Glycine receptor subunit alpha-3

Overview
NameGlycine receptor subunit alpha-3
Smed IDSMED30018078
Length (bp)1556
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine receptor subunit alpha-3 (SMED30018078) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30018078) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine receptor subunit alpha-3 (SMED30018078) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine receptor subunit alpha-3 (SMED30018078) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018078

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018078SMESG000041885.1 SmedASXL_013970SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018078SMESG000041885.1 dd_Smed_v4_11342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018078SMESG000041885.1 dd_Smed_v4_11342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30018078SMESG000041885.1 dd_Smed_v4_11342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30018078SMESG000041885.1 dd_Smed_v4_11342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018078SMESG000041885.1 dd_Smed_v6_11342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018078SMESG000041885.1 OX_Smed_1.0.16933ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30018078SMESG000041885.1 dd_Smed_v4_11342_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 259.996 bits (663), Expect = 1.965e-80
Identity = 151/440 (34.32%), Postives = 249/440 (56.59%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELAR--WCSACQRQQFFHLQEQNTLDR-NRLEFCSELESLLINHALDAHKGK---------KTIKTTPTE--------DSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         E++R    R     A   ++F+   + +   R +R  F     +  +   L A  G          + +  +P E           ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   37 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFT----AYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRH 456          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA3 (glycine receptor alpha 3 [Source:HGNC Symbol;Acc:HGNC:4328])

HSP 1 Score: 258.455 bits (659), Expect = 4.724e-80
Identity = 148/429 (34.50%), Postives = 243/429 (56.64%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLAR--------KKKSNGWEKDVREIVRHELARWCSAC-QRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R        ++K    + +VRE      A     C Q +     +  N   +   +   E+  + I+ A                   ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   37 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRA-----------------KKIDTISRACFPLAFLIFNIFYWVIYKILRH 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 254.603 bits (649), Expect = 1.481e-78
Identity = 145/404 (35.89%), Postives = 229/404 (56.68%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-------EDSD------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  SV+ T M+Y  +++LRQ+W D RL +    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG++LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  + P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K              E  R     +RQ     +E++    +R  F        + H L    G   +K TP        +D D            ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   72 NVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHK--------------EFLRLRRRQKRQN----KEEDVTRESRFNF----SGYGMGHCLQVKDG-TAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA2 (glycine receptor alpha 2 [Source:HGNC Symbol;Acc:HGNC:4327])

HSP 1 Score: 253.832 bits (647), Expect = 3.053e-78
Identity = 144/404 (35.64%), Postives = 229/404 (56.68%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-------EDSD------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  S++ T M+Y  +++LRQ+W D RL +    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG++LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  + P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K              E  R     +RQ     +E++    +R  F        + H L    G   +K TP        +D D            ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   72 NVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHK--------------EFLRLRRRQKRQN----KEEDVTRESRFNF----SGYGMGHCLQVKDG-TAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Match: GLRA1 (glycine receptor alpha 1 [Source:HGNC Symbol;Acc:HGNC:4326])

HSP 1 Score: 252.677 bits (644), Expect = 1.200e-77
Identity = 139/402 (34.58%), Postives = 231/402 (57.46%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDA--HKGKKTIKTT-----PTEDSD------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W+++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  R   +  +             +L +++     R  F +         A D    KG     TT     P++  +            ID  SR  FP  FL++N FYW+ Y ++
Sbjct:   66 NVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPM------------LNLFQEDEAGEGRFNFSAYGMGPACLQAKDGISVKGANNSNTTNPPPAPSKSPEEMRKLFIQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIV 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5968009:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 227.254 bits (578), Expect = 6.337e-69
Identity = 142/394 (36.04%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  280 VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSL----------KKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQ-VSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREI--VRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLV 1422
            V V + + +I+ +    MEYS     R+EWTD RL +E  EE     +  V P +           + +W+PD FF+N KE   H +  PN L+R+  NG+ILYS ++++  SC M+L+ +P+D Q CL+D+ SY YT  ++K+ W+++ PI    GL+ S  +   Q V T  CT  S T+TG+Y+CL+ + +L+R+   YL+  ++PS ++V+VSW++FW++ DSVPARVTLG+ TLL M TQ++GI++ LP VSY KAIDVW+  C+ F+ GALLE+ + +  ARK  +   ++ +R++  +  E  R  SA Q                R  FC  +                 ++        ID  SR +FP  +  +N  YW  YL+
Sbjct:   60 VTVNIYLRSISKIDDVNMEYSAQFTFREEWTDQRLAYERYEES---GDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQDVVTDYCT--SLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALVNYAARKDMTQVSQR-IRQMKQLPTEGYRPLSASQ---------------GRSSFCCRI----------------FVRRYKERSKRIDVVSRLVFPIGYACFNVLYWAVYLM 416          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-14 (pep chromosome:WBcel235:I:5967250:5973320:-1 gene:WBGene00000232.1 transcript:B0207.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-14)

HSP 1 Score: 227.254 bits (578), Expect = 6.337e-69
Identity = 142/394 (36.04%), Postives = 220/394 (55.84%), Query Frame = 1
Query:  280 VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSL----------KKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQ-VSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREI--VRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLV 1422
            V V + + +I+ +    MEYS     R+EWTD RL +E  EE     +  V P +           + +W+PD FF+N KE   H +  PN L+R+  NG+ILYS ++++  SC M+L+ +P+D Q CL+D+ SY YT  ++K+ W+++ PI    GL+ S  +   Q V T  CT  S T+TG+Y+CL+ + +L+R+   YL+  ++PS ++V+VSW++FW++ DSVPARVTLG+ TLL M TQ++GI++ LP VSY KAIDVW+  C+ F+ GALLE+ + +  ARK  +   ++ +R++  +  E  R  SA Q                R  FC  +                 ++        ID  SR +FP  +  +N  YW  YL+
Sbjct:   60 VTVNIYLRSISKIDDVNMEYSAQFTFREEWTDQRLAYERYEES---GDTEVPPFVVLATSENADQSQQIWMPDTFFQNEKEARRHLIDKPNVLIRIHKNGQILYSVRLSLVLSCPMSLEFYPLDRQNCLIDLASYAYTTQDIKYEWKEKKPIQQKDGLRQSLPSFELQDVVTDYCT--SLTNTGEYSCLRTRMVLRREFSYYLLQLYIPSFMLVIVSWVSFWLDKDSVPARVTLGVTTLLTMTTQSSGINAKLPPVSYTKAIDVWIGVCLAFIFGALLEFALVNYAARKDMTQVSQR-IRQMKQLPTEGYRPLSASQ---------------GRSSFCCRI----------------FVRRYKERSKRIDVVSRLVFPIGYACFNVLYWAVYLM 416          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502743:-1 gene:WBGene00000233.1 transcript:R11G10.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 223.787 bits (569), Expect = 8.332e-67
Identity = 147/417 (35.25%), Postives = 236/417 (56.59%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSE---IYQTNVLVYMKVL--AINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQIS--EFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNT---LDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD----IDSYSRFLFPACFLLYNCFYWLYY 1416
            I+E ++ +    +   P E   I+   V+V + +L  +I+ +    MEYS  +  R+ W D RL++    + +    + +  +  + +W+PD FF+N K+ Y H +  PN L+R+  +G ILYS +I++  SC M+LQ +PMD Q+C +D+ SY YT  ++++ W++E P+ +  GL  S   F   +  ST  CT  S T+TG Y+CL+    L+RQ   YL+  ++PS ++V+VSW++FWI+  +VPARVTLG+ TLL M TQ++GI++ LP V+YIKAIDVW+ AC+ F+  ALLE+   + +A K+ +N   +  RE              + +   LQ  +    + R   E   E+ ++ +N     +   K IKT  TE +D     D  SR +FP  FL +N  YW +Y
Sbjct:   75 ILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLTFRESWVDKRLSFGVKGDAQP---DFLILTAGQEIWMPDSFFQNEKQAYKHMIDKPNVLIRVHKDGTILYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQLTN-TSTTYCT--SKTNTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANKQDANKRARTERE--------------KAELPFLQNSHNDVWVPREVAEQEREVMTVRMNRR-QTNSVWKWIKTK-TEWNDKSKRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502582:-1 gene:WBGene00000233.1 transcript:R11G10.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 223.787 bits (569), Expect = 8.332e-67
Identity = 147/417 (35.25%), Postives = 236/417 (56.59%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSE---IYQTNVLVYMKVL--AINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQIS--EFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNT---LDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD----IDSYSRFLFPACFLLYNCFYWLYY 1416
            I+E ++ +    +   P E   I+   V+V + +L  +I+ +    MEYS  +  R+ W D RL++    + +    + +  +  + +W+PD FF+N K+ Y H +  PN L+R+  +G ILYS +I++  SC M+LQ +PMD Q+C +D+ SY YT  ++++ W++E P+ +  GL  S   F   +  ST  CT  S T+TG Y+CL+    L+RQ   YL+  ++PS ++V+VSW++FWI+  +VPARVTLG+ TLL M TQ++GI++ LP V+YIKAIDVW+ AC+ F+  ALLE+   + +A K+ +N   +  RE              + +   LQ  +    + R   E   E+ ++ +N     +   K IKT  TE +D     D  SR +FP  FL +N  YW +Y
Sbjct:   75 ILEHLLTRGYDHRVRPPGEDGTIHGGPVVVSVNMLLRSISKIDNVNMEYSVQLTFRESWVDKRLSFGVKGDAQP---DFLILTAGQEIWMPDSFFQNEKQAYKHMIDKPNVLIRVHKDGTILYSVRISLVLSCPMHLQYYPMDVQQCFIDLASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQLTN-TSTTYCT--SKTNTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANKQDANKRARTERE--------------KAELPFLQNSHNDVWVPREVAEQEREVMTVRMNRR-QTNSVWKWIKTK-TEWNDKSKRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Match: glc-2 (Glutamate-gated chloride channel subunit beta [Source:UniProtKB/Swiss-Prot;Acc:Q17328])

HSP 1 Score: 221.861 bits (564), Expect = 1.320e-66
Identity = 134/392 (34.18%), Postives = 212/392 (54.08%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGL--QISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSE--LESLLINHALDAH-----KGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            NV V + +  ++ + V  MEYS  +  R++W DPRL +ENL  F +    +  P +KK LW+PD FF   K  + H + + N  +R+ P+G+ILYS +I++  SC M LQ +P+D Q C  D+ SY +T++++ + W    P+ +  G+   +  F   +  +  DCT  S T+TG Y CL+ + L +RQ   YLV  + P+ +IV+VSW++FWI++ S   RV LG+ TLL M T  + I++ LP VSY+K +DVW+ AC  FV GALLEY   S          ++  VR+   ++ +R  +A + Q+           R +LE       +     H  +A      K ++         + ID Y+RF+ P  FL +N  YW+  L++
Sbjct:   58 NVRVNIMIRMLSKIDVVNMEYSIQLTFREQWIDPRLAYENLG-FYNPPAFLTVPHVKKSLWIPDTFFPTEKAAHRHLIDMENMFLRIYPDGKILYSSRISLTSSCPMRLQLYPLDYQSCNFDLVSYAHTMNDIMYEWDPSTPVQLKPGVGSDLPNFILKNYTTNADCT--SHTNTGSYGCLRMQLLFKRQFSYYLVQLYAPTTMIVIVSWVSFWIDLHSTAGRVALGVTTLLTMTTMQSAINAKLPPVSYVKVVDVWLGACQTFVFGALLEYAFVS----------YQDSVRQ---NDRSREKAARKAQR----------RREKLEMVDAEVYQPPCTCHTFEARETFRDKVRRYFTKPDYLPAKIDFYARFVVPLAFLAFNVIYWVSCLIM 423          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335420)

HSP 1 Score: 239.195 bits (609), Expect = 6.336e-73
Identity = 144/413 (34.87%), Postives = 228/413 (55.21%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSEI-----YQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKT----TPTEDSDIDSYSRFLFPACFLLYNCFYWLYYL 1419
            ++++I+   +Y    RPS I       TNV V M + +I+ +   KMEYS  +  R++WTD RL +++++    +    ++ +    +W+PDLFF N KEG+ H + +PN  +R+ PNG +LYS +I++  +C MNL+ +P+D Q C + + SYG+T ++L F W++ DP+ +   L +  F +  +  T  C  +S T+TG+Y+CLK   L +R+   YL+  ++P  ++V+VSW++FW++  +VPARV+LG+ TLL M TQ +GI+++LP VSY KAIDVW   C+ FV GALLE+ + +  +R        K  R  +        S               L R+  +  +  + L     + A K     KT     PT    ID  SR  FP  F L+N  YW  YL
Sbjct:   36 VLDQILGAGKYDARIRPSGINGTDNKATNVSVNMFLRSISKIDDYKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYL 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335419)

HSP 1 Score: 238.424 bits (607), Expect = 1.165e-72
Identity = 143/412 (34.71%), Postives = 229/412 (55.58%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSEIYQTN----VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKT----TPTEDSDIDSYSRFLFPACFLLYNCFYWLYYL 1419
            ++++I+   +Y    RPS I  T+    V + + V +I ++S  KMEYS  +  R++WTD RL +++++    +    ++ +    +W+PDLFF N KEG+ H + +PN  +R+ PNG +LYS +I++  +C MNL+ +P+D Q C + + SYG+T ++L F W++ DP+ +   L +  F +  +  T  C  +S T+TG+Y+CLK   L +R+   YL+  ++P  ++V+VSW++FW++  +VPARV+LG+ TLL M TQ +GI+++LP VSY KAIDVW   C+ FV GALLE+ + +  +R        K  R  +        S               L R+  +  +  + L     + A K     KT     PT    ID  SR  FP  F L+N  YW  YL
Sbjct:   36 VLDQILGAGKYDARIRPSGINGTDGPAIVRINLFVRSIMTISDIKMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYL 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343788)

HSP 1 Score: 236.884 bits (603), Expect = 5.663e-72
Identity = 148/428 (34.58%), Postives = 241/428 (56.31%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSEIYQTN----VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLAR--KKKSNGWEKDVREIVRH-ELARWCSA------------CQRQQFFH-LQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKT----TPTEDSDIDSYSRFLFPACFLLYNCFYWLYYL 1419
            ++++I+   +Y    RPS I  T+    V V + V +I+ +    MEYS  +  R++WTD RL +++++    +    ++ +    +W+PDLFF N KEG+ H + +PN  +R+ PNG +LYS +I++  +C MNL+ +P+D Q C + + SYG+T ++L F W++ DP+ +   L +  F +  +  T  C  +S T+TG+Y+CLK   L +R+   YL+  ++P  ++V+VSW++FW++  +VPARV+LG+ TLL M TQ +GI+++LP VSY KAIDVW   C+ FV GALLE+ + +  +R    K+N  ++++++  R  E A   +A                QF     +Q  L R+  +  +  + L     + A K     KT     PT    ID  SR  FP  F L+N  YW  YL
Sbjct:   36 VLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMASQFARGGGQQKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYL 456          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335416)

HSP 1 Score: 235.728 bits (600), Expect = 1.020e-71
Identity = 142/412 (34.47%), Postives = 227/412 (55.10%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSEIYQTN----VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKT----TPTEDSDIDSYSRFLFPACFLLYNCFYWLYYL 1419
            ++++I+   +Y    RPS I  T+    V V + V +I+ +    MEYS  +  R++WTD RL +++++    +    ++ +    +W+PDLFF N KEG+ H + +PN  +R+ PNG +LYS +I++  +C MNL+ +P+D Q C + + SYG+T ++L F W++ DP+ +   L +  F +  +  T  C  +S T+TG+Y+CLK   L +R+   YL+  ++P  ++V+VSW++FW++  +VPARV+LG+ TLL M TQ +GI+++LP VSY KAIDVW   C+ FV GALLE+ + +  +R        K  R  +        S               L R+  +  +  + L     + A K     KT     PT    ID  SR  FP  F L+N  YW  YL
Sbjct:   36 VLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRSKRIDVISRITFPLVFALFNLVYWSTYL 440          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0343789)

HSP 1 Score: 234.572 bits (597), Expect = 3.980e-71
Identity = 144/421 (34.20%), Postives = 234/421 (55.58%), Query Frame = 1
Query:  208 IMERIVDKKRYKKDERPSEIYQTN----VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNT-----LDRNRLEFCSELESLLINHALDAHKGKKTIKT----TPTEDSD----IDSYSRFLFPACFLLYNCFYWLYYL 1419
            ++++I+   +Y    RPS I  T+    V V + V +I+ +    MEYS  +  R++WTD RL +++++    +    ++ +    +W+PDLFF N KEG+ H + +PN  +R+ PNG +LYS +I++  +C MNL+ +P+D Q C + + SYG+T ++L F W++ DP+ +   L +  F +  +  T  C  +S T+TG+Y+CLK   L +R+   YL+  ++P  ++V+VSW++FW++  +VPARV+LG+ TLL M TQ +GI+++LP VSY KAIDVW   C+ FV GALLE+ + +  +R  ++    K+  +  R +L +  S              T     L R+  +  +  + L     + A K     KT     PT        ID  SR  FP  F L+N  YW  YL
Sbjct:   36 VLDQILGAGKYDARIRPSGINGTDGPAVVRVNIFVRSISKIDDVTMEYSVQLTFREQWTDERLKFDDIQGRLKY----LTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRF-TLEKFLTDYC--NSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSDRAADMHKENMKKKRRDLEQ-ASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYWSTYL 448          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 260.766 bits (665), Expect = 5.518e-81
Identity = 148/421 (35.15%), Postives = 237/421 (56.29%), Query Frame = 1
Query:  217 RIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD------------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            + +D +  K D    +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E    D  R  F +         A D    K      PT  +                   ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   57 KALDPQGSKSDGTHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRRR-HLKEDEAGD-GRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 451          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 259.61 bits (662), Expect = 1.278e-80
Identity = 148/418 (35.41%), Postives = 235/418 (56.22%), Query Frame = 1
Query:  226 DKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD------------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            D +  K D    +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E    D  R  F +         A D    K      PT  +                   ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   58 DPQGSKSDGTHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRRR-HLKEDEAGD-GRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 258.84 bits (660), Expect = 2.378e-80
Identity = 145/402 (36.07%), Postives = 230/402 (57.21%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD------------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
             NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E    D  R  F +         A D    K      PT  +                   ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   61 VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCT--KHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRRR-HLKEDEAGD-GRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 436          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 258.455 bits (659), Expect = 3.822e-80
Identity = 152/451 (33.70%), Postives = 245/451 (54.32%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKS----------NGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAH--KGKKTIKTTPTEDS-------------------DIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+++ P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K           +G E++VRE                             +RL F         N   D    K      TTP+E +                    ID+ SR  FP  FL +N FYW+ Y +L H
Sbjct:   37 RAAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEKGPVQVADGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSGKEEEVRE-----------------------------SRLSFTP-------NAGKDGAVPKTANNAATTPSEPAVAPGKSHEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKILRH 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 258.07 bits (658), Expect = 4.271e-80
Identity = 144/399 (36.09%), Postives = 235/399 (58.90%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEF-------CSELESLLINHALDAHKGKKTIKTTPTEDSD-------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  SV+ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  + P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R++K         E +R +        +RQ+    Q++  L   RL F       C +  +++ N  ++  +    +K T T           ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   70 NVTCNIFINSFGSVTETTMDYRVNIFLRQKWNDPRLAYSEYPD----SSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDKGPVQVADGLTLPQFLIRDEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQK---------EFLRLK--------RRQR--RTQKEEDLQDGRLHFSSYNTTTCVKDGAVVKNTQVNQIQQPSILKNTETNRKKFVDRAKRIDTISRAAFPLAFLIFNVFYWITYKIIRH 443          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 256.529 bits (654), Expect = 1.598e-79
Identity = 149/433 (34.41%), Postives = 244/433 (56.35%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R SPM+   D + + +     Y    RP+ +    NV   + V +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W++  P+ I+ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K              EL R+    ++ +   ++E      +R  F +      +  A D    K  +   P   +              ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   20 RPSPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK--------------ELLRFRRKRKKDRDDDVRE------SRFSFTAYGMGPCL-QAKDGVNPKGPLNAPPAPKTHEEMRKVFIDRAKKIDTLSRACFPLAFLIFNIFYWVIYKILRH 424          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: GLRA3 (glycine receptor alpha 3 [Source:NCBI gene;Acc:100488938])

HSP 1 Score: 256.144 bits (653), Expect = 2.791e-79
Identity = 149/433 (34.41%), Postives = 244/433 (56.35%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R SPM+   D + + +     Y    RP+ +    NV   + V +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W++  P+ I+ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K              EL R+    ++ +   ++E      +R  F +      +  A D    K  +   P   +              ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   32 RPSPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFVNSFGSIAETTMDYRLNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQENGPVQIADGLTLPQFVLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK--------------ELLRFRRKRKKDRDDDVRE------SRFSFTAYGMGPCL-QAKDGVNPKGPLNAPPAPKTHEEMRKVFIDRAKKIDTLSRACFPLAFLIFNIFYWVIYKILRH 436          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 255.373 bits (651), Expect = 4.192e-79
Identity = 143/420 (34.05%), Postives = 238/420 (56.67%), Query Frame = 1
Query:  178 KSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            KSP     D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ W DPRL++    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W    P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  ++    E         R+  F+          +++  + +++          K   +IK    + +  ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   14 KSPPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKE-----EDVARESRFNFSGYGMGHCLQVKDGTAVKATPPIPPPPQPKDADSIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 422          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 256.144 bits (653), Expect = 4.388e-79
Identity = 144/420 (34.29%), Postives = 238/420 (56.67%), Query Frame = 1
Query:  178 KSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            KSP     D + + +     Y    RP+ +    NV   + + +  SV+ T M+Y  +++LRQ W DPRL++    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W    P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  ++    E         R+  F+          +++  + +++          K   +IK    + +  ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   36 KSPPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKE-----EDVARESRFNFSGYGMGHCLQVKDGTAVKATPPIPPPPQPKDADSIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Match: tal1 (T-cell acute lymphocytic leukemia 1 [Source:Xenbase;Acc:XB-GENE-479827])

HSP 1 Score: 254.988 bits (650), Expect = 5.092e-79
Identity = 143/420 (34.05%), Postives = 238/420 (56.67%), Query Frame = 1
Query:  178 KSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            KSP     D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ W DPRL++    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W    P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  ++    E         R+  F+          +++  + +++          K   +IK    + +  ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   16 KSPPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQTWNDPRLSYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWLSTSPVQVADGLTLPQFILKEENELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQSKE-----EDVARESRFNFSGYGMGHCLQVKDGTAVKATPPIPPPPQPKDADSIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 424          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra3 (glycine receptor, alpha 3 subunit [Source:MGI Symbol;Acc:MGI:95749])

HSP 1 Score: 261.151 bits (666), Expect = 7.729e-81
Identity = 150/436 (34.40%), Postives = 250/436 (57.34%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARW--CSACQRQQFFHLQE-QNTLDRNRLEF-------CSELESLLI----NHALDA--HKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         E++R    R     A   ++F+   +  + +  +R  F       C + +  ++    NHA+        +  K        ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   53 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRH 472          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra2 (glycine receptor, alpha 2 subunit [Source:MGI Symbol;Acc:MGI:95748])

HSP 1 Score: 254.603 bits (649), Expect = 1.061e-78
Identity = 137/386 (35.49%), Postives = 227/386 (58.81%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  SV+ T M+Y  +++LRQ+W D RL +    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG++LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  + P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  ++    E         R+  F+          +++  + +++   N      K    IK    + +  ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   72 NVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFLRLRRRQKRQNKE-----EDVTRESRFNFSGYGMGHCLQMKDGTAVKATPANPLPQPPKDADAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 446          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 247.669 bits (631), Expect = 5.293e-76
Identity = 137/403 (34.00%), Postives = 226/403 (56.08%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKK-----------TIKTTPTE--------DSDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
             NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W+++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  R   +  +             +L + +     R  F +         A D    K                +P E           ID  SR  FP  FL++N FYW+ Y ++
Sbjct:   65 VNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRRHHKSPM------------LNLFQDDEGGEGRFNFSAYGMGPACLQAKDGISVKGANNNNTTNPPPAPSKSPEEMRKLFIQRAKKIDKISRIGFPMAFLIFNMFYWIIYKIV 449          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra4 (glycine receptor, alpha 4 subunit [Source:MGI Symbol;Acc:MGI:95750])

HSP 1 Score: 245.743 bits (626), Expect = 2.905e-75
Identity = 139/391 (35.55%), Postives = 226/391 (57.80%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDP-ILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKS------NGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
             NV   + + +  SV+ T M+Y  +V+LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W ++ P + ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K           + + E +  E   +            ++   ++ + +        LL        +G+   K        ID+ SR +FP  FL++N FYW+ Y VL
Sbjct:   70 VNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYREYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFMRLRRRQRRQRMEEDIIRESRFYFRGYGLGHCLQARDGGPMEGSSIYSPQPPTPLL-------KEGETMRKLYVDRAKRIDTISRAVFPFTFLVFNIFYWVVYKVL 447          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Match: Glra1 (glycine receptor, alpha 1 subunit [Source:MGI Symbol;Acc:MGI:95747])

HSP 1 Score: 243.047 bits (619), Expect = 3.173e-74
Identity = 115/282 (40.78%), Postives = 191/282 (67.73%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKK 1119
             NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W+++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K
Sbjct:   65 VNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYNEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWISFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK 340          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P24524|GLRA3_RAT (Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 4.081e-81
Identity = 151/436 (34.63%), Postives = 251/436 (57.57%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELAR--WCSACQRQQFFHLQE-QNTLDRNRLEF-------CSELESLLI----NHALDA--HKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         E++R    R     A   ++F+   +  + +  +RL F       C + +  ++    NHA+        +  K        ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   37 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRLSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSADEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRH 456          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|Q91XP5|GLRA3_MOUSE (Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2)

HSP 1 Score: 261.151 bits (666), Expect = 3.326e-80
Identity = 150/436 (34.40%), Postives = 250/436 (57.34%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARW--CSACQRQQFFHLQE-QNTLDRNRLEF-------CSELESLLI----NHALDA--HKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         E++R    R     A   ++F+   +  + +  +R  F       C + +  ++    NHA+        +  K        ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   37 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRH 456          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|O75311|GLRA3_HUMAN (Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2)

HSP 1 Score: 259.996 bits (663), Expect = 9.438e-80
Identity = 151/440 (34.32%), Postives = 249/440 (56.59%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELAR--WCSACQRQQFFHLQEQNTLDR-NRLEFCSELESLLINHALDAHKGK---------KTIKTTPTE--------DSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+ E P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         E++R    R     A   ++F+   + +   R +R  F     +  +   L A  G          + +  +P E           ID+ SR  FP  FL++N FYW+ Y +L H
Sbjct:   37 RSAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHK---------ELLRFRRKRKNKTEAFALEKFYRFSDMDDEVRESRFSFT----AYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRH 456          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|O93430|GLRA1_DANRE (Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.795e-79
Identity = 145/402 (36.07%), Postives = 230/402 (57.21%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD------------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
             NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E    D  R  F +         A D    K      PT  +                   ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   61 VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCT--KHYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRRR-HLKEDEAGD-GRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 436          
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Match: sp|P23416|GLRA2_HUMAN (Glycine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GLRA2 PE=1 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 7.114e-78
Identity = 145/404 (35.89%), Postives = 229/404 (56.68%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-------EDSD------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  SV+ T M+Y  +++LRQ+W D RL +    +    ++  + PS+   +W PDLFF N K    H +T  N L+R+  NG++LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  + P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K              E  R     +RQ     +E++    +R  F        + H L    G   +K TP        +D D            ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   72 NVTCNIFINSFGSVTETTMDYRVNIFLRQQWNDSRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKNGKVLYSIRLTLTLSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLSDGPVQVAEGLTLPQFILKEEKELGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHK--------------EFLRLRRRQKRQN----KEEDVTRESRFNF----SGYGMGHCLQVKDG-TAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWITYKIIRH 446          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A3S5FGS1 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS33396 PE=3 SV=1)

HSP 1 Score: 503.056 bits (1294), Expect = 2.461e-172
Identity = 249/412 (60.44%), Postives = 314/412 (76.21%), Query Frame = 1
Query:  199 RDLIMERIVDKKRYKKDERPSEIYQT--NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGK-KTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            RD I+  I   + Y K ERP+E+  T   V V M+VLAI S+ V  M+Y  D YLRQ W D RL W +++EFR +   IVS  LK  +WLPDLFFRNGKEGY+H MT+PNYL+R+ P+G +LYSQKITMRFSC+M LQ FPMD Q C ++IGSYGYTL+ELKF W  E+ + +S  ++ISEFN+P    T DCTN S TSTG YTCL A F L+RQL SYL +T++P+ILI+MVSWL+FW+NVD+ PARV LGL++LLG+LTQA+ +S++LPRVSYIKAID+W+I  I+FVIG L+EY +A  + R+K+++ W +DVREIVR ELA+WC+ACQ+Q    LQ  + L R +LEFC ELE+LL N  +D  K K K +K T T +S+IDSYSRFLFPACFLLYNCFYWLYYLVL
Sbjct:   33 RDRIVNHIF--RNYLKHERPTELDNTPTEVGVNMRVLAIFSIDVRNMDYYIDAYLRQIWFDKRLAWAHIDEFRQYKQPIVSSKLKNDIWLPDLFFRNGKEGYLHTMTVPNYLLRVMPDGNVLYSQKITMRFSCQMELQNFPMDMQVCGLNIGSYGYTLNELKFVWH-EEKVNLSGRMRISEFNTPETFDTFDCTNSSKTSTGNYTCLNATFKLKRQLSSYLATTYIPNILIIMVSWLSFWVNVDAAPARVPLGLLSLLGILTQASSVSNSLPRVSYIKAIDIWMIFSIIFVIGVLVEYALALTMLRRKRADTWHRDVREIVRQELAKWCTACQQQHLVQLQNSHQLTRGQLEFCEELEALLTNQVIDHQKEKNKAVKPTTTTESEIDSYSRFLFPACFLLYNCFYWLYYLVL 441          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183AQU5 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9330 PE=3 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 2.079e-165
Identity = 243/413 (58.84%), Postives = 314/413 (76.03%), Query Frame = 1
Query:  199 RDLIMERIVDKKRYKKDERP-SEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-EDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            RD I+  I++K  Y+  ERP +    T+V+V+MK+LAI S+ V  M+Y  D+ LRQ W D RL+W  +  F+++   +VSP LK+ LWLPDLFFRNGK+GY+HK+TLPNYL+R+ PNG +LYSQKITMRFSC+M+LQTFPMD+Q+C+++IGSYGYT+ ELKF WR EDP+ ++  LQ+SEF +P    T DC+ + STSTG Y CL+A F LQRQLGSYL +T+VP+ILI+MVSWL+FW+NVDS PARV LGL++LLG+LTQA  +SSTLPRVSYIKAIDVW+I  I+FVIG L+EY VA  + RKK++  W +DV+ IV  EL RWC+ CQ+QQ   LQ    L R +LEFC E+E LL +  +D  K K   +  P   +S+ID+YSRFLFPAC++LYNCFYW YYL L H
Sbjct:   18 RDQIVNMIMNK--YRSYERPPTGANATHVIVFMKILAIFSIDVRTMDYYVDMLLRQTWKDRRLSWNEVPAFQNYTETLVSPKLKEQLWLPDLFFRNGKDGYLHKLTLPNYLLRVSPNGEVLYSQKITMRFSCQMHLQTFPMDTQKCMINIGSYGYTITELKFVWRAEDPVELADALQLSEFETPESFGTEDCSGNYSTSTGAYACLQAWFHLQRQLGSYLATTYVPNILIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDVWMIFSIIFVIGVLVEYAVALTVLRKKQAETWHEDVKMIVHEELTRWCAVCQQQQLAQLQNSQGLSRGQLEFCEEMELLLTSQLIDDSKEKTKPRRPPGLVESEIDNYSRFLFPACYILYNCFYWAYYLGLKH 428          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A5J4NN47 (Glycine receptor alpha-2 OS=Paragonimus westermani OX=34504 GN=DEA37_0005192 PE=3 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 1.256e-164
Identity = 237/412 (57.52%), Postives = 305/412 (74.03%), Query Frame = 1
Query:  199 RDLIMERIVDKKRYKKDERPSEIYQTNVLVY-MKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-EDSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 1428
            RD I+E I+ K  YK  ERP E     V+   MK+LAI S+ V  M+Y  D  LRQ W D RL+W ++  F ++   +VSP LK+ LWLPDLFFRNGK+GY+H MTLPNYL+R+ PNG +LYSQKITMRFSC+M+LQTFPMD+Q C M+IGSYGYTL ELKF WR + P+ +S  LQ+SEF +P +    DC+ +SSTSTG+Y+CL A F LQRQLGSYL +T++P++LI+MVSWL+FW+NVDS PARV LGL++LLG+LTQA  +SSTLPRVSYIKAIDVW++  I+FVIG L+EY VA  + R+     W +DVR IV  EL RWC+ CQ+QQ   +Q    L R +L FC E+E LL +  +D +K K  ++  P   +S++D YSRF+FPA ++LYNCFYW+YYLVLV
Sbjct:  132 RDQIVEMIMSK--YKSYERPPEGGNATVVTMNMKILAIFSIDVRTMDYYVDALLRQTWKDRRLSWSDVPAFANYTQELVSPKLKEQLWLPDLFFRNGKDGYLHTMTLPNYLLRVSPNGEVLYSQKITMRFSCQMHLQTFPMDTQRCDMNIGSYGYTLSELKFVWRADKPVELSDNLQLSEFETPEEFEVADCSENSSTSTGQYSCLLATFELQRQLGSYLATTYIPNVLIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDVWMMFSIIFVIGVLVEYAVALTVLRRNHQETWHQDVRHIVHEELTRWCAVCQQQQLSKIQNAQGLSRGQLGFCEEMELLLTSQLIDDNKEKSKLRRPPGLVESEVDRYSRFMFPASYILYNCFYWMYYLVLV 541          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183W0B4 (Uncharacterized protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS6169 PE=3 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 6.055e-164
Identity = 247/416 (59.38%), Postives = 313/416 (75.24%), Query Frame = 1
Query:  190 AQQRDLIMERIVDKKRYKKDERPSEIYQ-TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPT-EDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            +  RD I+  I+ K  Y+  ERP +    T V V MKVLAI S+ V  M+Y+ D+ LRQ W D RL+W  + EFR F   +VSP LK+ LWLPDLFFRNGK+GY+HK+TLPNYL+R+ PNG +LYSQKITMRFSC+M+LQTFPMDSQ C +DIGSYGYTL+ELKF W  E P+ +   LQ+SEF +P +    DC++  STSTG+Y CLKA F LQRQLGSYL +T+VP++LI+MVSWL+FW+NVDS PARV LGL++LLG+LTQA  +SSTLPRVSYIKAID+W+I  I+FVIG L+EY VA  L R+K+S  W +DV++IVR ELARWC+ CQ+QQ   LQ    L R ++EF  ELE LL N  ++  K K   +  P   +S++D+YSRFLFPACF+LYNCFYW Y+LV+V+
Sbjct:  138 SSMRDRIVSLIMSK--YRSYERPPDGGNATIVTVNMKVLAIFSIDVRTMDYNVDLLLRQAWRDRRLSWHEIPEFRDFKEPLVSPKLKEQLWLPDLFFRNGKDGYLHKLTLPNYLLRVHPNGNVLYSQKITMRFSCQMHLQTFPMDSQSCYIDIGSYGYTLNELKFVWNGEKPVELGENLQLSEFETPEKFDAHDCSSGYSTSTGQYACLKATFELQRQLGSYLATTYVPNVLIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDIWMIFSIIFVIGVLVEYAVALTLLRRKQSETWHEDVKDIVREELARWCAICQQQQLVQLQNSQGLTRGQMEFREELEHLLTNQLIEESKDKSKPRRPPGLVESEVDTYSRFLFPACFVLYNCFYWCYFLVIVN 551          
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Match: A0A183PWS9 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS18815 PE=3 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 5.426e-163
Identity = 247/413 (59.81%), Postives = 316/413 (76.51%), Query Frame = 1
Query:  199 RDLIMERIVDKKRYKKDERPSEIYQ-TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTE-DSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            RD I+  I+ K  Y+  ERP +    T V V MKVLAI S+ V  M+Y  D+ LRQ W D RL+W ++ EF  FN  +VSP LK+ LWLPDLFFRNGK+GY+HK+TLPNYL+R+ PNG +LYSQKITMRFSC+M+LQTFPMD+Q C ++IGSYGYTL+ELKF W  + P+ ++  LQ+SEF +P Q  T DC++  STSTG+YTCL A F LQRQLGSYL +T++P++LI+MVSWL+FW+NVDS PARV LGL++LLG+LTQA  +SSTLPRVSYIKAID+W+I  I+FVIG L+EY +A  + R+K+S  W +DV+EIVR ELARWC+ CQ+QQ   LQ  N L + +LEF  ELE LL N  +D +K K   K  P   +S+ID+YSRFLFPACF+LYNCFYW Y+L++V+
Sbjct:   93 RDRIVNLIMSK--YRSYERPPDGGNATIVTVNMKVLAIFSIDVRTMDYYIDLLLRQVWRDRRLSWYDIPEFSKFNEPLVSPKLKEQLWLPDLFFRNGKDGYLHKLTLPNYLLRVHPNGNVLYSQKITMRFSCQMHLQTFPMDNQHCHINIGSYGYTLNELKFVWNHDKPVELAEKLQLSEFETPKQFITNDCSSGYSTSTGQYTCLNATFELQRQLGSYLATTYIPNVLIIMVSWLSFWVNVDSAPARVPLGLLSLLGILTQAISVSSTLPRVSYIKAIDIWMIFSIIFVIGVLVEYAIALTILRRKQSETWHEDVKEIVREELARWCAICQQQQLIQLQNTNQLIKGQLEFREELEHLLTNQFIDDYKDKTKPKRPPGLIESEIDTYSRFLFPACFVLYNCFYWCYFLIIVN 503          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 258.07 bits (658), Expect = 4.739e-80
Identity = 147/418 (35.17%), Postives = 233/418 (55.74%), Query Frame = 1
Query:  226 DKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTED------------------SDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            D +  K D    +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E       R  F +         A D    K      PT                      ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   61 DPQGSKSDGTHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRR-RHLKEDEA-GEGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSSIPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWIIYKII 452          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:103026517])

HSP 1 Score: 256.914 bits (655), Expect = 9.122e-80
Identity = 144/402 (35.82%), Postives = 228/402 (56.72%), Query Frame = 1
Query:  274 TNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTED------------------SDIDSYSRFLFPACFLLYNCFYWLYYLVL 1425
             NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K              EL R+    QR++  HL+E       R  F +         A D    K      PT                      ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   64 VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK--------------ELLRF----QRRR-RHLKEDEA-GEGRFSFAAYGMGPACLQAKDGMAIKGNNNNAPTSSIPPEKTVEEMRKLFISRAKRIDTVSRVAFPLVFLIFNIFYWIIYKII 439          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 255.373 bits (651), Expect = 4.621e-79
Identity = 144/404 (35.64%), Postives = 233/404 (57.67%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKS-----NGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTP-----TED---------SDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+   P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K         +K  +E    E+   C +       +  +  T+ +              N+A    KG+ T  T P     TE+           ID+ SR  FP  FL +N FYW+ Y +L H
Sbjct:   70 NVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTKH--YNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKE---EEVRESCLSFTA----NAGKDGTMTKP------------TNNAASTPKGQPT-PTVPQAGKSTEEMRKIFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKILRH 447          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra3 (glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-020402-1])

HSP 1 Score: 256.144 bits (653), Expect = 7.144e-79
Identity = 145/424 (34.20%), Postives = 236/424 (55.66%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKK----------------SNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLL---------INHALDAHKGKKTIKTTP-----TED---------SDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W+   P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K                   +E+++ E ++       +         + E N  +    E C    +            N+A    KG+ T  T P     TE+           ID+ SR  FP  FL +N FYW+ Y +L H
Sbjct:   70 NVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQANGPVQVADGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRRRKKSTKLHDRSFEEELSESLQSVNGLRSADPVYGSMDQMSESNDREEEVRESCLSFTANAGKDGTMTKPTNNAASTPKGQPT-PTVPQAGKSTEEMRKIFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKILRH 486          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 254.218 bits (648), Expect = 9.156e-79
Identity = 146/403 (36.23%), Postives = 234/403 (58.06%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEF-------CSELESLLINHALDA-----------HKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            NV   + + +  SV+ T M+Y  +++LRQ+W DPRL +    +  S +   + PS+   +W PDLFF N K    H +T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  E P+ ++ GL + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R++K         E +R          +R+Q  +L+E+  L   R  F       C +  +++ +   +A           H  KK +         ID+ SR  FP  FL++N FYW+ Y ++ H
Sbjct:   60 NVTCNIFINSFGSVTETTMDYRVNIFLRQKWNDPRLAYSEYPD-PSLD---LDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRISKDGTVLYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMNDLIFEWLDEGPVQVAEGLTLPQFIMREEKELGYCTK--HYNTGKFTCIEVKFKLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAGVNFVSRQQK---------EFLR---------LKRRQKRNLKEE--LREGRFHFSGYSMAPCMKDGTVVKSATANAIQQPSALRDAEHNRKKFVDRA----KRIDTISRAAFPLAFLIFNIFYWITYKIIRH 432          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 250.366 bits (638), Expect = 1.357e-78
Identity = 141/399 (35.34%), Postives = 231/399 (57.89%), Query Frame = 1
Query:  268 YQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKG-------------KKTIKTTPTEDSD-IDSYSRFLFPACFLLYNCFYWLYYLV 1422
            Y  NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W++E  + ++ GL + +F    +   + CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K     +  R+  + +L      C    F +    +    N  +     E  L   ++   KG             +  IK    + +  ID+ SR  FP  FL++N FYW+ Y V
Sbjct:    4 YPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQEGAVQVAEGLTLPQFVLKDEKDLVYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKELLRIRRRRQRNQIDLTSLILIC--NIFTYFINSSVPIFNMFKRVEGNERALTKDSVSV-KGVNATNAAPAPAPTQDAIKKKFVDRAKRIDTISRAAFPLAFLIFNIFYWIIYKV 393          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.891 bits (616), Expect = 1.856e-74
Identity = 146/409 (35.70%), Postives = 226/409 (55.26%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWEN--LEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARK-----KKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTI------------------KTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 1428
            NV   + + +  S+     +Y   VYLRQ WTDPRL + +  +       +NI      K +W PDLFF N K  + H++T  N ++R+  NG + Y+ ++T+  SC M+L  FPMD+Q C M + S+GYT  ++ F W    P+ +  GL + +F   +++ST  CT   + STG +TC+ AKF L R++G YL+  +VPSILIV++SW++FWIN+++ PARV LG+ T+L + TQ+TG  ++LP+VSYIKA+D+W+  C++FV  ALLEY   +V +R+     KK  G +K + +++ H+   W       +F   +  N L    L F   + +L  N  L     KK +                  K        ID+ SR  FP  FL++N  YW  + V++
Sbjct:   70 NVSCGVFIRSFGSIQEATSDYRMTVYLRQRWTDPRLAYSHYPVPLLHLDQSNI------KHIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHWNGPTPVSLFEGLTLPQFVLSNKISTGSCTK--TYSTGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPI-DLLVHKKMFW-------KFLVAENDNDL----LYFTITIFTL--NGLLPVSDSKKPVIVCIKPLLSLQETKEKMRKKYVACAQTIDNISRLFFPISFLIFNVVYWFAFKVML 456          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra1 (glycine receptor, alpha 1 [Source:NCBI gene;Acc:30676])

HSP 1 Score: 202.601 bits (514), Expect = 1.092e-61
Identity = 100/248 (40.32%), Postives = 165/248 (66.53%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEE-FRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVS 1017
            N  VY+K  +  S+  T M+Y   ++LRQ+W DPRLT+ +  E +   + + +     + +W PDLFF N K  Y H++T  N ++R+  NG +L++ ++T+  SC M+L+ FPMD+Q C M + S+GYT+ +L F W +E+P++IS  L + +F    ++ T  C    S+ TG ++C+ A+F+L R++G YL+  +VPS LIV++SW++FWIN+++ PARV LG+ T+L M TQ+TG  ++LP+V+
Sbjct:   33 NCSVYIK--SFGSIEETTMDYQVTIFLRQKWIDPRLTYSHYPEPYLDLDQSNI-----QYIWRPDLFFDNEKSAYFHEVTTDNKMLRIFKNGLVLFTVRLTLTLSCPMDLRNFPMDTQMCYMFLESFGYTMADLSFHWDEEEPVIISKELVLPQFVLSSKIDTDSCDKLYSSGTGHFSCISARFVLHREMGFYLIQLYVPSALIVIISWVSFWINMEAAPARVALGITTVLTMTTQSTGARASLPKVT 273          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 201.06 bits (510), Expect = 4.874e-59
Identity = 129/428 (30.14%), Postives = 215/428 (50.23%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIV--SPSLKKILWLPDLFFRNGKEGYVHKMTLPN---YLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELA-RW-------CSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIK-TTPTEDSDIDSYSRFLFPACFLLYNCFYWLYY 1416
            + SP     ++I +   D +     + P  +   ++LV         V    M+YS +++LRQ W DPR+   N+ +   +N + +    S    +W PDLFF N K        L     Y+             ++++  +C M+L+ +PMD+Q C + + SYGYT ++L F W   +P+    G+   +F   ++    +CT +   + G ++C+KA F L R +G YL+  ++PS L+V++SWL+FW+NV++ PARV LG+ T+L + TQ T  ++ LP+VSYIKAIDVW+ AC +FV  ALLE+   ++  R+   +    D     + EL   W        S+ +R Q  H  E++   + +            N+A   H   +  +  +      ID  SR +FP  F+++N FYW+ Y
Sbjct:   40 KPSPFLSMDNVIRDTGYDSRMRPNVDGPPVVVNCSILV----KGFGPVEEATMDYSINIFLRQTWNDPRIL--NVLKSIEYNTDFLDLGNSFVDSVWKPDLFFENEKSAAFQMYQLVTGFKYMYTFAMWITCFLCFRLSLVLACPMSLEVYPMDAQYCSIYLESYGYTTNDLIFQWNDTEPVSFGAGVSTPKFTLSNETFLGECTKE--YTYGTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWMGACQVFVFSALLEFAAVNMATRRHGISPSHHDGDHGTKGELPIEWKRHRHANVSSVRRPQ-RHRPERDCRSQGKPGVFHTNSRRDENNATRVHVSDEEWRYQSLLHARRIDYISRVIFPTVFMIFNIFYWVIY 458          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002305.1 (pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 gene:ENSPMAG00000002075.1 transcript:ENSPMAT00000002305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 7.638e-59
Identity = 127/436 (29.13%), Postives = 222/436 (50.92%), Query Frame = 1
Query:  193 QQRDLI-------MERIVDKKRYKKDERPSEIYQTNVLVYMKVL--AINSVSVTKMEYSTDVYLRQEWTDPRL-----TWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLAR-----------KKKSNGWE---KDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYY 1416
            Q+RD++       ++ ++ +  Y    RP+ +Y + VLV   VL  +   +    M+Y   +YL+Q W D R+          ++F    NN +       +W PDLFF N K    H++     ++    N +  +S  +++  +C MNL+ +P+D+QEC +++ S+GYT  +L F W + +P++++T L   +F   +     DC+ +    TG ++C+ A F L R +G YL+  + PS L+V++SWL+FW++V+S PARV+LG+ T+L + TQ T  ++ LP++SYIKA+DVW+ AC +FV  ALLE  V SV  +           +K +N W+     + ++V +  +R      ++                   ++     I+   D+    +  + +      ID  SR LFP  F+++   YW  Y
Sbjct:   22 QRRDIVKRSGMDGLDELIKESSYDGRLRPN-MYGSPVLVNCSVLVKSFGPIEENTMDYMMLIYLQQSWIDSRIESIYSAGHYQKDFLDLANNYI-----DTVWTPDLFFENEKSAAFHEIHCRFSIIVHATNNKTCFSLVLSLTLACPMNLEYYPLDTQECRINLESFGYTTQDLIFQWDENEPLVVATNLYTPKFKLSNHTELGDCSKE--YLTGTHSCINATFYLHRDMGYYLIQVYFPSCLLVIISWLSFWLSVESTPARVSLGITTILTVTTQMTSANAALPKMSYIKAMDVWMAACQVFVFAALLESTVVSVTKQHVVSGKAETRDQKNNNVWDLFFNPLYDVVGYNRSRSLGRAAKRT--------------TSVVNQPHGWFISQPTDSDGMAR--ERSLVRSRQIDYISRVLFPLAFVIFLTIYWFSY 433          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO39173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS4])

HSP 1 Score: 183.726 bits (465), Expect = 4.393e-54
Identity = 101/271 (37.27%), Postives = 170/271 (62.73%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYV 1089
            N+ VYM V++ ++V    ME+S DV+ +Q W DPRL       F      I+  S K+  W+PD FF N K    H++   N  + + P+G I  S+++T+  SC M+L+ +P+D Q C+++I SY + ++++ + W+ ++ ++I  G +++EF    + S  +    S + TG YT L AKF+ +R+L    +  + P+ LIV++SWL+FWI+ D+VPARV LG+ T+L ++T    + +++P+VSYIKAID+++I   +FV G LLEY+
Sbjct:   30 NISVYMSVVSFSTVYEKDMEFSLDVFFKQAWRDPRLRHSAKMPF------ILPGSQKEKFWIPDTFFLNVKTARFHQVPAANTRIVVTPDGDIELSERLTVSASCRMDLRMYPLDQQTCVLEILSYSFDINDIDYRWKAKEDLIILDG-EMNEFE--LKDSRGERKQKSRSCTGTYTHLVAKFVFRRRLAYSFIQIYSPTFLIVVLSWLSFWISKDAVPARVALGITTVLTIVTLMGSLRNSVPKVSYIKAIDLYLIVSFIFVFGTLLEYI 291          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO34692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK5])

HSP 1 Score: 182.185 bits (461), Expect = 1.202e-53
Identity = 101/281 (35.94%), Postives = 171/281 (60.85%), Query Frame = 1
Query:  337 YSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKI--LWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKE----DPILISTGLQISEFNSPHQVSTIDCTNDSST-STGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVR 1158
            ++ D+YLRQ W DPRL ++ +      N ++++ + + I  +W+P  +F N K+ Y H +T  NYL+ ++PNG + YS ++T+  +C++ LQ FP D Q C M + SYGY   ++ + W       D + IS  L++ +F    +++ +     ++  + G ++ L AKF   R+LG Y++ T++PS+L V +SW +FWI+ DS PARV LG+ T+L M+T +    + LP+VSY KAID +++ C+++V GAL+EY + +  A K +     K  RE +R
Sbjct:    2 FTIDMYLRQYWRDPRLIFDPV----PVNTDVLTLNRQTIDEIWIPSTYFFNAKKAYFHDVTTENYLLMIKPNGDVFYSVRLTITMACKLTLQMFPHDVQVCEMMLESYGYQATDVYYRWNSRNSTGDVVYISEDLEMPQF----KITNVKLEERTNIYNIGPHSALIAKFTFHRRLGYYMIQTYIPSMLTVTISWFSFWISPDSPPARVGLGITTVLTMITISNSARAPLPKVSYTKAIDWFLLMCLVYVFGALMEYAIVNFYACKVQQRNRNK--REEIR 272          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO41538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S448])

HSP 1 Score: 182.185 bits (461), Expect = 1.051e-52
Identity = 121/382 (31.68%), Postives = 197/382 (51.57%), Query Frame = 1
Query:  334 EYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTW--RKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVA--------SVLARK---------KKSNGWEKDVREI-VRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYL 1419
            +YS D++ RQ W D RL  +  + F    N   +P   +  W PD +F N K    H +T  N   ++ P+G I YS +IT+  SCEM+L+ FPMD+Q+C++ I SY YT++++ + W  R   PI I  G ++++F+      T+      S  TG +  L+  F  +R+   ++V  +VPS  IV +SWL FWIN ++VPAR++L +  +L  +     I+S+LPR+SY+KA+D ++I   MF++ +++EYV+           L+RK         ++SNG  +  RE+ V +  +             L      +++   F  +L S     +   H  KK+          ID  S+ +FP  + L+N  YW YYL
Sbjct:    4 DYSLDIFFRQWWRDERLAHDVNKVF----NMAANPG--QYFWTPDTYFVNVKSSKFHHVTRENMRTKIWPDGLIYYSSRITLTASCEMDLRFFPMDTQDCVLKIESYAYTVEDVIYNWNNRGTTPIEIFAG-EMAQFDMTEM--TMQTMITFSLLTGSFDSLRVSFRFKRRTSYFIVQHYVPSAFIVFLSWLGFWINKNAVPARISLTVTCILSTMVLFESINSSLPRISYLKAVDYYLIISFMFILASMVEYVLVLNVTDYKRITLSRKHSLQPCHCRERSNGLPRPRRELPVPNGFSDADHVTNILPLQRLASHKQQEKHEYNFGDQLSS-----SSYEHYAKKS--------HFIDHCSKKVFPLLYALFNIVYWSYYL 363          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO40889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y7])

HSP 1 Score: 172.17 bits (435), Expect = 1.439e-49
Identity = 92/288 (31.94%), Postives = 163/288 (56.60%), Query Frame = 1
Query:  238 YKKDERPSEIYQTN---VLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVV 1092
            Y+   RP+  YQ +   +L+ + V +  ++    M++S D++ RQ W DPRL   N+ E  +       P+    +W+PD  F +    Y+H + + N+ + + P GR+ +  + T+   C MNL+ +PMD Q C + I SY Y +  L + W+    I +  G ++S+F   +         +     G+Y+ LKA F  QR++G YL+  ++P + IV V+W++ W++  + PARV+L + TLL + T    +++++PRVSY+K+ID++++    FV+G LLEY+V
Sbjct:   11 YESKIRPN--YQGDPVEILIDISVASFGNLQEADMKFSLDMFFRQSWHDPRLR-HNMNETMTLTTGTKHPA--DFVWVPDTVFVDASHAYMHNVMVANHKLDVTPGGRVFWGTRATLIARCHMNLRRYPMDEQTCNLSIISYAYPVRHLLYRWKNSPGIKVLDG-EMSQF---YMTRITTSLRNEIYVAGEYSVLKASFTFQRRVGFYLIQIYIPCMAIVFVAWMSLWVDRRATPARVSLCITTLLTIATIWGNVNASMPRVSYVKSIDIYLMTSFTFVLGTLLEYIV 289          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Match: EDO43147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH2])

HSP 1 Score: 171.785 bits (434), Expect = 1.528e-49
Identity = 96/290 (33.10%), Postives = 166/290 (57.24%), Query Frame = 1
Query:  232 KRYKKDERP-SEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTND---SSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYV 1089
            K+Y K  RP +      V V  KV+++  ++   ME+S D++ RQ W +PR T    E F       ++    K+ W+PD +F N K+   HK+T  N  + + P+G + YS ++T+   C MNLQ FPMD Q C + I SY YT +++K+ W        + G++I   N   Q   ++   +   ++  +G ++ L A F L+R+L  + ++   P++++V++SW  FWI  D++PAR++L + T+L  L  +  +++ +P+VSY+KAIDV+V+    F+  +L+EYV
Sbjct:   13 KKYDKKLRPNAGGLPVEVQVEFKVVSLGGINEASMEFSMDIFFRQWWHEPRFTHNYSEPFT------MAEDAGKLFWIPDTYFINAKKSNFHKVTKENARIIIYPSGNVYYSVRLTLTLQCNMNLQLFPMDVQACPLFIESYAYTSEDIKYKWTPRG----TKGIEIIS-NETAQFVLVEARTEQIATAKISGHFSQLVATFSLKRRLEYFAITVVTPAMILVVLSWCCFWIVPDAIPARISLSVTTILSTLLLSGTVNAQMPKVSYMKAIDVFVLGNFAFIFLSLIEYV 291          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra4a (glycine receptor subunit alpha-4-like [Source:NCBI gene;Acc:101156095])

HSP 1 Score: 258.455 bits (659), Expect = 2.922e-80
Identity = 149/422 (35.31%), Postives = 238/422 (56.40%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKS--NGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R  P     D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +V+LRQ W DPRL +    +    N+  + PS+   +W PDLFF N K    H++T  N L+R+  +G +LYS ++T+  SC M+L+ FPMD Q C M + S+GYT+++L F W  ++P+ ++  L + +F    +     CT     +TGK+TC++ KF L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+ K      +K  ++ +  EL R       + +       T D   LE  +          +  + G+   K        ID+ SR +FP  FL++N FYWL Y VL H
Sbjct:   36 RAGPQLSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSITETTMDYRLNVFLRQNWNDPRLAYSEYPD----NSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQDGSVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSDNPVQVADDLTLPQFVLKEEKDLGYCTK--HYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFIRLRKKQRQQRIEEELVRESRGFYFRGYGLGHCLQTKDGAPLEGATVFSP---PPPMTMYDGEVFSKRFVDRAKRIDTISRAVFPLSFLIFNIFYWLTYKVLRH 448          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: ENSORLT00000025211.2 (glycine receptor subunit alpha-3 [Source:NCBI gene;Acc:101174559])

HSP 1 Score: 256.144 bits (653), Expect = 2.096e-79
Identity = 145/437 (33.18%), Postives = 245/437 (56.06%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPS-EIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-----------------IDSYSRFLFPACFLLYNCFYWLYYLVLVH 1431
            R +PM+   D + + +     Y    RP+ +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K  + H++T  N L+R+  NG +LYS ++T+  SC M+L+ FPMD Q C+M + S+GYT+++L F W++  P+ ++ GL + +F    +     CT     +TGK+TC++ +F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + ++R+       K++    RH+      +  +++    +  +T         S+     +N+A+       T +  P                      ID+ SR  FP  FL +N FYW+ Y +L H
Sbjct:   29 RHAPMSPS-DFLDKLMGRTSGYDARIRPNFKGPPVNVSCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYAEYPD----DSLDLDPSMLDSIWKPDLFFANEKGAHFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFQWQENGPVQVAEGLTLPQFILKDESDLRYCTK--HYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRTSLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQ------HKELLRFRRHK------SKTKEEVGESKLTSTAVMTSTPSISKDSKASVNNAV--APAANTTQNAPAAGGGGRSTEEMRKLFIDRAKKIDTVSRAGFPLAFLFFNIFYWVLYKILRH 444          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 255.758 bits (652), Expect = 3.189e-79
Identity = 146/417 (35.01%), Postives = 234/417 (56.12%), Query Frame = 1
Query:  226 DKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-----------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            D K  K +    +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K         E++R           R++  H++E  T D  R  F           A D    K      PT  +                  ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   51 DPKGSKNEATHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK---------ELLR----------FRRRRRHMKEDETGD-GRFGFPGYGMGPACLQAKDGMAIKGNNNNAPTSAAPEKSIEEMKKLFIGRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 441          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 254.603 bits (649), Expect = 5.447e-79
Identity = 143/400 (35.75%), Postives = 229/400 (57.25%), Query Frame = 1
Query:  277 NVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-----------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K         E++R           R++  H++E  T D  R  F           A D    K      PT  +                  ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   55 NVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK---------ELLR----------FRRRRRHMKEDETGD-GRFGFPGYGMGPACLQAKDGMAIKGNNNNAPTSAAPEKSIEEMKKLFIGRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 428          
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Match: glra1 (glycine receptor alpha 1 [Source:NCBI gene;Acc:101173557])

HSP 1 Score: 255.373 bits (651), Expect = 5.994e-79
Identity = 146/417 (35.01%), Postives = 234/417 (56.12%), Query Frame = 1
Query:  226 DKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSD-----------------IDSYSRFLFPACFLLYNCFYWLYYLVL 1425
            D K  K +    +    NV   + + +  S++ T M+Y  +++LRQ+W DPRL +    +    ++  + PS+   +W PDLFF N K    H++T  N L+R+  NG +LYS +IT+  +C M+L+ FPMD Q C+M + S+GYT+++L F W ++  + ++ GL + +F    +     CT     +TGK+TC++A+F L+RQ+G YL+  ++PS+LIV++SW++FWIN+D+ PARV LG+ T+L M TQ++G  ++LP+VSY+KAID+W+  C++FV  ALLEY   + +AR+ K         E++R           R++  H++E  T D  R  F           A D    K      PT  +                  ID+ SR  FP  FL++N FYW+ Y ++
Sbjct:   66 DPKGSKNEATHKKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPD----DSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLILACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTK--HYNTGKFTCIEARFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHK---------ELLR----------FRRRRRHMKEDETGD-GRFGFPGYGMGPACLQAKDGMAIKGNNNNAPTSAAPEKSIEEMKKLFIGRAKRIDTVSRVAFPLVFLIFNIFYWITYKII 456          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000041885.1 (SMESG000041885.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 425/425 (100.00%), Postives = 425/425 (100.00%), Query Frame = 1
Query:  175 RKSPMAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHYAQNIS 1449
            RKSPMAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHYAQNIS
Sbjct:   24 RKSPMAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHYAQNIS 448          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000077704.1 (SMESG000077704.1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 346/419 (82.58%), Query Frame = 1
Query:  181 SPMAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHYA 1437
            S  A QR LI   I  K  Y K++RP E  QT V VYMK+LAINSVSVT+MEYSTDVYLRQEW D RL W NL++F+S+N NIVSPSLKK+LWLPDLFFRNGKEGYVHKMTLPNYLMRL PNG ILYSQKITMRFSC+M+L+TFPMD+Q C MDIGSYGYTLDEL+F WR  D I I+TG+QISEFNSP + +T DCT  SSTSTG+Y+CLKA+F+LQRQLGSY+VSTFVPSILIVMVSWLNFWI+VDSVPARV LGLVTLLGMLTQA GISSTLPRVSYIKAID+WVI CI+FVI ALLEY VA+ +  +  SN  E +V+ IV+ EL  WC+A  R Q  H+Q  N+LDR+RL+FC +LE+LLI  A+D+H  KK IK  P E+S +D YSRFLFPA FL YNCFYW+Y+LVLV+Y+
Sbjct:   26 SEKADQRSLIRAEIFSK--YLKEDRPKEEEQTEVTVYMKILAINSVSVTQMEYSTDVYLRQEWVDSRLAWNNLDKFKSYNANIVSPSLKKVLWLPDLFFRNGKEGYVHKMTLPNYLMRLSPNGLILYSQKITMRFSCQMDLKTFPMDTQICEMDIGSYGYTLDELRFNWRVNDSISIATGMQISEFNSPGKFTTRDCTKLSSTSTGQYSCLKAEFVLQRQLGSYIVSTFVPSILIVMVSWLNFWIHVDSVPARVMLGLVTLLGMLTQAIGISSTLPRVSYIKAIDIWVIWCIIFVICALLEYAVANSVVARNYSNNMENEVKLIVQRELMNWCTAFDRLQISHMQVHNSLDRDRLQFCHDLENLLIEKAIDSH--KKVIKVRPPENSIVDVYSRFLFPALFLFYNCFYWVYFLVLVNYS 440          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000037124.1 (SMESG000037124.1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 267/441 (60.54%), Postives = 333/441 (75.51%), Query Frame = 1
Query:  187 MAQQRDLIMERIVDKKRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCS-ACQRQQ-----------------FFHLQEQNTLDRNRLEFCSELESLLINHALDAHKGKKTIKTT--------PTE-DSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 1428
            M   R+ I   I   K YK +ERPSE  QT V VYMKVLAINSV V KMEYSTDVYLRQEW D RL W+++E+FRS+NNN+VSP  K+ +WLPDLFFRNGK+GYVH MT PNYL+RL+PNG +LYSQKITM+FSC+M+LQTFPMD+QEC MDIGSYGYTLD+LKF WR  +P+++   +QI EFN P  V TIDC+  SSTSTG YTC+KA F LQRQLGSYL ST++P++LIVMVSWLNFW+++D+VPAR+TLGL+TLLG+LTQATG+S+ LPRVSYIKAIDVW+IACI+FVIGAL+E+ +AS+++RK KS  W++DV+ IV  EL +W   A ++QQ                 F +L + N+ D +  EF  +LE  L    L+A   +K  K+         P + DS+ID YS+FLFPA F+LYNCFYWLYYL+LV
Sbjct:   10 MNSDREQIQNHIF--KGYKSNERPSENKQTIVTVYMKVLAINSVDVIKMEYSTDVYLRQEWIDERLAWDHIEKFRSYNNNLVSPLFKEKIWLPDLFFRNGKDGYVHSMTTPNYLLRLQPNGEVLYSQKITMKFSCQMDLQTFPMDTQECNMDIGSYGYTLDQLKFRWRSWEPMILPPVMQIPEFNQPTNVKTIDCSELSSTSTGDYTCIKATFFLQRQLGSYLASTYIPNVLIVMVSWLNFWVSIDAVPARITLGLLTLLGILTQATGMSANLPRVSYIKAIDVWIIACILFVIGALIEFAIASMISRKSKSELWQRDVQNIVHQELFKWSKMALKKQQSINFLQMHLMGTPKTNSFTNLAQMNSTDNSANEFYHKLEVFLTAQLLEASPNEKLRKSISKPQVSEPPVQIDSEIDGYSQFLFPAFFMLYNCFYWLYYLILV 448          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 261/415 (62.89%), Postives = 327/415 (78.80%), Query Frame = 1
Query:  214 ERIVDK--KRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHAL--------DAHKGKKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLV 1428
            ERI+DK  + Y  +ERP E  QT V+V+MKVLAINSV+V+ MEYSTD+YLRQ W D RL W+NL EF+ FN+++VSPSLK  LWLPDLFFRNGKEGYVH MT PNYLMRL PNG +LYSQKITMRFSC+M+LQT+PMD+Q C M+IGSYGYTLD+LKF W + +P+ +   +QI EFN+P +V T DCTN S+T TG Y+CLKA F+L+RQLGSYLVSTF+P+ LIV+VSWLNFW++V++VPAR+TLGL+TLLG+LTQA+GIS  LPRVSYIKAIDVW+IACI+FVIGALLE+ VAS +A++KK   W+ +VR+IVR EL+RW  A  RQ+  H+Q    L+RN LEFC EL+ LL              AH+ K+    +  E+S ID YSR+LFP+CF+ YN  YW+YYL++V
Sbjct:   32 ERIMDKILQNYSLNERPIESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPSLKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQTNPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVASTVAQQKKLYQWKSEVRDIVRQELSRWNLAINRQKTHHMQTSQILNRNELEFCEELDILLTAQQYANNYHSQESAHQIKRQKILSEIEESKIDVYSRYLFPSCFIFYNFCYWIYYLIIV 446          
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Match: SMESG000061905.1 (SMESG000061905.1)

HSP 1 Score: 500.36 bits (1287), Expect = 1.358e-174
Identity = 264/409 (64.55%), Postives = 328/409 (80.20%), Query Frame = 1
Query:  232 KRYKKDERPSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEEFRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRILYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPILISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYLVSTFVPSILIVMVSWLNFWINVDSVPARXXXXXXXXXXXXXQATGISSTLPRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIVRHELARWCSACQRQQFFHLQEQNTLDRNRLEF---CSELESLLINHALDAHKGK---KTIKTTPTE--DSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHY 1434
            + Y   ERPSE+ QT V+VYM+VLAINSV V KMEYSTDV LRQEW D RLTW       S+N +I SP+LK+ +WLPDLFFRNGK+GYVH MTLPNYLMRL  NG ILYSQKITMRFSC+MNL TFPMDSQEC+MDIGSYGYTLD+LKF WR+++PI+I++ +QI EFN      T DC+ ++ TSTG YTCLKA F L+RQLGSYL ST++P++LIVMVSWLNFW++V+++PAR+TLGL+TLLG+LTQATG+S++LPRVSYIKAID+W+IACI+FVIGAL+E+ +AS++AR++KS  W+K VREIVR ELARWC+ CQ+QQ   +Q  + +DR + E      +LE LL    +   K K   K  ++ P +  DS+ID YSRFLFPACF+LYNCFYWLYYLVLVH+
Sbjct:   58 ENYNLHERPSEVKQTEVVVYMRVLAINSVDVLKMEYSTDVLLRQEWLDDRLTWHRHPRLASYNKSISSPALKEKVWLPDLFFRNGKKGYVHSMTLPNYLMRLNSNGMILYSQKITMRFSCQMNLSTFPMDSQECIMDIGSYGYTLDQLKFLWREKEPIIIASNIQIPEFNPSTDPYTFDCSKEAGTSTGNYTCLKASFHLRRQLGSYLASTYIPNVLIVMVSWLNFWVSVEAIPARITLGLLTLLGILTQATGMSNSLPRVSYIKAIDIWIIACIIFVIGALIEFAMASMIARRRKSEDWQKQVREIVRQELARWCAVCQQQQLVQIQNSSLIDRTQFETPIGTEDLEILLCPDTVQKWKKKPVQKVNRSKPQKSVDSEIDCYSRFLFPACFVLYNCFYWLYYLVLVHH 466          
The following BLAST results are available for this feature:
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.965e-8034.32glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA34.724e-8034.50glycine receptor alpha 3 [Source:HGNC Symbol;Acc:H... [more]
GLRA21.481e-7835.89glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA23.053e-7835.64glycine receptor alpha 2 [Source:HGNC Symbol;Acc:H... [more]
GLRA11.200e-7734.58glycine receptor alpha 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
avr-146.337e-6936.04pep chromosome:WBcel235:I:5968009:5973320:-1 gene:... [more]
avr-146.337e-6936.04pep chromosome:WBcel235:I:5967250:5973320:-1 gene:... [more]
avr-158.332e-6735.25pep chromosome:WBcel235:V:13498786:13502743:-1 gen... [more]
avr-158.332e-6735.25pep chromosome:WBcel235:V:13498786:13502582:-1 gen... [more]
glc-21.320e-6634.18Glutamate-gated chloride channel subunit beta [So... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluClalpha6.336e-7334.87gene:FBgn0024963 transcript:FBtr0335420[more]
GluClalpha1.165e-7234.71gene:FBgn0024963 transcript:FBtr0335419[more]
GluClalpha5.663e-7234.58gene:FBgn0024963 transcript:FBtr0343788[more]
GluClalpha1.020e-7134.47gene:FBgn0024963 transcript:FBtr0335416[more]
GluClalpha3.980e-7134.20gene:FBgn0024963 transcript:FBtr0343789[more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra15.518e-8135.15glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra11.278e-8035.41glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra12.378e-8036.07glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra33.822e-8033.70glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra24.271e-8036.09glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLRA31.598e-7934.41glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
GLRA32.791e-7934.41glycine receptor alpha 3 [Source:NCBI gene;Acc:100... [more]
tal14.192e-7934.05T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
tal14.388e-7934.29T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
tal15.092e-7934.05T-cell acute lymphocytic leukemia 1 [Source:Xenbas... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glra37.729e-8134.40glycine receptor, alpha 3 subunit [Source:MGI Symb... [more]
Glra21.061e-7835.49glycine receptor, alpha 2 subunit [Source:MGI Symb... [more]
Glra15.293e-7634.00glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
Glra42.905e-7535.55glycine receptor, alpha 4 subunit [Source:MGI Symb... [more]
Glra13.173e-7440.78glycine receptor, alpha 1 subunit [Source:MGI Symb... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24524|GLRA3_RAT4.081e-8134.63Glycine receptor subunit alpha-3 OS=Rattus norvegi... [more]
sp|Q91XP5|GLRA3_MOUSE3.326e-8034.40Glycine receptor subunit alpha-3 OS=Mus musculus O... [more]
sp|O75311|GLRA3_HUMAN9.438e-8034.32Glycine receptor subunit alpha-3 OS=Homo sapiens O... [more]
sp|O93430|GLRA1_DANRE1.795e-7936.07Glycine receptor subunit alphaZ1 OS=Danio rerio OX... [more]
sp|P23416|GLRA2_HUMAN7.114e-7835.89Glycine receptor subunit alpha-2 OS=Homo sapiens O... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5FGS12.461e-17260.44Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A183AQU52.079e-16558.84Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A5J4NN471.256e-16457.52Glycine receptor alpha-2 OS=Paragonimus westermani... [more]
A0A183W0B46.055e-16459.38Uncharacterized protein OS=Trichobilharzia regenti... [more]
A0A183PWS95.426e-16359.81Uncharacterized protein OS=Schistosoma mattheei OX... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra14.739e-8035.17glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra19.122e-8035.82glycine receptor alpha 1 [Source:NCBI gene;Acc:103... [more]
glra34.621e-7935.64glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra37.144e-7934.20glycine receptor, alpha 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glra29.156e-7936.23glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra21.357e-7835.34glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000008467.11.856e-7435.70pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra11.092e-6140.32glycine receptor, alpha 1 [Source:NCBI gene;Acc:30... [more]
glra4a4.874e-5930.14glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000002305.17.638e-5929.13pep scaffold:Pmarinus_7.0:GL478144:76380:93696:1 g... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391734.393e-5437.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346921.202e-5335.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415381.051e-5231.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408891.439e-4931.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431471.528e-4933.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glra4a2.922e-8035.31glycine receptor subunit alpha-4-like [Source:NCBI... [more]
ENSORLT00000025211.22.096e-7933.18glycine receptor subunit alpha-3 [Source:NCBI gene... [more]
glra13.189e-7935.01glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra15.447e-7935.75glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
glra15.994e-7935.01glycine receptor alpha 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine receptor subunit alpha-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041885.10.000e+0100.00SMESG000041885.1[more]
SMESG000077704.10.000e+071.36SMESG000077704.1[more]
SMESG000037124.10.000e+060.54SMESG000037124.1[more]
SMESG000032691.10.000e+062.89SMESG000032691.1[more]
SMESG000061905.11.358e-17464.55SMESG000061905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018078 ID=SMED30018078|Name=Glycine receptor subunit alpha-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1556bp
AAATTTTCAAGAGATGAAATTAATACTAATTATATTTTTGTTTAAGTGAT
CCTTTTATTCCGATAGATTCCGACAGAAATCTTTGAGGGTCTTTGGAAAT
CAACAATGAATCCGATCTTTTTCATTGTCTTGGTTTTATTGTTGAATTCT
CTTCGATTGCTCTCAATTCCAAGACGAAAGAGTCCGATGGCTCAACAGAG
GGATTTAATTATGGAAAGGATAGTCGATAAGAAACGTTACAAAAAAGATG
AACGTCCAAGTGAAATTTATCAGACAAATGTGTTGGTTTATATGAAAGTG
TTGGCAATCAATTCGGTTAGTGTGACAAAAATGGAATATTCTACAGACGT
TTACCTCCGACAAGAATGGACAGATCCGAGATTGACTTGGGAGAATTTAG
AAGAATTTCGATCATTTAATAACAATATCGTATCACCGTCATTGAAAAAG
ATATTATGGTTGCCTGATCTGTTTTTCCGGAATGGAAAAGAGGGCTATGT
TCATAAAATGACTCTTCCAAATTATCTAATGCGACTCCGTCCAAATGGGA
GAATTCTCTACAGTCAGAAAATAACGATGAGATTTTCCTGTGAAATGAAC
CTCCAGACCTTTCCTATGGACAGTCAAGAATGCTTAATGGATATCGGCAG
TTATGGTTACACTTTAGATGAATTGAAATTCACTTGGAGAAAAGAGGATC
CAATTTTAATCTCAACTGGTCTTCAGATATCGGAATTTAATTCCCCTCAT
CAAGTCAGCACTATTGACTGCACAAATGACTCGAGTACGTCAACTGGAAA
ATATACTTGTTTAAAAGCGAAATTCTTATTACAAAGACAATTGGGATCCT
ATTTAGTTAGTACATTCGTTCCTAGTATACTCATTGTGATGGTGTCATGG
TTGAACTTTTGGATTAATGTCGATTCAGTTCCAGCTCGTGTTACTTTGGG
TCTCGTTACACTGTTGGGCATGTTGACTCAGGCGACCGGGATATCGTCTA
CTTTACCAAGAGTCAGTTATATAAAAGCTATTGATGTTTGGGTAATCGCT
TGCATTATGTTTGTCATTGGAGCTCTATTGGAATACGTAGTTGCCAGTGT
TCTTGCCAGAAAGAAAAAATCTAACGGTTGGGAAAAGGACGTCCGAGAAA
TCGTGAGACATGAATTAGCTAGATGGTGCTCAGCTTGTCAGAGACAGCAA
TTCTTTCATCTCCAAGAACAAAATACTCTTGACAGAAATAGGTTGGAGTT
TTGTTCTGAACTTGAATCTTTACTGATTAATCACGCATTGGACGCTCACA
AGGGCAAGAAAACCATCAAGACAACGCCGACTGAAGATTCTGATATTGAT
AGCTATAGCCGATTTCTCTTCCCAGCATGTTTTCTTTTATATAATTGCTT
TTACTGGTTATACTATTTAGTATTAGTTCATTATGCTCAGAATATTTCCT
AATGAATACTTTAAAATAACTTTTTTCATAAATTTAGATATTTTAGAGAA
GATACAGAAATGTACATAAAAGGAAACTTTTTATTCGCAGATTTAGATGA
TTTCAC
back to top

protein sequence of SMED30018078-orf-1

>SMED30018078-orf-1 ID=SMED30018078-orf-1|Name=SMED30018078-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MNPIFFIVLVLLLNSLRLLSIPRRKSPMAQQRDLIMERIVDKKRYKKDER
PSEIYQTNVLVYMKVLAINSVSVTKMEYSTDVYLRQEWTDPRLTWENLEE
FRSFNNNIVSPSLKKILWLPDLFFRNGKEGYVHKMTLPNYLMRLRPNGRI
LYSQKITMRFSCEMNLQTFPMDSQECLMDIGSYGYTLDELKFTWRKEDPI
LISTGLQISEFNSPHQVSTIDCTNDSSTSTGKYTCLKAKFLLQRQLGSYL
VSTFVPSILIVMVSWLNFWINVDSVPARVTLGLVTLLGMLTQATGISSTL
PRVSYIKAIDVWVIACIMFVIGALLEYVVASVLARKKKSNGWEKDVREIV
RHELARWCSACQRQQFFHLQEQNTLDRNRLEFCSELESLLINHALDAHKG
KKTIKTTPTEDSDIDSYSRFLFPACFLLYNCFYWLYYLVLVHYAQNIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006028GABAA/Glycine_rcpt
IPR006201Neur_channel
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 79..95
score: 44.02
coord: 240..252
score: 29.76
coord: 162..176
score: 48.11
coord: 116..127
score: 44.08
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 13..437
e-value: 1.6E-100
score: 335.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 20..439
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 249..269
score: 42.18
coord: 275..296
score: 47.67
coord: 309..330
score: 40.47
coord: 417..437
score: 47.79
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 23..243
e-value: 4.3E-64
score: 217.7
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 44..245
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 35..245
e-value: 1.5E-43
score: 148.8
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 254..363
e-value: 7.5E-25
score: 88.4
NoneNo IPR availablePANTHERPTHR18945:SF455GLYCINE RECEPTOR SUBUNIT ALPHA-3coord: 20..439
NoneNo IPR availableCDDcd18987LGIC_ECD_anioncoord: 57..245
e-value: 4.67341E-71
score: 220.628
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 249..434
e-value: 1.33165E-46
score: 154.532
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.738
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
NoneNo IPR availableTMHMMTMhelixcoord: 279..301
NoneNo IPR availableTMHMMTMhelixcoord: 247..269
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
NoneNo IPR availableTMHMMTMhelixcoord: 308..330
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 162..176
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 249..443