DDE_Tnp_IS1595 domain-containing protein

Overview
NameDDE_Tnp_IS1595 domain-containing protein
Smed IDSMED30018069
Length (bp)648
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_Tnp_IS1595 domain-containing protein (SMED30018069) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_Tnp_IS1595 domain-containing protein (SMED30018069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_Tnp_IS1595 domain-containing protein (SMED30018069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_Tnp_IS1595 domain-containing protein (SMED30018069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30018069 dd_Smed_v4_9347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018069 dd_Smed_v4_9347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018069 dd_Smed_v4_9347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-6f10.4 (si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-340])

HSP 1 Score: 80.1073 bits (196), Expect = 1.819e-17
Identity = 48/121 (39.67%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  120 LYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGML----DSYLCEYMWRRRLNGANPFEKILHDIRE 470
            L +V DRS  TL+PII + IR GS + SD WRAY         Y H TVNHS NF++P TG +TQ IE  W   K +  R  G     L      ++  + W  R N      +++HDIR+
Sbjct:  216 LKMVKDRSRTTLVPIITRHIRRGSTVYSDNWRAYLNALQ-PLRYRHLTVNHSENFVDPQTGCHTQHIERAWLAIKAQVSRLRGNKTTKLLREHLKFIQWHYWLGRRNSKGALAQLIHDIRK 335          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-6f10.4 (si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-340])

HSP 1 Score: 80.1073 bits (196), Expect = 1.819e-17
Identity = 48/121 (39.67%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  120 LYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGML----DSYLCEYMWRRRLNGANPFEKILHDIRE 470
            L +V DRS  TL+PII + IR GS + SD WRAY         Y H TVNHS NF++P TG +TQ IE  W   K +  R  G     L      ++  + W  R N      +++HDIR+
Sbjct:  216 LKMVKDRSRTTLVPIITRHIRRGSTVYSDNWRAYLNALQ-PLRYRHLTVNHSENFVDPQTGCHTQHIERAWLAIKAQVSRLRGNKTTKLLREHLKFIQWHYWLGRRNSKGALAQLIHDIRK 335          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-17m8.2 (si:dkey-17m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-234])

HSP 1 Score: 80.1073 bits (196), Expect = 1.936e-17
Identity = 48/121 (39.67%), Postives = 63/121 (52.07%), Query Frame = 3
Query:  120 LYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGML----DSYLCEYMWRRRLNGANPFEKILHDIRE 470
            L +V DRS  TL+PII + IR GS + SD WRAY         Y H TVNHS NF++P TG +TQ IE  W   K +  R  G     L      ++  + W  R N      +++HDIR+
Sbjct:  197 LKMVKDRSRTTLVPIITRHIRRGSTVYSDNWRAYLNALQ-PLRYRHLTVNHSENFVDPQTGCHTQHIERAWLAIKAQVSRLRGNKTTKLLREHLKFIQWHYWLGRRNSKGALAQLIHDIRK 316          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. UniProt/SwissProt
Match: sp|O86236|Y132A_HAEIN (Uncharacterized transposase-like protein HI_1328.1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1328.1 PE=4 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 6.860e-8
Identity = 32/104 (30.77%), Postives = 53/104 (50.96%), Query Frame = 3
Query:  114 CFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGC---WSLAKQRNKRHFGTHRGMLDSYLCEYMWR 416
             +  VVP+  + TL+PII++ ++P SI+ +D +R+Y  +    F   H  +NHS +F       N   I G    W+ AK+  ++  G  +   + YL E  WR
Sbjct:    5 VYTVVVPNVQSATLLPIIREKVKPDSIVYTDTFRSYDVLDVSEFS--HFRINHSTHF-----AENHNYINGIGNFWNHAKRHLQKFNGIPKEHFELYLKECEWR 101          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A1B6H5F2 (DDE_Tnp_IS1595 domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.11270 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 4.355e-45
Identity = 74/131 (56.49%), Postives = 94/131 (71.76%), Query Frame = 3
Query:   93 FCRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRL-NGANPFEKILHDIREYWPP 482
             C ET DCFL+ V DRSA +LMPII +SI PG+ I+SD+WR+Y+ I N    Y H TVNHS NFI+P TGA+   ++  W +AK   +R +GTH  +LDSYLCE+MWR+RL +G NPFE IL DI  +WPP
Sbjct:  155 ICHETKDCFLFAVEDRSAASLMPIIVESIAPGTRIVSDKWRSYNGIRNANSNYDHNTVNHSENFIDPGTGAHINTVKRMWGVAKSSFRRQYGTHSKLLDSYLCEFMWRKRLTDGTNPFEAILQDIAAFWPP 285          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A085N0X9 (DDE_Tnp_IS1595 domain-containing protein OS=Trichuris suis OX=68888 GN=M514_12546 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.524e-45
Identity = 73/129 (56.59%), Postives = 93/129 (72.09%), Query Frame = 3
Query:   96 CRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLN-GANPFEKILHDIREYWP 479
            CRETG+CFL  V DRS+ TL+P++++ +RPG+ II+DEWRAY  +   G  Y H  VNHS NF++P+T A+TQ IE  W+  K+RNK   GT R MLDSY CE+MWRRRL  G + FE ILH+I  YWP
Sbjct:   63 CRETGECFLVQVADRSSKTLIPVVKEHVRPGTTIITDEWRAYRALAKEG--YTHLRVNHSTNFVHPMTRAHTQTIESLWAQIKRRNKIRCGTRRTMLDSYFCEFMWRRRLQPGEDVFENILHEIAAYWP 189          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A2S2PWR0 (DDE_Tnp_IS1595 domain-containing protein OS=Sipha flava OX=143950 GN=g.129255 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 8.206e-44
Identity = 75/131 (57.25%), Postives = 91/131 (69.47%), Query Frame = 3
Query:   93 FCRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYWPPA 485
             CRET +CF+  VPDR  NTLMPII + IR G  IISD WRAY+ I      Y H TVNH  NF++PI+GA+TQ +E  W  AK  NK+H GT R  LDSYL E+MW  +LNG +PF+K+L DI E+WPPA
Sbjct:  123 ICRETNECFVVCVPDRLENTLMPIICERIRVGLTIISDSWRAYNNIQQTDH-YTHLTVNHKYNFVDPISGAHTQNVERMWGSAKWGNKKHRGTKRNFLDSYLSEFMWGSKLNGRDPFKKMLKDIAEFWPPA 252          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: J9L4Y5 (DDE_Tnp_IS1595 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.754e-41
Identity = 73/129 (56.59%), Postives = 90/129 (69.77%), Query Frame = 3
Query:   96 CRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYWPP 482
            CRET  CF+  VPDRS  TL+PIIQ+ I PGSII+SD W+AY+ +  +GF   H TVNH+ NF+N  TGA+TQ IE  W  AK  NK+H  T+R  L+SYL E+MWR RL   + FE IL DI E+WPP
Sbjct:   49 CRETKACFIISVPDRSEKTLLPIIQRYIIPGSIILSDCWKAYNNLQQVGFK--HNTVNHTYNFVNSDTGAHTQDIERLWGSAKWGNKKHRRTNRHFLESYLAEFMWRTRLGEQDAFETILKDISEFWPP 175          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A5S6Q554 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.026e-41
Identity = 71/130 (54.62%), Postives = 93/130 (71.54%), Query Frame = 3
Query:   96 CRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLN-GANPFEKILHDIREYWPP 482
            CRETG+CFL  V +RS+ TL+P+I+Q +RPG+ +I+DEWR Y  +   G GY H TVNHS+ F+ P TGA+TQ +E  W+  K+ NK   GT R  LDSYLCE+MWRRRL    +PF+ I++DI  YWPP
Sbjct:  167 CRETGECFLVPVGNRSSQTLLPLIRQYVRPGTTVITDEWRGYRGLA--GSGYTHLTVNHSLQFVQPETGAHTQTVESLWAQVKRSNKLRCGTPRRFLDSYLCEFMWRRRLRPRQDPFDCIVNDIATYWPP 294          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO49358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG49])

HSP 1 Score: 77.0258 bits (188), Expect = 5.076e-17
Identity = 45/124 (36.29%), Postives = 64/124 (51.61%), Query Frame = 3
Query:  117 FLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQI----PNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYW 476
            +  VV  R+   L PIIQ+ ++PGS+  SD+W AY  I    PN+     H  V H   F++P+TG NTQ IE  W+  K+  K         L S+L E MWR+      PF+ ++  I  Y+
Sbjct:  177 YYTVVNKRTREVLAPIIQEVLQPGSVFHSDDWGAYRNITAHAPNVS---SHRVVVHKDYFVDPVTGVNTQEIESTWARVKRMVKSKKRIPTADLQSHLDEVMWRQWRGEKCPFDNMVLLISRYY 297          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO44629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVE9])

HSP 1 Score: 69.3218 bits (168), Expect = 3.277e-15
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:   81 GGCSFCRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAY----SQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFG 368
            G  S        +  +VP R A TL+PIIQ+++ PGS + SD+W AY    +++PN+        V H  NF++PITG +TQ IE  WS  K   K   G
Sbjct:   39 GVLSTAYSPSRGYFQLVPRRDAETLLPIIQRALLPGSTVHSDDWAAYRRLQARLPNVVAN--QGVVVHRYNFVDPITGVHTQNIESLWSRLKSTVKERRG 136          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO49589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR9])

HSP 1 Score: 66.6254 bits (161), Expect = 1.249e-14
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 3
Query:  177 IRPGSIIISDEWRAYSQI----PNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYW 476
            ++PGS++ SD+W AY  I    PN+     H  V H   F++P+TG NTQ IE  W+  K+  K   G     L S+L E MWR+      PF+ ++  I  Y+
Sbjct:    1 LQPGSVLHSDDWGAYRNITAHAPNVSS---HRVVVHKDYFVDPVTGVNTQEIESTWARVKRMVKSKKGIPTADLQSHLDEVMWRQWRGEKCPFDNMVLLISRYY 101          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO27703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8I3])

HSP 1 Score: 65.0846 bits (157), Expect = 5.346e-14
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 3
Query:  177 IRPGSIIISDEWRAYSQI----PNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYW 476
            ++PGS++ SD+W  Y  I    PN+     H  V H   F++P+TG NTQ IE  W+  K+  K   G     L S+L E MWR+      PF+ ++  I  Y+
Sbjct:    1 LQPGSVLHSDDWGTYRNITAHAPNVSS---HRVVVHKDYFVDPVTGVNTQEIESTWARVKRMVKSKKGIPTADLQSHLDEVMWRQWRGEKCPFDNMVLLISRYY 101          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO33828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR40])

HSP 1 Score: 65.855 bits (159), Expect = 5.681e-14
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:   81 GGCSFCRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAY----SQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFG 368
            G  S        +  +VP R A TL+ IIQ+++ PGS + SD+W AY    +++PN+        V H  NF++PITG +TQ IE  WS  K   K   G
Sbjct:   39 GVLSTAYSPSRGYFQLVPRRDAETLLTIIQRALLPGSTVHSDDWAAYRRLQARLPNIVAN--QGVVVHRYNFVDPITGVHTQNIESLWSRLKSTVKERRG 136          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000054196.1 (SMESG000054196.1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.394e-26
Identity = 55/117 (47.01%), Postives = 75/117 (64.10%), Query Frame = 3
Query:  102 ETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAK---QRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPF 443
            +T + F++ V  R A TL+P+I + + PG+ I+SD WRAY  I +LGF   HE V H  NFI+P TGANTQ IE  W  AK    + KR  GT  G+L S+L E+++R+R +G N F
Sbjct:   94 DTNEMFMFYVEKRDAATLLPLIVEHVEPGTTIVSDGWRAYLNIISLGF--FHEVVKHEENFIDPTTGANTQRIECGWGQAKLLIMKLKR--GTTLGLLQSHLDEFVFRKR-HGENVF 205          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000079181.1 (SMESG000079181.1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.703e-18
Identity = 43/103 (41.75%), Postives = 58/103 (56.31%), Query Frame = 3
Query:  117 FLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRL 425
            FL  +  R+  TL  +I++ IRPGSII SD W AY  +  LG  Y H  VN   N+++PI+GA T   E      K RN   +GT R    S+L E++WR+R 
Sbjct:   59 FLVPIEKRNRETLQCMIRKFIRPGSIIHSDFWAAYGDLTVLG--YFHFKVNLEENYVDPISGATTNHQESRCQKVKMRNIMRYGTARTTFGSHLIEFLWRQRF 159          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000074868.1 (SMESG000074868.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.128e-16
Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 3
Query:  117 FLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMW 413
            ++ +V  RSA +L+PI+ + I P SI+ +D WRAY    NL   + H+TVNH + F++  TG +TQ IE  WS  K R K   G    +L+ YL  +MW
Sbjct:  185 YMQLVRSRSAESLLPILLKKIHPESIVRTDMWRAYF---NLNRLFEHQTVNHRLCFVDRSTGVHTQTIESYWSRQKYRLKCLRGIKLSVLNEYLATFMW 280          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000009188.1 (SMESG000009188.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.510e-11
Identity = 46/137 (33.58%), Postives = 68/137 (49.64%), Query Frame = 3
Query:   87 CSFCRETGDCFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYWPPAQ*SS 497
            CSF    G  ++ +VPD+ A T++PII+  +R GSII +D  + YSQ+      Y H+++ H   F++   G +TQ IE   +  K + K            Y  + MW    N    FEK LH I++  P A  SS
Sbjct:  118 CSFSPAKG--YMCLVPDKKAETIIPIIEIYVRKGSIIHTDHAKIYSQVDKKA-SYEHKSIVHKYKFVDYKNGVHTQKIESYNNKIKLKIKEMRCIKENC--RYCVDIMWLDN-NKNECFEKTLHFIKK-SPAATRSS 247          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000048736.1 (SMESG000048736.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.540e-11
Identity = 31/85 (36.47%), Postives = 46/85 (54.12%), Query Frame = 3
Query:  114 CFLYVVPDRSANTLMPIIQQSIRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEGCWSLAKQRNKRHFG 368
             +  ++PD+  NT++PII   +   SII +DE ++YS +    F Y H TV H  +++   TG NTQ IE   +  K   KR  G
Sbjct:   33 AYAKIIPDKKQNTIVPIICSQVDNKSIICTDEHKSYSHLD--SFNYYHGTVCHKYDYVRKTTGINTQAIESFHNELKLEIKRRKG 115          
The following BLAST results are available for this feature:
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-6f10.41.819e-1739.67si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-34... [more]
si:dkey-6f10.41.819e-1739.67si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-34... [more]
si:dkey-17m8.21.936e-1739.67si:dkey-17m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-23... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O86236|Y132A_HAEIN6.860e-830.77Uncharacterized transposase-like protein HI_1328.1... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6H5F24.355e-4556.49DDE_Tnp_IS1595 domain-containing protein (Fragment... [more]
A0A085N0X96.524e-4556.59DDE_Tnp_IS1595 domain-containing protein OS=Trichu... [more]
A0A2S2PWR08.206e-4457.25DDE_Tnp_IS1595 domain-containing protein OS=Sipha ... [more]
J9L4Y51.754e-4156.59DDE_Tnp_IS1595 domain-containing protein OS=Acyrth... [more]
A0A5S6Q5542.026e-4154.62Uncharacterized protein OS=Trichuris muris OX=7041... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493585.076e-1736.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446293.277e-1539.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495891.249e-1436.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277035.346e-1435.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338285.681e-1438.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054196.19.394e-2647.01SMESG000054196.1[more]
SMESG000079181.16.703e-1841.75SMESG000079181.1[more]
SMESG000074868.11.128e-1641.41SMESG000074868.1[more]
SMESG000009188.11.510e-1133.58SMESG000009188.1[more]
SMESG000048736.11.540e-1136.47SMESG000048736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018069 ID=SMED30018069|Name=DDE_Tnp_IS1595 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=648bp
TGGCCCTGGTTTACATGTAGAGATTGATGAATCTCTATTTTCCAGGAAAA
AAAACAACGTTGGACGGGTTTATACACAACGGTGGGTGTTCTTTTTGTAG
GGAAACTGGGGATTGCTTTCTTTACGTCGTTCCTGATCGCTCGGCAAACA
CCTTAATGCCCATCATACAGCAATCCATAAGACCAGGGTCAATTATAATA
TCTGATGAATGGCGGGCATATAGTCAAATTCCAAACCTGGGATTTGGTTA
CGTGCATGAAACAGTCAACCATTCAGTAAATTTCATTAATCCCATTACCG
GTGCAAACACACAAATGATTGAAGGATGTTGGAGTTTAGCGAAACAAAGA
AATAAGCGTCATTTTGGGACGCATCGTGGCATGTTAGATAGTTATTTATG
TGAGTATATGTGGCGACGAAGATTAAATGGTGCAAATCCATTTGAAAAGA
TTTTACATGATATCCGTGAATACTGGCCACCTGCCCAATGATCGAGTTAT
TAAAATGATATCCTAAAGATTGATTGCTAAAGAATTAATTATTTAAGAAT
CTTTCTTTTAGTGGAAATACATGGATTTAGGTATATTTAGGTTTGATAAT
TCCGATTATATTTAGAATCAGTTTTGTCAATTATCCCAAAAAGCTGAG
back to top

protein sequence of SMED30018069-orf-1

>SMED30018069-orf-1 ID=SMED30018069-orf-1|Name=SMED30018069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MNLYFPGKKTTLDGFIHNGGCSFCRETGDCFLYVVPDRSANTLMPIIQQS
IRPGSIIISDEWRAYSQIPNLGFGYVHETVNHSVNFINPITGANTQMIEG
CWSLAKQRNKRHFGTHRGMLDSYLCEYMWRRRLNGANPFEKILHDIREYW
PPAQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR024445Tnp_ISXO2-like