T+ + +P     L   +T  Y  L  A QG +A  T   E  G Q++  VQ +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++ E       F   R +++  +  LV + K++VS        L ++A   A T   L + VK+G   + S   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTAIYDACRIIRDRVPEAQTGQASDYGLFLSDEDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVE-EKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGV------------IRSGSIGTESL--------------------TLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DDVGGGNDLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELLKQVSAAASVVSQALADLLQHVRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHIPQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTAIQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLT-----CAA----QGNEHF--------TGIAARETAQALKTLAQAARGVAASI-------------TDPKASAAMLDSARDVMEGSALLIHEAKQALISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGEASKKLLMDAIP---PANKSFQEAQNELNQTAADLNQSAGEVVTA------------TRGSSSQLAVASGKFSHD-FDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASSKLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLIT-LCTQQAPGQKECDNALRELEAVRGMLDNPSEPVNDLSYFDCIESVMENS-KVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLVDPIQFAKANQAIQMACQNLVDPESSPSQ----VLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFASNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVSQ--NLPSRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDEGTPPEDEGSFVDYQTSMV-------KHSKAIAVTAQEMMTKSVTSPDELGALASQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFASAGTLNAENDES------FADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELISATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2151          
BLAST of Talin-1 vs. Ensembl Medaka
Match: tln1 (talin 1 [Source:NCBI gene;Acc:101157630])

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 697/2279 (30.58%), Postives = 1180/2279 (51.78%), Query Frame = 1
Query:   55 LRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAK--KSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAK---SSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNL--VNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPN--DKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKM-KIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVR--PSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            L + I   +V K +  +P   ++  C  IR+ + EAQ   P  YGL+L  +D KKG+WL+  K L +Y+L+ GDT++Y+ + R L IR +DGT KT+ VDDS  VS++++T+C ++GI NYDEYSL+ D +      + T ++K+  ++ +D +K++KLK+K HT+D LNWL+  ++LR+QG+EE+E+LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG QCQ+Q G+++  K K GFLDL+E LPKEY KN    EKKIF  H   ++++E+EAK  Y  L RS KTYG++FFLVKEK+ GKNKL+PRLLG+ KE V++VDEKTKE+I  W LT+I++WAAS   FT+DFG+Y  D YY+ QT +GE+I+QLIAGYIDIILK+KK+KDH G++ DEES M E++++P K+ +++     + K +  SV+    ++R  A    S                    +Q           +G        +T+  MH   M      Q+    ++  ++  +Q  +  L   +  P +G D ASQ W    +D S+  +  ++ A+ A  A ++    G     +          I+      S     L +LME             DE  +G+ L+ AAK LA A ++++K A P   + R    + +  AA  VG+ S +LL  I E                   T+ D  +QE L++LAK+VAN    L+ + K +A + E+ + Q +V+ AAT+  L+ SQL++ T++VAPTI   VCQEQLI + + V+K+++  V +S  AT  E L      AA  V + L+ L++H+++       +     A + I    + +  S  D  ++V  AR LAQAT+ +++ I++ A  E     E   KL++AAK LA+AT  ++++AK    + D    +  LREA E   + T        I++++++ L  AA++AA   T  I  +  AA   K++ +  ++    + ++ QI  L+  ++ ++  P    AQL LI A ++++ P  ++  + K   PT+SD +    L+Q       A  EL+    +A   C  L++  AL  ++ LE++++  K S     L PLP E   + +  L  + +   SA  Q          + E T G+++Y        AG  AR+++  L  LV AARGVAAS           D    + A L    + L+  K+A +L+ EAK   + P D +   R  Q +  +S AL+ C++ LPGQRD+D   + +         +  P   ++  +    +++L +     NQ+ NE+V A       + K   K    +   ++    +      + D         +  + + +  +S     LL   K +  +  +  ++ QL  A + + DSIN+L+T + T   PGQKECD  +  LES++ +L+NP   ++   +FEC+D +++ + + L +S+  I    K+ N  +F DS+   + ++C L E  AQ AYLVGV D  S  G KGL D T F +  + I   CQ + +P  T  Q    ++S A  +A+++  LC A +       N   K +     K      + L+  ++ L+  F+++NR++ ++ +G + + V  L     + +FA   A IS E   +  PI AA  T+L+++  +IQ +++L  +  +   +   +   + ++D++K LI+ ++E APGQ+ECD+A+ +L   I++   + +  I +H +    R   S E+    + +++ ++ + I+ ++ A + E  QL    S+     E ++ + I  A++    Q     L+   T+ E++ Q+L   K++GGNPKA  +   ++E  Q + E+ +DL A L   +   G V  +V+TI  +  K+++S  +     F + Q+ M+     +     ++ + +N+      L  L   LT  + +L    + A  T  N+  G  +++ V  +G     LV     ++  P+   +   L    +++ +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++       E F   R  ++  +  LV + KL+VS        L ++A     T   LA  VK+G   L S   +  + L+ + ++V  +L + +   +  +G P+ DP    LK   K  +  +TSLLK +K+++D   K  +A++  I
Sbjct:    4 LSLKIGVGNVVKTMQFEPSTMVYDACRIIRERVPEAQLGQPNDYGLFLSDEDPKKGIWLEAGKALDYYMLRNGDTLDYKKKQRPLKIRMLDGTVKTVMVDDSKIVSDMLMTICARIGITNYDEYSLVHD-IGEEKKEETTGTLKKDKTLLRDDKKMEKLKQKLHTDDELNWLDHGRTLREQGVEETEMLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGDHNESKHKSGFLDLKEFLPKEYIKNKG--EKKIFQAHKNCQNMTEIEAKVSYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWAASPKSFTLDFGDYQ-DGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGMEGDEESTMLEDSVSPKKSTVLQQQFNKMGKVETGSVALP-AIMRSGAGGPES--------------------FQ-----------MGSMPQAKQHITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQASLEDFDTLPPLGTDAASQAWRKNKMDESKHEIHSQVDAITAGTASMVNLTAGDPAETDYTAVGCAVTTISSNLTEMSKGVKLLAALME-------------DEGGNGQLLLGAAKNLACAVSDMLKTAQPANTEPR----QNLLQAAGNVGQTSGELLSHIGE-------------------TDTDPQFQEMLMQLAKAVANAAAALVLKAKNVAQKTEDSAQQNRVIAAATQCALSTSQLVACTRVVAPTISSPVCQEQLIEASKLVAKSVEGCVGASQSATNDEGLLKQVGVAATGVTQTLNELLQHIKQYASGGHPIGRHGEATDRILNVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKMDAEGE--SDLENSRKLLSAAKLLADATAKMVEAAKGAAANPDSEEQQQKLREAAEGLRMAT-NAAAQNAIKKRLVNKLENAAKQAAAAATQTIAAAQHAASTNKNQGAQQQLVQSCKVVAEQIPQLVQGVRGSQSQPDSPSAQLALINASQNFLQPGAKMVTAAKATVPTISDQASAMQLSQCAKNLASALAELRTASQKAQDACGQLEIDNALVMVRDLEKDIQEAKASAREGKLKPLPGETLGKCSQDLSTNTKAVTSAIAQL---------LSEATQGDENY--------AGISARDMAQTLKSLVSAARGVAAS----------TDDPAARGAVLDCAGDVLD--KSA-NLIEEAKRAIAKPGDAESQQRLAQVAKAMSQALNRCVNCLPGQRDVDNAIRTVGEASKTLLADSFP---SSGKSFQELQAQLNEVAAGLNQSANEVVQASRGTTQDLAKATSKFGQDFSNFLDAGVDMAGTSQSKED---------QTQVVSNLKTISMSSSKLLLAAKALSTDSSSPNLKNQLAAAARAVTDSINQLIT-MCTQQAPGQKECDNALRELESVKGMLENPTEAVNDLSFFECIDSVMENS-KVLGESMAGISHNAKNSNLPEFGDSVSAASKALCGLTEGAAQAAYLVGVSDPNSTAGQKGLVDPTQFARANQSIQMACQNLVDPACTQSQ----VLSAATIVAKHTSALCNACRLASSQTSNAVAKRQFVQSAKEVANTTANLVKSIKALDGAFSQENREKCKAATGPLIEAVDNLTAFASNPEFASIPAHISPEGHAAMEPIVAAAQTMLESSTGLIQTARSLAVNPKDPPTWSVLAGHSRTVSDSIKKLITNMREKAPGQRECDDAIEVLNGCIREVDQASLAAISQHLT---PREDISMETLHEQMAASVHEISNLIDPVAVAARSEASQLGHKVSQMASYFEPLIMAAIGTASKILSSQQQMAVLDQTKTLAESALQMLYTAKEAGGNPKAAHMQEAVEESVQMMKEAVDDLGATLADAASAAGAVGGMVDTINDAINKMEDSHTLDHDGTFVDYQTTMVKTAKAIAVTVQEMVTKSNTNPDD--LGGLANQLTNNFGNLANEAKYAALTAENDEIGSHIKKQVGELGFTCTGLVTKAGALQCSPNDTFTKKELIESARKVSEKVSHVLASLQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLHREN------AETFADHRECILKTAKALVEDTKLLVSGAGASQEKLAQAAQSSVSTITKLAEVVKLGAASLGSEDPETQVVLINAVKDVAKALSNLISATKAAAGKPHDDPSMLQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATI 2148          
BLAST of Talin-1 vs. Ensembl Medaka
Match: tln2a (talin-2 [Source:NCBI gene;Acc:101173776])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 666/2200 (30.27%), Postives = 1141/2200 (51.86%), Query Frame = 1
Query:  322 MDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHY-RMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHL--LVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKS---SPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSE------DCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAP-----LTQNLTQRYDDLCRACQGAVA--TLSNENNGKQLQECVQTVGKVSISLVK--STTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            +DG  KT+ VDDS TV EL++T+C+++GI NY+EYSLI + ++     D T ++K+  ++ +D+ K++KLK K HT+D LNWL+ S++ R+QG++++E LLL+RK+F+SD NVDSRDP+QL+LLY Q +D ++NG+HPV+  +A E AG+Q Q+Q G++   K KPGFLDL+E LPKEY K  +  EKKIF +H    +++E+EAK KY  L RS +TYG++FFLVKEK+  KNKL+PRLLG+ KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KD  G++ DEES M EE+++P K+ I++     V + +  SV+   V            +R  S  ++S+                    +LG   SP   +T   MH   M      Q+  + ++  ++  +QK +  L   +  P +G+D AS+ WI   +D S+  +  ++ A+ A  A V+    G  T  +          I+      S     L +LME             D+   G +L+ AA+ LA A ++L+KA  P   +     R+ +  AA ++G+AS DLL+QI E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+   Q +V+ AAT+  L+ SQL++  K+V+PTI   VCQEQLI + + V ++++  +++   AT+  EL      AA+ V +AL  L++H+R+   + + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++I+ L        AA T T     + +A+ K+ A++ ++    + +++ I  L+  ++ ++  P+D  AQL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+    +A   C  +++ +AL  ++ L   L+  K +     L PLP E  ++ A  L  + +  GS+  Q        C       G + +         G  ARE + AL  L  AARGVAASI              +  A   ++++  + ++ +  L+ EAK    SP D +   R  Q +  +S +L+ C++ LPGQ+D+DM  K I     +   + +P     N +    ++EL  T  D NQ+  E+V+A             R S  ++        HD FDE   A   ++ +     + V ++S           LL   K +  +P     +  L  A + + DSIN+L+T + T   PGQKECD  +  LE++R +LDNP  P++   YF+C++ +++ + + L +S+  I    K  +   F DS+   + ++C L E   Q +YLVGV D  S+ G++GL D   F +  + I   CQ + +P+++  Q    ++S A  +A+++  LC A +  +   + P  K       K    + + L+  ++ L+ +F+E+NR   +  +  + + V  L     + +FA   A IS E   +Q PI  +  ++LD++  +++ +++L  +  +   +   +   + ++D++K LI+ I++ APGQ+ECD ++  + K I+    + + ++       SR   S E+ Q  L S + ++ H I+ +S A + E  QL    ++     E ++ + +  A++ +  Q    +L+   T+ E++ Q+L A K+ GGNPKA+  H  I E AQ + E+ +D++  L++ + + G V  +VE+I ++ AK+ E     ++  F + Q+ M+         +  I+  A    T+ + +P     L   +T  Y  L  A QG +A  T   E  G Q++  VQ +G   I LV+     ++ P+ + +   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  +  +  ++ E       F   R +++  +  LV + K++VS        L ++A   A T   L + VK+G   + S   +  + L+ + ++V  +L   +   +  +G    DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct:    2 LDGAVKTIMVDDSKTVGELLVTICSRIGITNYEEYSLIQETVEEKKE-DGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDDNETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGIQAQIQFGSHIEHKHKPGFLDLKEFLPKEYIKQ-RGAEKKIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGV------------IRSGSIGTESL--------------------TLGTMPSPQQQITMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLGEVDNLPPLGQDMASKVWIQNKMDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAALME-------------DDVGGGNDLMKAARTLAGAVSDLLKAVEPASGEP----RQTVLTAAGSIGQASGDLLRQIGENET-------------------DERFQDVLMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELLKQVSAAASVVSQALADLLQHVRQYTSRGEPIGRYDQATDTIMTVTESIFISMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQSCKAVADHIPQLVQGVRSSQAKPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQAAAMQLGQCAKNLATCLAELRTAAQKAHEACGPMEIDSALTAIQTLRSELQDAKLAATTTQLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLT-----CAA----QGNEHF--------TGIAARETAQALKTLAQAARGVAASI-------------TDPKASAAMLDSARDVMEGSALLIHEAKQALISPADAESQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALKSIGEASKKLLMDAIP---PANKSFQEAQNELNQTAADLNQSAGEVVTA------------TRGSSSQLAVASGKFSHD-FDEFLDAGIEMAGHTQKKDDQVQVISNLKNISMASSKLLLAAKSLSVDPAAANAKNLLAAAARAVTDSINQLIT-LCTQQAPGQKECDNALRELEAVRGMLDNPSEPVNDLSYFDCIESVMENS-KVLGESMAGISQNCKISDVTAFGDSVGSASKALCGLTEAAGQASYLVGVSDPNSQAGHQGLVDPIQFAKANQAIQMACQNLVDPESSPSQ----VLSAATIVAKHTSALCNACRLASSKTTNPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEENRSRCQVATTPLIEAVENLTTFASNPEFASVPAQISNEGSAAQEPIIQSARSMLDSSTLLLKTARSLALNPKDPPTWSVLAGHSRTVSDSIKSLITAIRDKAPGQRECDSSIDNINKCIRDIEQASLAVVSQ--NLPSRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVTQLAGYFEPLIKASVGVASKLNDHQQQMTFLDQTKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAAQLMKEAVDDIMVTLNEAASEVGMVGGMVESIAEAMAKLDEGTPPEDEGSFVDYQTSMV-------KHSKAIAVTAQEMMTKSVTSPDELGALASQVTVDYSQL--AVQGRLASHTAEPEEIGFQIKTRVQELGHGCIYLVQKAGALQISPTDSFTKRELIECARAVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFASAGTLNAENDES------FADHRENILKTAKALVEDTKMLVSGAASGQERLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELISATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2058          
BLAST of Talin-1 vs. Ensembl Medaka
Match: tln2b (talin 2 [Source:NCBI gene;Acc:101167954])

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 601/1922 (31.27%), Postives = 1017/1922 (52.91%), Query Frame = 1
Query:   49 FELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLIS----DKMDFSPGI---DKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEH----VPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMH-YRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENI----QEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAA--KKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSS---PPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDES-DSALH---HLSSNRDHIA--NGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASK--TIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTIS-RTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPK 5724
              L+I +   +V K +  +P   ++  C  IR+ + EAQT     YGL+L  DD +KG+WL++ +TL +Y+L+ GD +EY+ + R   I+ +DGT KT+ VDDS TV EL++T+C+++GI NY+EYS+I     DK D   G    D+TL ++       D+ K++KLK K HT+D LNWL+ S++ R+QG+EESE LLL+RK+F+SD NVDSRDP+QL+LLY Q +D +ING+HPV+  +A E AG+Q Q+Q G +   K KPGFLDL+E LPKEY K  +  EKK+F +H    +++E+E K KY  L RS +TYG++FFLVKEK+ GKNKL+PRLLG+ KESV++VDEKTK+++  WPLT++++WAAS   FT+DFGEY  + YY+ QT +GE+ISQLIAGYIDIILK+K++KDH G++ DEES M EE+++P ++ I++     V + +  SV+   ++                  S S+   D              T ++G   S    +TT  MH   M    + Q+  + ++  ++  +Q+ +  L   +  P +G D AS+ W+   +D S+  +  ++ A+ A  A V+    G          E  E     +  + + I+ +L  + + ++  A   D   DE  SG +L+ AA+ LA A ++L+++  P   + R    + +  AA ++G+AS DLL+ + E E                    D+ +Q+ L+ LAK+VAN    L+ + K +A  AE+ + Q +V+ AAT+  L+ SQL++ TK+V+PTI   VCQEQL+ + + V ++++  V++   A+   EL      AA  V +AL  L++H+R      + +  +  A + I    + +  S  D  ++V  AR LAQAT+ +++ ++  A  E     +   KL+ AAK LA+AT  ++++AK      +  + +  LREA E   V T        I++++++ L +AA++AA   T  I  + +AA   K+ AS+ ++ +  + +++ I  L+  I+ ++  P++   QL LI A ++++ P  ++  S K   PTV+D +    L Q          EL+    +A   C  L++ +AL+ ++ L+  L+  K S+    L PLP E  ++ A  L  + +  GS+  Q        C       G + Y         G  ARE + AL  L  AARGVAA  +             E  A   ++++    ++ +  L+ EA  +   P D D   R  Q +  +S +L+ C++ LPGQ+D+DM  + I     +   + LP     + +    +++L  T  + N +  E+V +             + S D             FDE  D+ +    H  S  D I     +  +S     LL   K +  +P     +  L  A + + +S+N+L+T + T    GQKECD  +  LE++R +LDNP  PI+   YF+C++ +++ + + L +S+  I    K  + Q F +S+   + ++C L E   Q +YLVGV D  S+ G++GL D   F +  + I   CQ + +P ++  Q    ++S A  +A+++  LC A +  +   S P  + +     K      + L+  ++ L+ +F+E+NR      +  + + V  L     + +F    A IS E   +Q PI  +  ++LD++  +I+ +++L+ +  +   +   +   + ++D++K LI++I++ APGQ+ECD ++  + K I+   D +   +    +T+  R   S E+ Q  L S++ ++ H I+ +S   + E  QL    ++     + ++ + +  A++    Q     L+   T+ E++ Q+L A K+ GGNPK
Sbjct:    4 LSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRKGIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGTIKTVMVDDSKTVGELLVTICSRIGITNYEEYSVIQELTEDKKDDGLGTLRKDRTLLLR-------DERKMEKLKAKLHTDDDLNWLDHSRTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDIINGSHPVSFDKACEFAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQ-RGAEKKVFQEHKNCGEMTEIEGKVKYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTVKRWAASPKSFTLDFGEYQ-ESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDHFGLEGDEESTMLEESVSPKRSTILQQQFNRVGRVEHGSVALPGII-----------------RSGSIGGPD--------------TFNMGTMPSAQQQITTGQMHKGHMPPLSLAQQALMGTINSSMQAVQQAQADLGHVDNLPPLGHDLASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAG----------EPAETDYTAVGCAITTISSNLTEMSKGVKLLAALMD---DEVGSGHKLMGAARMLAGAVSDLLRSVEPAAAEPR----QTVLTAAGSIGQASGDLLRHMGEGET-------------------DEKFQDTLMNLAKAVANAAAMLVLKAKNVAQVAEDTTLQNRVIAAATQCALSTSQLVACTKVVSPTISSPVCQEQLVEAGKLVDRSVETCVKACRSASDDGELLKQVAAAAGVVSQALSDLLQHVRHYASCGEPIGRYDQATDTIMNVTENIFTSMGDAGEMVRQARVLAQATSDLVNAMRSDA--EAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREAAEGLRVAT-NAAAQNAIKKKLVNRLEIAAKQAAAAATQTIAAAQNAAISNKNTASHQQLVHSCKAVADSIPQLVQGIRSSQAQPEELGPQLTLIMASQNFLQPGSKMVSSAKSAVPTVADQAAAMQLGQCAKNLATCLAELRTATQKAHEACGPLEIDSALKTVQTLKCELQDAKISVIDAQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLT-----CAA----QGNEHY--------TGVAARETAQALRTLAQAARGVAACTK-------------EPQAAAAMLDSAQCVMEGSAMLIHEAHQALVHPGDADSQQRLAQVAKAVSHSLNNCVNCLPGQKDVDMALRSIGEASKKLLVDFLP---PCSKSFQEAQTDLNHTAAELNHSAGEVVHSSRGTSRQLAAASGKFSQD-------------FDEFLDAGIEMAGHTQSKEDKIQVIGNLKNISMASSKLLLAAKSLSVDPGAANAKNLLAVAARAVTESVNQLIT-LCTQQAAGQKECDNALRELEAVRGLLDNPNEPINELSYFDCIESVMENS-KVLGESMAGISQHCKTGDVQAFGESVSLASKALCGLTEAAGQASYLVGVSDPNSQSGHEGLVDPIQFARAHQAIQTACQNLVDPASSPSQ----VLSAATIVAKHTSALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKGLDGDFSEENRNRCRLATAPLLEAVENLATFANNPEFVSAPAQISNEGSAAQEPIVRSARSMLDSSTYLIETARSLVLNPKDPPSWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDYSIDNINKCIR---DIEQASLAAVGQTLPCRDDISMEALQEQLTSSVQEIGHLIDPVSTTARGEAAQLGHKVTQLASYFDPLIVASVGLASKLQDHQQQMTILDQTKTLSESALQMLYAAKEGGGNPK 1791          

HSP 2 Score: 87.0409 bits (214), Expect = 5.194e-16
Identity = 70/254 (27.56%), Postives = 121/254 (47.64%), Query Frame = 1
Query: 6073 AVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISN--LQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAI 6828
            A+A  + E    Q++  VQ +G   I LV+    ++ S   S S   L    + + +++  V+  L + N GTQAC  A   +  I +D+DT+I+F  SA   N + E     E F   R S++  +  LV + KL+V+        L ++A   A T   L   VK+G   + S   +  + L+ + ++V  +L   +   +  +G P  DP    LK   K  +  +TSLLK +K+++D   +  +A++  I
Sbjct: 1817 AIAITAQEMVAFQIRTRVQELGHGCIFLVQKAGALQLSPTDSFSKRELIECARSVTEKVSLVLSALQAGNKGTQACITAASAVSGIIADLDTTIMFA-SAGTLNPENE-----ESFADHRESILKTAKALVEDTKLLVAGAASTQEKLAQAAHSSAKTITQLTEVVKLGATSMGSENPETQVVLINAVRDVAKALAELIGATKCAAGKPPDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATI 2064          
BLAST of Talin-1 vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 5274.52 bits (13681), Expect = 0.000e+0
Identity = 2671/2685 (99.48%), Postives = 2675/2685 (99.63%), Query Frame = 1
Query:   22 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRDPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAS 8076
            SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMK GISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQD TDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEE+EEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERD+LINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLD AGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ    MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLI ILEASEQLLKA+KKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTS LPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTR PSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA+
Sbjct:    9 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERDRLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ----MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRYPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAT 2689          
BLAST of Talin-1 vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 5272.98 bits (13677), Expect = 0.000e+0
Identity = 2671/2685 (99.48%), Postives = 2675/2685 (99.63%), Query Frame = 1
Query:   22 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRDPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAS 8076
            SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMK GISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQD TDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEE+EEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERD+LINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLD AGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ    MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLI ILEASEQLLKA+KKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTS LPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTR PSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA+
Sbjct:    9 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERDRLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ----MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRYPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAT 2689          
BLAST of Talin-1 vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 5272.98 bits (13677), Expect = 0.000e+0
Identity = 2669/2683 (99.48%), Postives = 2673/2683 (99.63%), Query Frame = 1
Query:   28 MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRDPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAS 8076
            MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMK GISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQD TDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEE+EEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERD+LINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLD AGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ    MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLI ILEASEQLLKA+KKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTS LPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTR PSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA+
Sbjct:    1 MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERDRLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ----MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRYPSEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNAT 2679          
BLAST of Talin-1 vs. Planmine SMEST
Match: SMESG000066444.1 (SMESG000066444.1)

HSP 1 Score: 5250.64 bits (13619), Expect = 0.000e+0
Identity = 2671/2726 (97.98%), Postives = 2674/2726 (98.09%), Query Frame = 1
Query:   22 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKRGISINXXXXXXXXXXXXYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIXXXXXXXXXXXXIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRXXXXXXXXXXXXXXAYENIQEXXXXXXXXXXXXXXXRRLAQATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRXXXXXXXXXXXXPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDSSLMISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEXXXXXXXXXXQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIXXXXXXXXXXXXXXGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRDPSEVDLDTAKNQIKFVTTKLIDIKLNPD------------------------------------------LIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA 8073
            SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMK GISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQD TDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEE+EEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERD+LINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLD AGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ    MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLI ILEASEQLLKA+KKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTS LPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTR PSEVDLDTAKNQIKFVTTKLIDIKLNPD                                          LIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA
Sbjct:    9 SPMLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSPKSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMDGTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTLSMKHGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLLKRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQCQVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSEVEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVDEKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQLIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKRSSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDGTDFYQEDINMSRQTSSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQLMIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQGLATIEENEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTDEDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGEASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVANETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTIEQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEALDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQATTAMISEIQLKAVNEQYKTPEERDRLINAAKQLAEATTVLIDSAKNCTMDKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTGTHLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHLAQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIATEELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPDEKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENLDAAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQIVNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLPGQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQAVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHLSSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLDSINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECLDFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQTAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQ----MISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELMTGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISEEAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDLNDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTISRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLLESMVNSCICAANQTDLIQNSNIYLEHLIAILEASEQLLKAIKKSGGNPKANSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQNLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEVRPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEINSDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLIVSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVSFQEVIVSLISFLEVARNTSELPYTDPLFQNLKEEGKCSINAITSLLKVLKSMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRLSIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISVVSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNFKLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSSPEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRYPSEVDLDTAKNQIKFVTTKLIDIKLNPDSTCSFCEPVLVVDGLGNGRTKSAINNNNNNNKTFKIDVDPYQLIGKDKCSVAEVDQMLSYIKDIGWSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEAASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIHTHGNQIKKNTDLLLNHLNCINDRKWGEASLNA 2730          
BLAST of Talin-1 vs. Planmine SMEST
Match: SMESG000019748.1 (SMESG000019748.1)

HSP 1 Score: 2668.65 bits (6916), Expect = 0.000e+0
Identity = 1527/1556 (98.14%), Postives = 1532/1556 (98.46%), Query Frame = 1
Query: 8227 WSMPLLVLITSFFVEISHYHSXXXXXXXXFHKSSDQGSKLISIIKSFEMQSNHXXXXXXXXXXXXXXQVESVSLKVDVAIQTDSIXXXXXXXXXXVRSRLQVHETNLLQKSLSSCKYPRKEKDDNLKKHVKFDSSIYTQMLDNVVDKYNRDVLIQQAEIINSSFPKSLSFSENLTQIEPDKEDVDESNIDKVTKPETNSDSGSSPRKIIRSKSDTKILSIWWSHIAKYKKDLTFKDNSVTSRPRLSSNISRVSSHGRRSLLFFGPNQPVLTSNSNPLKTVAMEDSKDLKTGSPTNSGKSPSFNTGVHIRAENKRVSDTRRWSLASLPSSGYGTLTPTSSNLSSQYSSKENLIHHKHHSSHQPRSPLCIGNNNTSQSSPFHSSGLVTSITQSSIRTANVAITGKCISGRNSRNHSPNDKISTIGESHRTPTDSTSDAQFASKTLPITIKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSWEPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCPESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEIXXXXXXXXXXXXXXXXXLNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGSGLGSXXXXXXNDETIEHCEXXXXXXXXXXXXXGTVFHAFPSCSPRFSRFVETELCRMSESSSLVFPQDSEDAGKMXXXXXXXXXXXXXXXXXXXXXXXXDDPIKSHGSAAVTIRTGGNXXXXXXXXXXXXXXXXXXXXXXXXXETELPSVIXXXXXXXWRDVGNQTNAVAMADIAVARERCDXXXXXXXXXXXXXXXXXXXXXCHSTLRALKPIRDPISAVSPLARVDXXXXXXXXXXXXXXXXXXXXXHQLTPPPAPAGSHRRSSAPRAQSPLXXXXXXXXXXXTQEPQPPPAIVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQHLRAGKKCCTGHQKPLKAIGXXXXXXXXXXXXXXXXXLSGGGATYFGYSSPSGSAPQIIRRSTEKPLIRQLSEKQQHRMQQSNQAGGPRQPVADTGSTGLITRTRHQHHXXXXXXXXXXXXXXXXXCHQQQQPPSGGTARR 12894
            WSMPLLVLITSFFVEISHYHSLLKWLLLLFHKSSDQGSKLISIIKSFEMQSNHLYNWLNDLTNDNDDQVESVSLKVDVAIQTDSIKHCKCHCRRRVRSRLQVHETNLLQKSLSSCKYPRKEKDDNLKKHVKFDSSIYTQMLDNVVDKYNRDVLIQQAEIINSSFPKSLSFSENLTQIEPDKEDVDESNIDKVTKPETNSDSGSSPRKIIRSKSDTKILSIWWSHIAKYKKDLTFKDNSVTSRPRLSSNISRVSSHGRRSLLFFGPNQPVLTSNSNPLKTVAMEDSKDLKTGSPTNSGKSPSF TGVHIRAENKRVSDTRRWSLASLPSSGYGTLTPTSSNLSSQYSSKENLIHHKHHSSHQPRSPLCIGNNNTSQSSPFHSSGLVTSITQSSIRTANVAITGKCISGRNSRNHSPNDKISTIGESHRTPTDSTSDAQFASKTLPITIKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSWEPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKC ESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEITGCGGGRSRERTESGCELNMSQ+SNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGSGLGSAAAAAANDETIEHCESNDDNNYYSQDNNGTVFHAFPSCSPRFSRFVETELCRMSESSSLVFPQDSEDAGKMARSVSAAPSLLSSESSSSCGGAGGDDPIKSHGSAAVTIRTGGNSSTSSSSLELSAHGSLAHHSSDASSETELPSVIGGGGGNNWRDVGNQTNAVAMADIAVARERCD    +    S  + GAGGGAGCHSTLRALKPIRDPISAVSPLARVD  +T    A AAANVARSASTHQLTPPPAPAGSHRRSSAPRAQSPL   GA+GASGGTQEPQPPPAIVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQHLRAGKKCCTGHQKPLKAIGQVPPVPPHRQQHQVKQHLSGGGATYFGYSSPSGSAPQIIRRSTEKPLIRQLSEKQQHRMQQSNQAGG RQPVADTGSTGLITRTRHQHHSNSNSSSPSPVASSSYSCHQQQQPPSGGTARR
Sbjct:  223 WSMPLLVLITSFFVEISHYHSLLKWLLLLFHKSSDQGSKLISIIKSFEMQSNHLYNWLNDLTNDNDDQVESVSLKVDVAIQTDSIKHCKCHCRRRVRSRLQVHETNLLQKSLSSCKYPRKEKDDNLKKHVKFDSSIYTQMLDNVVDKYNRDVLIQQAEIINSSFPKSLSFSENLTQIEPDKEDVDESNIDKVTKPETNSDSGSSPRKIIRSKSDTKILSIWWSHIAKYKKDLTFKDNSVTSRPRLSSNISRVSSHGRRSLLFFGPNQPVLTSNSNPLKTVAMEDSKDLKTGSPTNSGKSPSFTTGVHIRAENKRVSDTRRWSLASLPSSGYGTLTPTSSNLSSQYSSKENLIHHKHHSSHQPRSPLCIGNNNTSQSSPFHSSGLVTSITQSSIRTANVAITGKCISGRNSRNHSPNDKISTIGESHRTPTDSTSDAQFASKTLPITIKPRSQSLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTVSWEPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRLKCLESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRNVQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEITGCGGGRSRERTESGCELNMSQDSNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLVREKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTFETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNFGIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTMFQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDSTEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHEVKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDDPDPGSGLGSAAAAAANDETIEHCESNDDNNYYSQDNNGTVFHAFPSCSPRFSRFVETELCRMSESSSLVFPQDSEDAGKMARSVSAAPSLLSSESSSSCGGAGGDDPIKSHGSAAVTIRTGGNSSTSSSSLELSAHGSLAHHSSDASSETELPSVIGGGGGNNWRDVGNQTNAVAMADIAVARERCD---SSPVAMSVASSGAGGGAGCHSTLRALKPIRDPISAVSPLARVD--STATNPAAAAANVARSASTHQLTPPPAPAGSHRRSSAPRAQSPL---GATGASGGTQEPQPPPAIVIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGDLITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPAGKMATKHHPRKAQHLRAGKKCCTGHQKPLKAIGQVPPVPPHRQQHQVKQHLSGGGATYFGYSSPSGSAPQIIRRSTEKPLIRQLSEKQQHRMQQSNQAGGSRQPVADTGSTGLITRTRHQHHSNSNSSSPSPVASSSYSCHQQQQPPSGGTARR 1770          
The following BLAST results are available for this feature:
BLAST of Talin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN10.000e+029.81talin 1 [Source:HGNC Symbol;Acc:HGNC:11845][more]
TLN20.000e+029.58talin 2 [Source:HGNC Symbol;Acc:HGNC:15447][more]
MAST41.266e-2256.22microtubule associated serine/threonine kinase fam... [more]
MAST41.525e-2256.22microtubule associated serine/threonine kinase fam... [more]
MAST41.320e-2256.22microtubule associated serine/threonine kinase fam... [more]
back to top
BLAST of Talin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln-10.000e+026.67TaLiN [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUD9][more]
kin-43.643e-15752.29KIN-4 protein; Protein KINase [Source:UniProtKB/T... [more]
kin-47.039e-15752.29KIN-4 protein; Protein KINase [Source:UniProtKB/T... [more]
kin-48.709e-15652.29KIN-4 protein; Protein KINase [Source:UniProtKB/T... [more]
kin-42.971e-15552.29KIN-4 protein; Protein KINase [Source:UniProtKB/T... [more]
back to top
BLAST of Talin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhea0.000e+027.99gene:FBgn0260442 transcript:FBtr0305210[more]
rhea0.000e+027.99gene:FBgn0260442 transcript:FBtr0333105[more]
rhea0.000e+027.99gene:FBgn0260442 transcript:FBtr0333106[more]
rhea0.000e+027.99gene:FBgn0260442 transcript:FBtr0333108[more]
rhea0.000e+028.03gene:FBgn0260442 transcript:FBtr0333107[more]
back to top
BLAST of Talin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln10.000e+030.77talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln10.000e+030.89talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2a0.000e+030.64talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
tln2a0.000e+030.57talin 2a [Source:ZFIN;Acc:ZDB-GENE-040724-263][more]
mast1a1.930e-1952.61microtubule associated serine/threonine kinase 1a ... [more]
back to top
BLAST of Talin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLN20.000e+029.79talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+028.98talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+028.80talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN20.000e+028.93talin 2 [Source:NCBI gene;Acc:100144637][more]
TLN24.228e-1730.69talin 2 [Source:NCBI gene;Acc:100144637][more]
back to top
BLAST of Talin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tln10.000e+030.49talin 1 [Source:MGI Symbol;Acc:MGI:1099832][more]
Tln20.000e+030.34talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln20.000e+030.34talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Tln20.000e+030.34talin 2 [Source:MGI Symbol;Acc:MGI:1917799][more]
Mast42.180e-2356.40microtubule associated serine/threonine kinase fam... [more]
back to top
BLAST of Talin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y490|TLN1_HUMAN0.000e+029.81Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3[more]
sp|P26039|TLN1_MOUSE0.000e+030.49Talin-1 OS=Mus musculus OX=10090 GN=Tln1 PE=1 SV=2[more]
sp|P54939|TLN1_CHICK0.000e+029.97Talin-1 OS=Gallus gallus OX=9031 GN=TLN1 PE=1 SV=2[more]
sp|Q9Y4G6|TLN2_HUMAN0.000e+029.58Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4[more]
sp|Q71LX4|TLN2_MOUSE1.057e-1431.25Talin-2 OS=Mus musculus OX=10090 GN=Tln2 PE=1 SV=3[more]
back to top
BLAST of Talin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YNR70.000e+034.17Talin OS=Fasciola gigantica OX=46835 GN=FGIG_00042... [more]
A0A4E0S2C90.000e+034.21Talin OS=Fasciola hepatica OX=6192 GN=D915_001787 ... [more]
A0A0X3P9U10.000e+034.56Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A5K4FCV30.000e+035.20Putative talin OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A0X3PHC10.000e+034.52Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Talin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln10.000e+030.42talin 1 [Source:ZFIN;Acc:ZDB-GENE-031002-48][more]
tln2b0.000e+029.77talin 2b [Source:ZFIN;Acc:ZDB-GENE-130325-1][more]
tln2a0.000e+029.59talin-2-like [Source:NCBI gene;Acc:103042966][more]
mast22.966e-2556.04microtubule associated serine/threonine kinase 2 [... [more]
mast3b5.944e-2053.65microtubule associated serine/threonine kinase 3b ... [more]
back to top
BLAST of Talin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003776.10.000e+030.71pep scaffold:Pmarinus_7.0:GL481036:4073:28398:-1 g... [more]
mast24.668e-2050.65microtubule associated serine/threonine kinase 2 [... [more]
ENSPMAT00000007752.17.422e-11629.36pep scaffold:Pmarinus_7.0:GL478287:501:47681:-1 ge... [more]
ENSPMAT00000003561.11.839e-6040.51pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 ge... [more]
ENSPMAT00000004595.12.046e-6039.23pep scaffold:Pmarinus_7.0:GL477044:11103:63873:-1 ... [more]
back to top
BLAST of Talin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN821.241e-6437.99Putative serine/threonine protein kinase; implicat... [more]
TPK34.595e-6436.62cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK11.232e-6337.10cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK22.645e-6134.66cAMP-dependent protein kinase catalytic subunit; p... [more]
FPK12.957e-6139.02Ser/Thr protein kinase; phosphorylates several ami... [more]
back to top
BLAST of Talin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO477770.000e+029.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425234.099e-17850.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285035.509e-13052.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378006.342e-5834.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352288.183e-5835.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Talin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tln2a0.000e+030.47talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2a0.000e+030.47talin-2 [Source:NCBI gene;Acc:101173776][more]
tln10.000e+030.58talin 1 [Source:NCBI gene;Acc:101157630][more]
tln2a0.000e+030.27talin-2 [Source:NCBI gene;Acc:101173776][more]
tln2b5.194e-1631.27talin 2 [Source:NCBI gene;Acc:101167954][more]
back to top
BLAST of Talin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066444.10.000e+099.48SMESG000066444.1[more]
SMESG000066444.10.000e+099.48SMESG000066444.1[more]
SMESG000066444.10.000e+099.48SMESG000066444.1[more]
SMESG000066444.10.000e+097.98SMESG000066444.1[more]
SMESG000019748.10.000e+098.14SMESG000019748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018086 ID=SMED30018086|Name=Talin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=13480bp
ATCTATATAAATCTTATATGATCGCCAATGCTGAATTCTAATGGTAATTT
CGAATTGAGAATACATATAGTTGATGCTGATGTTACGAAAATTGTTCCTC
TCGACCCTGAAGCTACTATATTTCAACTATGTGAAACTATAAGAAAAAAT
ATTCGAGAAGCCCAAACAAAATCTCCTAAATCTTATGGTTTGTATCTACC
TCATGATGATTTGAAAAAAGGACTATGGCTAGACAATTCCAAAACTCTGC
AGCATTACATTTTGAAGAGAGGGGACACTATTGAATACAGAAACAGATCT
CGCTGGTTACATATTCGTACCATGGATGGAACAAATAAAACTTTAAAAGT
TGACGATAGTTGGACAGTTTCTGAATTGATGCTAACAGTTTGTACAAAAT
TAGGAATTTATAATTATGATGAATATTCTCTGATTTCGGATAAAATGGAT
TTTTCACCAGGCATTGACAAAACTTTATCGATGAAACGCGGAATAAGCAT
AAATAAAGACCAAGAAAAGCTGGATAAATTGAAAAAAAAATATCACACTG
AAGATGGTTTGAATTGGTTGAATCCTTCGCAAAGTCTTCGTCAACAAGGA
ATTGAAGAAAGTGAAGTTTTACTTCTAAAAAGAAAATATTTTTTTTCTGA
TATGAATGTTGATTCAAGAGATCCGATTCAATTAAGTCTTTTATATGAAC
AATTGAAAGATGCAGTTATTAATGGAACTCATCCTGTCACACTGCCGGAA
GCAATCGAATTAGCCGGATTGCAATGTCAAGTGCAGTTAGGAAATTATTC
CGCTGATAAATTTAAACCAGGATTCTTGGATTTACGTGAATGTCTCCCGA
AAGAATATCAAAAAAACCCAAAGACTGTCGAGAAAAAAATATTTAATCAA
CATTCAAAATCAAAGGACCTTTCAGAAGTCGAAGCCAAGGAAAAATATTG
CCTCTTATGTCGAAGTTTCAAAACTTATGGAATAACCTTTTTCCTCGTAA
AGGAAAAAGTAATAGGAAAAAACAAATTAATTCCTCGTCTTCTTGGAGTA
AATAAAGAAAGTGTTGTTCAAGTGGATGAAAAAACCAAAGAAATCATCAA
TACATGGCCATTGACATCAATAAGAAAATGGGCTGCGTCATTCAATGGTT
TTACCATGGATTTTGGTGAATATTCGCCCGATGAATATTATACTGCTCAA
ACTGATAAAGGCGAGAGAATATCACAGTTAATTGCCGGATATATTGATAT
CATTCTTAAACGAAAAAAAGCAAAAGATCATCTAGGCGTTGATGCAGACG
AAGAAAGTATTATGTATGAAGAAAATATTGCTCCATCTAAAGCAATTATT
GTTGAACATGTTCCAAAGCAAAAAAGGTCTTCGGTTAGTGAAGAGGATGT
TGTTATTCGTAAAAAGGCACACATGGCAAATTCCTCTGTAAGAATGAATA
GTCAAGCTTCTGATTCAGTTTGTTCTCAAGATTGTACTGATTTTTATCAG
GAAGATATTAACATGAGCCGACAAACATCATCTTTAGGGAGAACTCAATC
TCCAAGCAGTTCCTTGACAACAAATTCTATGCATTATCGAATGTCGGATG
ATGATATTCGTCAAAAACTATACATTATATCATTACAAGATAATCTGGAT
ACAATTCAAAAGTACAAAGATCAATTAATGATAGAAAACAAAGGTCCGGA
GATAGGAAAAGATGAGGCAAGTCAACAATGGATATATGTTAATATTGATA
ATAGTCGTCAACGCATGGCTGATGAAATTGGTGCAATGAATGCGGCAGTT
GCGCAAGTTCTTCGTTCAGCGCAAGGTCTAGCAACAATCGAAGAGAGTGA
AGAGGAAGAAATGAATGAAGAAATGATTGCTAAAATGCAGAATTCGTTCA
GTTTGATTACAGTACATTTACCGAGTTTGATGGAAGAGATAAGAACTGCT
GCCTATTATCAAGATCAGCTAACAGACGAAGATGTATCAGGTGAAGAACT
CATAGCTGCCGCAAAGCGTTTAGCTGATGCATTTACCAATCTAATCAAAG
CTGCATATCCAGTTGAAGATCAAAAACGGTCGTTAAACAGAAAAGAAATT
TTCGATGCTGCAAATGCAGTCGGAGAAGCAAGCAGTGATCTACTGCAGCA
AATAACAGAACAAGAAAATTGTCAAATTGAATTGAAAAGTGAACGTCCAT
ATTCTATCATCATGATAACAGAAGAAGATCAATTGTATCAAGAAGAATTG
TTAAGATTAGCAAAAAGTGTGGCTAATGAAACTACAAATTTAATTAAACA
AGTGAAAGTGATTGCTGTTGAAGCAGAAAATCCCAGTGACCAAAAGAAAG
TAGTTATGGCTGCGACCGAAACTGGATTAGCTATCAGTCAATTAATTTCA
ACGACAAAGATAGTTGCGCCAACTATAGAACAGTCAGTTTGTCAGGAGCA
ATTAATTTTTTCCATTGAGGATGTTAGTAAAGCAATACAAGTTGTAGTTG
AAAGTTCAAATAAAGCCACTCAATCGGAAGAGTTACAAGATCTTACAGTT
CAAGCTGCAAATCAAGTTCAAGAAGCACTAGATACTTTAATGAAGCATCT
CAGGAAGGATTTTGACAAAAATGACAAACTCGACAATTTTCTGTTGGCAT
ATGAAAATATTCAAGAAGTAGACGATAGTGATGACGATCTCGACAAACTC
GTTTCCGCGGCCAGAAGATTAGCTCAGGCCACAACAGCAATGATTTCTGA
AATTCAATTAAAAGCAGTAAATGAACAATACAAAACTCCTGAAGAACGCG
ATAAGCTCATTAACGCTGCAAAACAATTGGCTGAAGCTACTACTGTTTTG
ATTGATAGTGCAAAAAATTGTACCATGGATAAAGACGAAATGAATTTACG
ATACACATTGAGAGAGGCCACCGAACGGTTTATTGTAGTCACATATACAA
CAGAATGTGCAACATATATCCAAGAACAAGTTATTGACCACTTGCTGGTA
GCAGCTCGGAAAGCAGCAACGACAGGAACGCATTTAATTAATACCAGTTT
ATCTGCTGCTAAAAAATCCCGGGCCAGTAATTTTAAGGTATGTAATGATG
GCCGAGAATTATCCAATCAAATTTCGAACTTGATTGTTGCGATTAAAGAA
GCACGAAGAGATCCGAAGGATCACTTAGCTCAGTTGGAATTGATTGCTGC
TTGTAGAGATTACATTGATCCTAGTGAACAATTATCTCAATCAAATAAAT
ATATGTGGCCAACTGTGTCTGATCCTTCTTTACAAACTGCATTAAACCAA
TCAATTAACCAGTCAGTGATTGCTACAGAGGAATTGAAAAAATGCGTCCA
TCAAGCTGATCTCATGTGCCAGCATCTGGATTTGTCAGCTGCCTTGGAAC
AGCTTAAGCGATTGGAGCAAAATCTGAAAAGCATAAAAAATTCCATTGAA
AGAGAAAATTTAATTCCTTTGCCCGATGAAAAGAGCGATGAATCAGCCGC
TTTGTTAATTAAAAGTGTTCGGCGAAGTGGGTCCGCTGCTAATCAATTTA
AAAATGACTTAGAAAGTAGATGCGTTGTGTATGAACAAACAAATGGAGAA
GATAGTTATCAAAATTTAGAAAATCTTGACGTGGCTGGTCAAAAAGCCCG
AGAATTATCCATGGCTCTTGATAGATTGGTTCATGCAGCTCGAGGAGTGG
CTGCCAGTATTGAATTCGAAAATCAAGAATCTGAAAACAATGACAAAAAC
CTAGAGAAACTTGCTCAATTGCAAATCGTAAATAACTGTTTAGAAGCTGT
AAAGGCTGCTCGCGATTTAGTTATTGAAGCTAAATCTAGCCCTCCAGATA
ATGATCAGATGGATCGTGCTCAACAAGCTTCTGTGCGATTATCAGACGCC
TTATCACTTTGTCTTGATAGTCTTCCTGGACAGAGAGATCTGGATATGCT
ATCAAAACATATTGAATCCAAGAAACATCAGTTTGCCGAAAACCGATTAC
CTATTCAACAAAACAACAACATCAATTTGAGTAATTGCCGATCAGAATTA
ACCGACACGACATTCGATTTTAATCAAGCTGTTAACGAATTGGTATCTGC
ACCATCTTTCAATTTAGTCAATAAAGGCTGTAAAAAGATGAGAATGTCAT
ATGATAGAATTGTTGAGATCTGTAATGTGCTTGTACACGATCCGTTTGAT
GAGTCTGATTCCGCGTTGCACCATTTGTCTTCCAATAGAGATCATATAGC
TAATGGGGTTATGATAATGTCTGAGGATTGTCAAACATTGCTTGATAAAG
TGAAAAAAATTCAATGTGAACCAGATAATATAATCGTTCGTAAACAACTG
CAAGAAGCCACAAAAATGTTGTTGGATTCGATCAATCGGTTGCTGACAAA
TATCTCTACGAATTTGCGTCCTGGGCAAAAGGAATGCGATAAAACAATTT
ACCGATTAGAGAGCATGCGTCCAATTCTCGATAATCCAGTCCATCCAATT
TCACATAAAGATTACTTTGAATGTCTCGATTTTATTATTGATAAAACTGT
GCAACCACTGGCAGATAGTTTAAAAAACATCCCTGCTGCAGTTAAAGATG
AAAACAATCAGAAATTTATCGATTCTATCTATCATTGCGCAGATTCTGTC
TGCATGTTATTAGAAGAAACAGCCCAGACTGCTTATTTAGTTGGTGTAGG
AGATGTCCGATCTAAAATTGGAAATAAAGGACTTGCTGATCATACGTCAT
TCTTACAGATTCAAAAAGAAATTTCTGAAAACTGTCAAACTATTTGTAAT
CCTGACACAACTGCTAGACAGGATTCATCATTAATGATTTCTACAGCTGG
TCAAATTGCTGAAAATTCAAGGAAGCTTTGCGAAGCTAGCAAAACAATTA
TGATTTCATTTCCAAATGACAAAATTAAACTATCTGATAAAACAAAAATT
ACTTTATTAGCTGTTAGTGAATTAATGACGGGGGTTCAAAATCTCAATCA
AAACTTTAATGAAGATAATAGAAAAGAAGTCGAATCCTTGTCTGGTAAAG
TTCAAGATAATGTAGCTGAATTAGTTCAGTTATTATTGAGCTATAAATTT
GCTGGAGATGCTGCTATTATATCAGAAGAAGCAAAAGAATCGCAAGGTCC
TATTAAAGCAGCTGGAATAACAGTTTTAGATACTGCCATTGAAGTTATAC
AATGTTCTAAAGCTTTAATATCATCAGAAGCCAACGAGGAATTATTTATA
GCATATTCTAGTAGCTGTAAAGATTTGAACGATGCTTTAAAACATTTAAT
ATCGACAATTAAAGAAAGCGCCCCCGGTCAAAAAGAATGTGATGAAGCTT
TAGCTATATTAGCTAAGTTGATAAAACAAGCTTATGATTCTAAAATGAAA
ATTATGAAACATAGGTCGAGAACGATTTCTCGTACTTTTGAATCTGAAGA
ATCTTATCAAAATATTTTGCAAAGTGCTCTTATTCAAATGCCACATTGCA
TAAATGAACTCTCTAGAGCTGGTAAGAAAGAACCTGAACAGCTTGCTCGA
ATCTTTTCGCGACAAACTCAACTTCTTGAATCGATGGTCAACAGCTGTAT
ATGTGCAGCAAATCAAACAGATCTTATTCAAAACTCAAATATTTATCTGG
AACACTTAATCACAATTTTGGAGGCCAGTGAACAGTTATTAAAAGCAGTT
AAAAAAAGTGGAGGAAATCCCAAAGCAAACTCGGTTCATTCACAGATAGA
TGAAATGGCTCAAGGAGTAATCGAGAGTTGTGAAGACCTTTTGGCAGCTC
TTGATAAAATATCTTTCAAACAAGGTAATGTCAATACAATAGTTGAAACG
ATCACTAAGTCTTCAGCAAAGGTCCAAGAATCAGCGATTATTCCAGAAAA
ATCTAGATTCGGAAATTCTCAATCAAAAATGCTTGACATCTGCTATGATA
TGAATAATTTGACAACTGACATTTCCAGTAATGCAAATTCCGAATCAACT
CAACGCCTGTTAGCTCCATTGACGCAAAATCTTACTCAGAGATATGATGA
TTTGTGTCGTGCGTGCCAAGGTGCCGTTGCTACACTATCTAATGAAAACA
ATGGTAAACAGTTGCAAGAGTGCGTTCAGACAGTTGGAAAGGTTTCAATT
AGTTTAGTCAAATCCACAACAGAAGTGCGACCTTCAGTTGCTTCTTCGAT
TTCTAATTTACAAGCAAAGACCCAAGAATTGCATAAAAGAATAGATGATG
TTATTCAGTTATTAATTAGCAGTAATGTTGGAACTCAAGCATGCACTCAA
GCAATAAAAATCTTGAAAGAAATTAACAGCGACATTGACACTTCCATTTT
ATTTGTTAAGTCAGCAGACATTCAAAACGATGATAGAGAATATTATTCCG
TTAAAGAACTATTTAAAAAATCTCGTAATAGTGTGATAGATAATTCAAGT
GAGCTTGTACGAAACATAAAATTGATTGTGTCGAAAGACGTTTGCGATGT
GAATATTCTTCAAGAAAGTGCTGATCAAATCGCAATAACATCTCAAAGTT
TGGCGAACGATGTCAAAGTAGGTTTGGAGCATTTAAATAGCTCCACTTCA
CAATATAACATTGAGCTGTTAGTCTCTTTTCAAGAAGTCATTGTTTCTCT
CATTAGTTTTCTTGAAGTTGCTAGAAACACCAGTGGGCTTCCTTATACTG
ATCCACTATTTCAAAACCTAAAAGAAGAGGGAAAGTGTTCTATTAATGCA
ATTACAAGTCTGTTAAAAGTTTTGAAATCAATGGACGATGTGAATTTGAA
AGATTTCCAAGCAATTGATAACGCAATCATTGAGTTGGAACATAATCATG
AATGTTTATTGGAGCTAGAAAACGGCATATCTCGAGAAGCGTCACCAGTA
GAAAGTCCGACCTCTACAAATCGCCTATCTATTGGGTCTGATATTACAGT
CAGTCCAAGATTTGCACCAGAAGAAATTAATAGATTGATTCCTTCATTGG
CTAATGTATGTGATAAAATTTTAGAAATTTCATCTCCAGAATTCAAACCA
ATTATTCGCCAAGAAAATATTTCAGTAGTTTCTATCTCTTGTAGCAAAGT
TAACAACGAATTAACAAGTGCATGCAAAAATCTTTTGCGAAATGGCCCAG
TTACAGATTCAAAAAAGCAAACTCTAAACACCGTTGATCAATTAGTCGAG
AATTATACTGAATTGTTGAAGAATTTCAAATTGTATTTAACAAATCCAAC
TAAAGAAACTAGGATTCCAGTGGAAACAGTTGTTTCTAAATTGAATGAAT
TAATCAAACTTCTACGGGATCAGGTCAATTTATTGCGGGAAGGTCCAAGA
TTGGTGATGTACTTTAGACCAAGCAGTCCGGAATGGCGAGATGTCTCAGA
AAAATATATTGGGCGACACGTGGCTTATCATCATTGTTTCGTTAAATCTT
ATAATCATGATTCTCACACTTCTTTGCATCACCATCAAGCTCCATTTATA
CAGCTTCCGATTAATACACGAGATCCGTCGGAGGTAGATCTTGATACCGC
TAAAAATCAAATCAAATTTGTGACCACCAAACTAATAGATATTAAATTAA
ATCCAGATTTAATCGGAAAAGATAAGTGCTCAGTTGCAGAAGTTGATCAA
ATGCTTTCGTACATAAAAGATATCGGTTGGTCTACTGAAGAACTCCTTTC
GTCTAGTCAAGAAATTTGCAAATCCAATTCTGACACCGATAATGAAATTT
GGAACATTGATTTTAAAAAAGAAATTTTTAAATCTGCGATTGGCGTCTCA
AACGCTATGAAAGATTTATGTGAAGCAGCTAGTAAACCACTTTCAACTGG
TTGCAGTCCGACTTGGGGGGATAGAATGTCCACATCTACTAGAAAAGTTG
CCAACAGTACTGGCCAACTTTTACTAAATTTGAAACCGACAGTAATTCAA
AATAAATCTCAAATTGAAAAAATTCATACCCATGGGAATCAAATTAAAAA
GAATACCGATTTACTCTTGAATCATCTGAATTGCATAAATGATCGGAAAT
GGGGAGAGGCTTCGTTGAATGCTAGTACTACTACTAATAATAATAATAAT
CATAATAATACCAATTGCGATCACCTGTTTTCTATAATGATCACCATTGT
CATTTGTTTTGCTCTCCGGTTTGATCTGTTGTCAACCTTCCGATCTGAAC
ATATCATTATTCCCACAACCGATTAGTGGTCCATGCCTCTACTAGTGCTT
ATAACAAGCTTCTTTGTCGAGATTTCTCATTACCATTCCTTGCTCAAGTG
GCTGTTATTATTATTTCATAAATCATCGGATCAAGGTTCAAAATTAATTT
CGATTATCAAAAGTTTTGAAATGCAATCCAATCATCTATATAATTGGCTC
AACGATCTCACAAATGACAACGACGATCAAGTTGAATCTGTTTCATTAAA
AGTAGATGTAGCTATCCAAACTGATTCTATTAAACACTGTAAGTGTCATT
GTCGACGAAGAGTACGCAGTCGTTTACAGGTTCACGAGACGAATCTCCTT
CAGAAAAGTCTCTCATCTTGTAAATATCCACGAAAAGAAAAAGACGATAA
TTTGAAAAAGCATGTAAAATTCGACAGCAGTATTTACACTCAAATGCTAG
ACAATGTTGTTGACAAATACAATCGGGATGTTCTGATTCAGCAGGCGGAA
ATTATCAATTCCTCTTTTCCTAAAAGCTTGAGCTTTTCCGAGAATCTAAC
CCAAATCGAACCGGATAAAGAGGATGTTGATGAAAGTAACATTGACAAAG
TTACAAAACCAGAAACCAACTCTGACAGTGGATCATCCCCAAGGAAAATC
ATTCGAAGCAAAAGTGATACAAAAATCTTATCGATTTGGTGGTCACATAT
AGCAAAATATAAGAAAGATTTGACGTTCAAGGATAATTCAGTTACTTCTC
GACCGAGATTATCATCAAATATTTCACGGGTCAGTTCTCATGGACGCAGG
AGTTTGCTGTTCTTTGGTCCCAATCAACCGGTACTGACTTCGAATTCTAA
TCCTTTGAAAACTGTTGCTATGGAGGACTCGAAAGATTTGAAAACTGGGA
GTCCAACAAATTCAGGCAAATCTCCATCATTCAATACTGGTGTTCATATC
CGTGCTGAAAATAAGAGGGTGAGTGATACCAGGAGGTGGTCATTGGCATC
TCTGCCGTCCTCTGGATACGGAACATTGACTCCTACAAGCAGTAATTTAT
CAAGCCAATATTCATCAAAAGAAAACCTTATTCACCATAAACACCACAGC
TCTCACCAGCCGCGATCACCATTGTGTATAGGTAATAATAATACCAGTCA
ATCTTCGCCTTTCCATTCATCTGGACTTGTCACATCAATTACACAATCTT
CAATCCGTACCGCCAACGTTGCCATCACTGGCAAATGCATCAGCGGCCGT
AATAGCAGGAACCATAGTCCTAATGACAAAATTTCCACCATTGGTGAATC
TCACCGAACTCCGACGGATTCAACTTCTGACGCCCAATTCGCTTCTAAAA
CCTTGCCAATTACCATTAAACCGAGATCACAAAGTTTGAATCCGTGTCGG
TCTCCTGGAGCCTATGAGCAAGACATATTCATTCTGAACCACGTGTACAA
GGAACGGTTCCCAAAAGCAACCATACAAATGATGGAAAGGCTCAGTGCAA
TGCTCGAGGAATTAGAAAATGAGAATACCGTATCCTGGGAGCCGATTAGT
CGGCTGGTGCACACACAAATCATGAAGCATGTCAAGGACATACTGAATAT
GACAAATCTTGAGGCAATCACATCGACATATTTCTTTGAATTGACCCAGA
ATCTAGAGAAATTACTGAAGGAGACCCGGCTGAAATGTCCCGAATCTCTG
GCACGCGTGCGCCCGATTGTCCAACACCTGCTGTTTATAATTGCCAGGCC
CGCCCGTCTATTAGAATGCATTGAATTTGATCCCAAGGAATTCTACAAGC
TATTGGAGGTGGCAGAGAACAATTTGCGGAATGTCCAGACCGACGTGCCA
AAATATATCATTTCCAAATTGGGATTGGACAAGGATCCTTACGATATCGG
ATCGGAGGAGCTCAATACTTCACTGGAATTGAACGGCGGCTCGCTGGAGA
TCACCGGTTGTGGTGGCGGCAGGTCACGGGAACGCACAGAGTCAGGATGC
GAATTGAACATGTCACAGGAGAGCAATAATTCTCTCGAATTGAGTTTCTC
CAAGTCGATGACTCCTAAGGAATCAGATTTCGAGGATATCAAATTGATTT
CCAACGGTGCCTATGGAGCGGTTCATCTCGTCAGGGAAAAGAAAACCAAA
AAGCGATTCGCCATGAAAAAGATCCGGAAAGACAACTTGCTGCTGAGGAA
TCAAGTGGAACAGATATTTGCCGAGAGAGACATCATGACATTTGCCGACA
GCCCGTTTGTAGTCGGGCTCTACTGCACGTTCGAGACTAGAAAGTACCTG
TGCATGATAATGGAGTACGTGGAGGGGGGAGACGTCGCGACCCTCATCAA
GAGCATTGGCCCGTTACCGGATGAACTGGCCCGCATGTATTTTGCTGAGA
CTGTGCTAGCACTGGAATACCTCCACAATTTCGGCATCGTCCATCGCGAT
TTGAAGCCAGACAACCTGCTGATCACGCTGGAAGGCCACATTAAATTGAC
CGATTTCGGACTGTCCAAGGTAGGCCTGATGAACCTGACCACGACTCTAT
TGGAATCCGTGCTCAATAAGGACTGTACGATGTTCCAGGACAAGCAGGTG
TTCGGCACTCCGGATTACATTGCTCCCGAGGTGATTTTGCGCCAGGGATA
CGATAAAATGATCGACTGGTGGGCAATGGGAATCATTTTGTATGAGTTCA
TTGTTGGCTGCACTCCATTTTATGGCGACTCAACTGAGGAATTGTTCGGC
AACATCATCAGCGGTGAGATCGAGTGGCCGCAAGATCCGGATCCGTGCGT
GCCAGACAATGCAGTGAATCTGATCACTGAGCTACTGAAGCGGGATCCGT
TGGTGCGTCTCGGTGCTGAGGGAACTCACGAGGTCAAGGAGCACGAATTC
TTCTCCGATGTCGATTGGCAGGGCTTATTGCGCCAGAAAGCTCTGTTTAT
CCCGGTTCTAGATCACGAGGACGACACCAGCTATTTTGATCCGAGGACCA
GTCGATACCAGCACGAGTCGGAGTCCGATGATCCGGATCCGGGATCAGGA
TTAGGATCAGCAGCGGCAGCAGCAGCCAATGACGAGACAATTGAGCATTG
CGAGTCCAATGACGATAACAATTATTACAGCCAGGATAACAACGGCACCG
TGTTCCATGCGTTCCCTTCGTGTTCTCCTCGGTTCAGCCGGTTCGTTGAG
ACCGAGCTCTGTCGGATGAGTGAATCAAGCTCTCTCGTGTTTCCGCAGGA
CTCAGAGGATGCCGGCAAGATGGCGAGGAGCGTCAGTGCAGCGCCGAGCT
TGCTGTCGAGTGAGTCAAGCAGCAGTTGCGGCGGTGCCGGTGGTGACGAT
CCGATCAAGTCTCATGGATCAGCAGCAGTGACCATTCGGACCGGGGGTAA
CAGCAGCACCAGCAGTAGCAGCCTGGAATTGAGTGCTCATGGCAGCTTGG
CACATCACTCGAGTGACGCAAGCAGCGAGACAGAGTTGCCATCGGTGATT
GGCGGCGGCGGTGGCAACAATTGGCGTGATGTTGGCAACCAGACAAATGC
TGTTGCTATGGCCGATATTGCCGTTGCTAGGGAGCGATGTGACTCCTCTC
CAGTTGCTATGTCGGTTGCCAGTAGTGGGGCAGGAGGGGCAGGAGGAGGA
GCAGGCTGCCATTCCACATTGCGAGCATTGAAACCGATCAGAGATCCAAT
ATCAGCAGTTTCCCCACTGGCCCGTGTCGACAGCACCGCAACCAATCCAG
CAGCAGCAGTAGCAGCAGCAAATGTGGCCCGCTCAGCATCCACTCACCAG
CTGACTCCTCCTCCGGCACCGGCAGGATCCCATCGGCGGTCCAGCGCTCC
CCGTGCCCAATCCCCGCTCGGTGCCAGCGGTGCGAGCGGTGCCAGCGGTG
GGACACAGGAACCGCAACCGCCGCCTGCCATTGTCATTCACAGGAGGTCT
CGCAATTTCGGATTTGTCATTCGGGCTATCCGAGTATTCTATGGCGAGAG
CAACGTGTACACGCTGCACCACTTGATAGTTGGTGTGGATCCCGAGGGCA
GCGCATTCCAGGCCGGGCTGAGGGAGGGCGACTTGATCACTCACATCAAT
GGCGTATCGATTGTCGGTGCTTATCACACGGAGGTCGTCTCGATGATCAT
TCAGTCGGGTGCCAGCATCAGTTTACGCGTCATTCCAATAAACAAAAGCT
TCATCCGAACGGATGGCCCGTGGCGTCCTGCAGGCAAGATGGCTACCAAG
CACCATCCGAGGAAAGCGCAACATTTGAGGGCGGGAAAGAAATGCTGCAC
CGGTCACCAGAAACCGTTGAAAGCTATTGGCCAAGTTCCCCCAGTTCCTC
CGCACAGACAGCAGCACCAAGTGAAACAGCATTTATCAGGTGGCGGTGCG
ACATATTTCGGATACAGTTCCCCGAGCGGGTCGGCACCGCAAATCATTCG
CAGGTCGACAGAGAAACCGCTGATCAGGCAACTGAGTGAGAAACAGCAGC
ACCGAATGCAGCAGTCCAATCAAGCAGGGGGACCCCGACAGCCAGTTGCC
GACACCGGCAGCACCGGACTCATCACTAGGACTCGCCATCAGCACCATAG
CAACAGCAATTCCTCCTCTCCATCACCGGTTGCATCCAGCAGTTACAGTT
GCCATCAGCAACAGCAGCCCCCGTCCGGTGGCACTGCAAGGAGATGATTA
TTATTGTCGTTGTTTTTGTTGTCCTGTAATATATATTGATTGATTGATTT
ATGTGAATCATTCTGCTGTTGCTATGGAGATTTATCCCTATTATTGTTAC
TCGCTCACAGAGAAAGTGAGATATATTGATTTGATTCGTTTAGTCTTTCA
GTTGCGCCAGTTTATTGATTGATTGATTTTACTATCTGATTATCACCATG
TGTGACTATTATTGATTATTATTATTGATTATTATCAGTGATTACCGCTA
TTATTGACTTTCTCTTTAATTTCTGTCTCATTGCCATGCATACCACCAAC
ATTATCGATTGATTGCTAGCCAATCACCAATAGCAACGGTGGCGAATAAT
TGCTGTACAAATGCCAATTTTGTCTGTGTAAATATATATCGGTATTGGTT
ACCGCGCAGAGGCAAACTATCATTGCCCGAACTATCATTGGACACCACGG
GTCACCTTGCCAACGGTATCGATGCGATGTAAATAATGCCAATTTTGTCT
GTGTCTAATATTTTATTATTATTATCAATAATATAATCATTCGATTGTTG
TCAAATATATCGATCTGCCGAGAAAAAAAA
back to top

protein sequence of SMED30018086-orf-1

>SMED30018086-orf-1 ID=SMED30018086-orf-1|Name=SMED30018086-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1555bp
MPLLVLITSFFVEISHYHSLLKWLLLLFHKSSDQGSKLISIIKSFEMQSN
HLYNWLNDLTNDNDDQVESVSLKVDVAIQTDSIKHCKCHCRRRVRSRLQV
HETNLLQKSLSSCKYPRKEKDDNLKKHVKFDSSIYTQMLDNVVDKYNRDV
LIQQAEIINSSFPKSLSFSENLTQIEPDKEDVDESNIDKVTKPETNSDSG
SSPRKIIRSKSDTKILSIWWSHIAKYKKDLTFKDNSVTSRPRLSSNISRV
SSHGRRSLLFFGPNQPVLTSNSNPLKTVAMEDSKDLKTGSPTNSGKSPSF
NTGVHIRAENKRVSDTRRWSLASLPSSGYGTLTPTSSNLSSQYSSKENLI
HHKHHSSHQPRSPLCIGNNNTSQSSPFHSSGLVTSITQSSIRTANVAITG
KCISGRNSRNHSPNDKISTIGESHRTPTDSTSDAQFASKTLPITIKPRSQ
SLNPCRSPGAYEQDIFILNHVYKERFPKATIQMMERLSAMLEELENENTV
SWEPISRLVHTQIMKHVKDILNMTNLEAITSTYFFELTQNLEKLLKETRL
KCPESLARVRPIVQHLLFIIARPARLLECIEFDPKEFYKLLEVAENNLRN
VQTDVPKYIISKLGLDKDPYDIGSEELNTSLELNGGSLEITGCGGGRSRE
RTESGCELNMSQESNNSLELSFSKSMTPKESDFEDIKLISNGAYGAVHLV
REKKTKKRFAMKKIRKDNLLLRNQVEQIFAERDIMTFADSPFVVGLYCTF
ETRKYLCMIMEYVEGGDVATLIKSIGPLPDELARMYFAETVLALEYLHNF
GIVHRDLKPDNLLITLEGHIKLTDFGLSKVGLMNLTTTLLESVLNKDCTM
FQDKQVFGTPDYIAPEVILRQGYDKMIDWWAMGIILYEFIVGCTPFYGDS
TEELFGNIISGEIEWPQDPDPCVPDNAVNLITELLKRDPLVRLGAEGTHE
VKEHEFFSDVDWQGLLRQKALFIPVLDHEDDTSYFDPRTSRYQHESESDD
PDPGSGLGSAAAAAANDETIEHCESNDDNNYYSQDNNGTVFHAFPSCSPR
FSRFVETELCRMSESSSLVFPQDSEDAGKMARSVSAAPSLLSSESSSSCG
GAGGDDPIKSHGSAAVTIRTGGNSSTSSSSLELSAHGSLAHHSSDASSET
ELPSVIGGGGGNNWRDVGNQTNAVAMADIAVARERCDSSPVAMSVASSGA
GGAGGGAGCHSTLRALKPIRDPISAVSPLARVDSTATNPAAAVAAANVAR
SASTHQLTPPPAPAGSHRRSSAPRAQSPLGASGASGASGGTQEPQPPPAI
VIHRRSRNFGFVIRAIRVFYGESNVYTLHHLIVGVDPEGSAFQAGLREGD
LITHINGVSIVGAYHTEVVSMIIQSGASISLRVIPINKSFIRTDGPWRPA
GKMATKHHPRKAQHLRAGKKCCTGHQKPLKAIGQVPPVPPHRQQHQVKQH
LSGGGATYFGYSSPSGSAPQIIRRSTEKPLIRQLSEKQQHRMQQSNQAGG
PRQPVADTGSTGLITRTRHQHHSNSNSSSPSPVASSSYSCHQQQQPPSGG
TARR*
back to top

protein sequence of SMED30018086-orf-2

>SMED30018086-orf-2 ID=SMED30018086-orf-2|Name=SMED30018086-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2733bp
MLNSNGNFELRIHIVDADVTKIVPLDPEATIFQLCETIRKNIREAQTKSP
KSYGLYLPHDDLKKGLWLDNSKTLQHYILKRGDTIEYRNRSRWLHIRTMD
GTNKTLKVDDSWTVSELMLTVCTKLGIYNYDEYSLISDKMDFSPGIDKTL
SMKRGISINKDQEKLDKLKKKYHTEDGLNWLNPSQSLRQQGIEESEVLLL
KRKYFFSDMNVDSRDPIQLSLLYEQLKDAVINGTHPVTLPEAIELAGLQC
QVQLGNYSADKFKPGFLDLRECLPKEYQKNPKTVEKKIFNQHSKSKDLSE
VEAKEKYCLLCRSFKTYGITFFLVKEKVIGKNKLIPRLLGVNKESVVQVD
EKTKEIINTWPLTSIRKWAASFNGFTMDFGEYSPDEYYTAQTDKGERISQ
LIAGYIDIILKRKKAKDHLGVDADEESIMYEENIAPSKAIIVEHVPKQKR
SSVSEEDVVIRKKAHMANSSVRMNSQASDSVCSQDCTDFYQEDINMSRQT
SSLGRTQSPSSSLTTNSMHYRMSDDDIRQKLYIISLQDNLDTIQKYKDQL
MIENKGPEIGKDEASQQWIYVNIDNSRQRMADEIGAMNAAVAQVLRSAQG
LATIEESEEEEMNEEMIAKMQNSFSLITVHLPSLMEEIRTAAYYQDQLTD
EDVSGEELIAAAKRLADAFTNLIKAAYPVEDQKRSLNRKEIFDAANAVGE
ASSDLLQQITEQENCQIELKSERPYSIIMITEEDQLYQEELLRLAKSVAN
ETTNLIKQVKVIAVEAENPSDQKKVVMAATETGLAISQLISTTKIVAPTI
EQSVCQEQLIFSIEDVSKAIQVVVESSNKATQSEELQDLTVQAANQVQEA
LDTLMKHLRKDFDKNDKLDNFLLAYENIQEVDDSDDDLDKLVSAARRLAQ
ATTAMISEIQLKAVNEQYKTPEERDKLINAAKQLAEATTVLIDSAKNCTM
DKDEMNLRYTLREATERFIVVTYTTECATYIQEQVIDHLLVAARKAATTG
THLINTSLSAAKKSRASNFKVCNDGRELSNQISNLIVAIKEARRDPKDHL
AQLELIAACRDYIDPSEQLSQSNKYMWPTVSDPSLQTALNQSINQSVIAT
EELKKCVHQADLMCQHLDLSAALEQLKRLEQNLKSIKNSIERENLIPLPD
EKSDESAALLIKSVRRSGSAANQFKNDLESRCVVYEQTNGEDSYQNLENL
DVAGQKARELSMALDRLVHAARGVAASIEFENQESENNDKNLEKLAQLQI
VNNCLEAVKAARDLVIEAKSSPPDNDQMDRAQQASVRLSDALSLCLDSLP
GQRDLDMLSKHIESKKHQFAENRLPIQQNNNINLSNCRSELTDTTFDFNQ
AVNELVSAPSFNLVNKGCKKMRMSYDRIVEICNVLVHDPFDESDSALHHL
SSNRDHIANGVMIMSEDCQTLLDKVKKIQCEPDNIIVRKQLQEATKMLLD
SINRLLTNISTNLRPGQKECDKTIYRLESMRPILDNPVHPISHKDYFECL
DFIIDKTVQPLADSLKNIPAAVKDENNQKFIDSIYHCADSVCMLLEETAQ
TAYLVGVGDVRSKIGNKGLADHTSFLQIQKEISENCQTICNPDTTARQDS
SLMISTAGQIAENSRKLCEASKTIMISFPNDKIKLSDKTKITLLAVSELM
TGVQNLNQNFNEDNRKEVESLSGKVQDNVAELVQLLLSYKFAGDAAIISE
EAKESQGPIKAAGITVLDTAIEVIQCSKALISSEANEELFIAYSSSCKDL
NDALKHLISTIKESAPGQKECDEALAILAKLIKQAYDSKMKIMKHRSRTI
SRTFESEESYQNILQSALIQMPHCINELSRAGKKEPEQLARIFSRQTQLL
ESMVNSCICAANQTDLIQNSNIYLEHLITILEASEQLLKAVKKSGGNPKA
NSVHSQIDEMAQGVIESCEDLLAALDKISFKQGNVNTIVETITKSSAKVQ
ESAIIPEKSRFGNSQSKMLDICYDMNNLTTDISSNANSESTQRLLAPLTQ
NLTQRYDDLCRACQGAVATLSNENNGKQLQECVQTVGKVSISLVKSTTEV
RPSVASSISNLQAKTQELHKRIDDVIQLLISSNVGTQACTQAIKILKEIN
SDIDTSILFVKSADIQNDDREYYSVKELFKKSRNSVIDNSSELVRNIKLI
VSKDVCDVNILQESADQIAITSQSLANDVKVGLEHLNSSTSQYNIELLVS
FQEVIVSLISFLEVARNTSGLPYTDPLFQNLKEEGKCSINAITSLLKVLK
SMDDVNLKDFQAIDNAIIELEHNHECLLELENGISREASPVESPTSTNRL
SIGSDITVSPRFAPEEINRLIPSLANVCDKILEISSPEFKPIIRQENISV
VSISCSKVNNELTSACKNLLRNGPVTDSKKQTLNTVDQLVENYTELLKNF
KLYLTNPTKETRIPVETVVSKLNELIKLLRDQVNLLREGPRLVMYFRPSS
PEWRDVSEKYIGRHVAYHHCFVKSYNHDSHTSLHHHQAPFIQLPINTRDP
SEVDLDTAKNQIKFVTTKLIDIKLNPDLIGKDKCSVAEVDQMLSYIKDIG
WSTEELLSSSQEICKSNSDTDNEIWNIDFKKEIFKSAIGVSNAMKDLCEA
ASKPLSTGCSPTWGDRMSTSTRKVANSTGQLLLNLKPTVIQNKSQIEKIH
THGNQIKKNTDLLLNHLNCINDRKWGEASLNASTTTNNNNNHNNTNCDHL
FSIMITIVICFALRFDLLSTFRSEHIIIPTTD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002075pigment cell
PLANA:0003001lateral region of the whole animal
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0007016cytoskeletal anchoring at plasma membrane
GO:0007155cell adhesion
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0030276clathrin binding
GO:0005200structural constituent of cytoskeleton
GO:0003779actin binding
GO:0051015actin filament binding
GO:0005515protein binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0000287magnesium ion binding
Vocabulary: INTERPRO
TermDefinition
IPR030224Sla2_fam
IPR035964I/LWEQ_dom_sf
IPR036476Talin_cent_sf
IPR035963FERM_2
IPR036723Alpha-catenin/vinculin-like_sf
IPR019749Band_41_domain
IPR032425FERM_f0
IPR019748FERM_central
IPR018979FERM_N
IPR015224Talin_cent
IPR011993PH-like_dom_sf
IPR015009Vinculin-bd_dom
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR002558ILWEQ_dom
IPR000299FERM_domain
IPR006077Vinculin/catenin
IPR029071Ubiquitin-like_domsf
IPR0178964Fe4S_Fe-S-bd
IPR015155PFU
IPR001478PDZ
IPR000719Prot_kinase_dom
IPR015022MA_Ser/Thr_Kinase_dom
IPR023142MAST_pre-PK_dom
IPR008271Ser/Thr_kinase_AS
IPR000961AGC-kinase_C
IPR011009Kinase-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005925focal adhesion
GO:0001726ruffle
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 597..617
NoneNo IPR availableCOILSCoilCoilcoord: 1121..1148
NoneNo IPR availableCOILSCoilCoilcoord: 2381..2401
NoneNo IPR availableSMARTSM01244IRS_2coord: 319..413
e-value: 3.6E-9
score: 46.5
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 10..87
e-value: 1.6E-22
score: 81.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1769..1937
e-value: 2.1E-30
score: 108.1
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1113..1301
e-value: 2.5E-18
score: 68.7
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 1959..2084
e-value: 6.5E-13
score: 51.3
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 862..983
e-value: 1.7E-17
score: 65.5
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 984..1112
e-value: 6.9E-23
score: 83.1
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 88..209
e-value: 2.4E-38
score: 132.9
NoneNo IPR availableGENE3DG3DSA:1.20.1440.10coord: 736..861
e-value: 2.5E-30
score: 107.1
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1467..1768
e-value: 3.6E-73
score: 248.5
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 2085..2280
e-value: 1.9E-23
score: 85.2
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 526..711
e-value: 3.8E-27
score: 97.0
NoneNo IPR availableGENE3DG3DSA:1.20.1420.10coord: 1302..1464
e-value: 4.3E-12
score: 48.2
NoneNo IPR availableGENE3DG3DSA:1.20.120.230coord: 1567..1698
e-value: 3.6E-73
score: 248.5
NoneNo IPR availablePANTHERPTHR10407:SF19coord: 11..2274
NoneNo IPR availableCDDcd17089FERM_F0_TLNcoord: 12..93
e-value: 5.42479E-29
score: 110.04
NoneNo IPR availableCDDcd17090FERM_F1_TLNcoord: 94..206
e-value: 2.68452E-42
score: 149.025
NoneNo IPR availableCDDcd10569FERM_C_Talincoord: 320..412
e-value: 1.93476E-47
score: 162.896
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 320..411
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 90..324
e-value: 3.1E-49
score: 179.5
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 210..318
e-value: 1.9E-38
score: 133.1
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 98..195
e-value: 2.8E-12
score: 46.4
IPR032425Talin, N-terminal F0 domainPFAMPF16511FERM_f0coord: 11..90
e-value: 2.8E-24
score: 85.2
IPR015224Talin, centralPFAMPF09141Talin_middlecoord: 537..708
e-value: 6.1E-25
score: 88.1
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 215..324
e-value: 5.4E-23
score: 81.6
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 223..315
e-value: 6.84916E-23
score: 93.0798
IPR015009Vinculin-binding site-containing domainPFAMPF08913VBScoord: 1966..2078
e-value: 4.8E-7
score: 30.3
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 319..417
e-value: 1.6E-32
score: 113.8
IPR030224Sla2 familyPANTHERPTHR10407HUNTINGTIN INTERACTING PROTEIN 1coord: 11..2274
IPR000299FERM domainPROSITEPS50057FERM_3coord: 94..415
score: 50.882
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 828..957
IPR035964I/LWEQ domain superfamilySUPERFAMILYSSF109885I/LWEQ domaincoord: 734..856
IPR036476Talin, central domain superfamilySUPERFAMILYSSF109880A middle domain of Talin 1coord: 540..709
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 87..138
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 204..319
IPR036723Alpha-catenin/vinculin-like superfamilySUPERFAMILYSSF47220alpha-catenin/vinculin-likecoord: 1965..2071