ADAMTS-like protein 3

Overview
NameADAMTS-like protein 3
Smed IDSMED30018067
Length (bp)1915
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADAMTS-like protein 3 (SMED30018067) t-SNE clustered cells

Violin plots show distribution of expression levels for ADAMTS-like protein 3 (SMED30018067) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADAMTS-like protein 3 (SMED30018067) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADAMTS-like protein 3 (SMED30018067) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018067

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30018067SMESG000073115.1 dd_Smed_v6_12413_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30018067SMESG000073115.1 dd_Smed_v4_12413_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018067SMESG000073115.1 dd_Smed_v4_12413_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30018067SMESG000073115.1 dd_Smed_v4_12413_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 98.2117 bits (243), Expect = 1.769e-20
Identity = 85/304 (27.96%), Postives = 128/304 (42.11%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYE-KGLITPTNKRSCHSRKCLMEKS--------TNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            +  W  CS TCG G Q +   C           P E C ++      ++ CN  DC  G  W+   W +CS +CG  G Q R V C     D    ++ D+ C+   K  + ++C R +CPP      W  C     C  GIQ R   C  L   G  + L    C +  GL      RSC   +C   KS           +I    R  +Q    KR+++ +G  ++++  T + +KC +++F K  I W    ++     Q   RL I+K+G + I   +  D G + C AGS    + LK
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCLHPGETPA---PPEECRDEKPH--ALQACNQFDCPPG--WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQG-PKASSHKSCARTDCPPHLAVGDWSKC--SVSCGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLPL---VRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW----EKDGRCLQNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 68.1662 bits (165), Expect = 4.542e-11
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  424 WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEAS-RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN 804
            W  G+W+ CS +CG+ G + +  +C+ + G+ V +  C+  +KP A    C   +CP ++ +S W  C     C  G   R + C     NGTV  +   AC  K    P  ++ C    C+  +  N
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQC--SVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKD--RPLGRKPCFGHPCVQWEPGN 1551          

HSP 3 Score: 64.3142 bits (155), Expect = 6.102e-10
Identity = 73/340 (21.47%), Postives = 119/340 (35.00%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDW-EIRNIQLQSDLPNVL--TKLSVIMKDIAR--------WVAGKWSKCSISCESTGHQFRSVYC---------EKLYDHFYYRLEDEE----------------------CLKHLEEKP--------------TSKRQCSV---PFG--------CPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            L + +G +     G  ++++C +K  P+ NI W+ +             + +  NG +++   S  +EG ++C A +  GK  + +  L    R W E R + LQ     +L  T       D           W  G WS CS +C   G + +   C         E L DH    L   E                      C +    +                S R C+    P G        C +WE  N    +C   C+G    +   +  C      ++   CD + +P +   C +  C V W   PW  C+ +CG  G Q+R + C+
Sbjct: 1301 LSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLS------GNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKA-VATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGN----RCPGRCMGRAVRMQQRHTACQHNSSDSN---CDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCI 1625          

HSP 4 Score: 59.6918 bits (143), Expect = 1.903e-8
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYC---SNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDS--EGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVS 681
            C+ TCG GYQ     C    L  V  +P  YC      +   P +++C+   C  ++GF              W    WT CS SCG  GIQ R   C++    GE   V++  C    KP+  + C  ++C PK+I+  W  C     C  G++YR + C++
Sbjct:  351 CTVTCGGGYQLNSAECVDIRLKRV--VPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCT--VTCGRGLRYRVVLCIN 507          

HSP 5 Score: 54.299 bits (129), Expect = 7.446e-7
Identity = 45/169 (26.63%), Postives = 68/169 (40.24%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNG-----------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            FI E   WS+CS TCG G Q +   C     +            +   +PT R C    C                    + W    +T C+ +C   G Q     CL  + + +V+D  C+   +P A S+ C    CPP++   +W PC   + C  GIQ R ++C+
Sbjct:  568 FIPE--PWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPC--SATCGVGIQTRDVYCL 731          

HSP 6 Score: 52.7582 bits (125), Expect = 2.650e-6
Identity = 60/192 (31.25%), Postives = 81/192 (42.19%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPK-WEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDI--------KAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC---VWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            RW  G W  CS +C   G Q R VYC    +        EEC    +EKP + + C+  F CP  W I   +  QCS  C   G    N  V C  R   TD    ++        KA     CA   C     +  W++CS SCG  GIQ R  +C     K   +P  ++  +    LP +++SC  P+C
Sbjct:  706 RWHVGSWGPCSATC-GVGIQTRDVYCLHPGE---TPAPPEECR---DEKPHALQACNQ-FDCPPGWHIE--EWQQCSRTC---GGGTQNRRVTC--RQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGV-GIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLP-LVRSCQMPEC 880          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 98.2117 bits (243), Expect = 1.818e-20
Identity = 84/303 (27.72%), Postives = 127/303 (41.91%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKS--------TNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            +  W  CS TCG G Q +   C           P E C ++      ++ CN  DC  G  W+   W +CS +CG  G Q R V C     D    ++ D+ C+   K  + ++C R +CPP      W  C     C  GIQ R   C  L   G  + L    C  + L      RSC   +C   KS           +I    R  +Q    KR+++ +G  ++++  T + +KC +++F K  I W    ++     Q   RL I+K+G + I   +  D G + C AGS    + LK
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCLHPGETPA---PPEECRDEKPH--ALQACNQFDCPPG--WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQG-PKASSHKSCARTDCPPHLAVGDWSKC--SVSCGVGIQRRKQVCQRLAAKGRRIPLSEMMC--RDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW----EKDGRCLQNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 77.7962 bits (190), Expect = 4.697e-14
Identity = 88/405 (21.73%), Postives = 144/405 (35.56%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDW-EIRNIQLQSDLPNVL--TKLSVIMKDIAR--------WVAGKWSKCSISCESTGHQFRSVYC---------EKLYDHFYYRLEDEE----------------------CLKHLEEKP--------------TSKRQCSV---PFG--------CPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTCR 1860
            L + +G +     G  ++++C +K  P+ NI W+ +             + +  NG +++   S  +EG ++C A +  GK  + +  L    R W E R + LQ     +L  T       D           W  G WS CS +C   G + +   C         E L DH    L   E                      C +    +                S R C+    P G        C +WE  N    +C   C+G    +   +  C      ++   CD + +P +   C +  C V W   PW  C+ +CG  G Q+R + C+   +  P     + +  K P   + C  P C   C D    C   K    C ++ +  RCC++C+
Sbjct: 1301 LSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLS------GNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKA-VATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGN----RCPGRCMGRAVRMQQRHTACQHNSSDSN---CDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKR-HCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQ 1689          

HSP 3 Score: 68.1662 bits (165), Expect = 4.585e-11
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  424 WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEAS-RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN 804
            W  G+W+ CS +CG+ G + +  +C+ + G+ V +  C+  +KP A    C   +CP ++ +S W  C     C  G   R + C     NGTV  +   AC  K    P  ++ C    C+  +  N
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQC--SVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKD--RPLGRKPCFGHPCVQWEPGN 1551          

HSP 4 Score: 59.3066 bits (142), Expect = 2.057e-8
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYC---SNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDS--EGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVS 681
            C+ TCG GYQ     C    L  V  +P  YC      +   P +++C+   C  ++GF              W    WT CS SCG  GIQ R   C++    GE   V++  C    KP+  + C  ++C PK+I+  W  C     C  G++YR + C++
Sbjct:  351 CTVTCGGGYQLNSAECVDIRLKRV--VPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCT--VTCGRGLRYRVVLCIN 507          

HSP 5 Score: 54.299 bits (129), Expect = 8.836e-7
Identity = 45/169 (26.63%), Postives = 68/169 (40.24%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNG-----------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            FI E   WS+CS TCG G Q +   C     +            +   +PT R C    C                    + W    +T C+ +C   G Q     CL  + + +V+D  C+   +P A S+ C    CPP++   +W PC   + C  GIQ R ++C+
Sbjct:  568 FIPE--PWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPC--SATCGVGIQTRDVYCL 731          

HSP 6 Score: 52.373 bits (124), Expect = 2.675e-6
Identity = 60/192 (31.25%), Postives = 81/192 (42.19%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPK-WEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDI--------KAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC---VWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            RW  G W  CS +C   G Q R VYC    +        EEC    +EKP + + C+  F CP  W I   +  QCS  C   G    N  V C  R   TD    ++        KA     CA   C     +  W++CS SCG  GIQ R  +C     K   +P  ++  +    LP +++SC  P+C
Sbjct:  706 RWHVGSWGPCSATC-GVGIQTRDVYCLHPGE---TPAPPEECR---DEKPHALQACNQ-FDCPPGWHIE--EWQQCSRTC---GGGTQNRRVTC--RQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGV-GIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLP-LVRSCQMPEC 880          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 96.2857 bits (238), Expect = 2.119e-20
Identity = 95/370 (25.68%), Postives = 149/370 (40.27%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI------------RNIQ----------LQSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            L   LG    +  G    L C IK  P  NI W H  Q           + ++    + +   S   +GE+ C A + +G L  K+  + + Y  W +            R +Q           + +  +   K+   ++ IA        RW+   WS C+ SC   G Q R V C+KL           +    + ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     + +C+      P   + C    C  ++C D  + CEK K  K C +  F  RCC TC
Sbjct:   99 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHI-LAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSCGG-GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWG--PRPANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 460          

HSP 2 Score: 54.299 bits (129), Expect = 4.852e-7
Identity = 31/123 (25.20%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN G+Q   + CL +  E        K R       C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct:  190 YWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS--CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVA-KRPVDTQACNQQLCV 309          

HSP 3 Score: 53.1434 bits (126), Expect = 1.016e-6
Identity = 45/199 (22.61%), Postives = 79/199 (39.70%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVEN-IPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +  WS+C+ +CG G Q +   C +     +   +  + C+         + CN   C     W    W +C+  C   +  +Q R+V C   +G ++  + C    +P +++NC    C   +  S W  C +    + G Q R + CV    N  V +      P  A +++  ITP     C       EK   L++
Sbjct:  252 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCG-NYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKVKQLKL 446          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 94.7449 bits (234), Expect = 2.465e-19
Identity = 94/369 (25.47%), Postives = 147/369 (39.84%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI------------RNIQ----------LQSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            L   LG    +  G    L C IK  P  NI W H  Q           + ++    + +   S   +GE+ C A + +G L  K+  + + Y  W +            R +Q           + +  +   K+   ++ IA        RW+   WS C+ SC   G Q R V C+KL           +    + ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     +       + P   + C    C  ++C D  + CEK K  K C +  F  RCC TC
Sbjct: 1398 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHI-LAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGPR-PANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 1759          

HSP 2 Score: 88.1965 bits (217), Expect = 2.906e-17
Identity = 88/339 (25.96%), Postives = 135/339 (39.82%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP---TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG--TVVK------LPFEACYEKGLIT-------PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSD 1176
            P   EI  WS CS TCG G Q   R  F + L   E       +++L   P   T++ CN  +C     W    W  CS +CG  G+Q REV C     D     + + FC    KP   + CK+ +CP +++ S W  C   + C  G Q RS  C  +L  G  TVV       LPF +     ++        P+ K S H             I    +  +Q    ++L   +G  ++++  T + L+C  ++  K  I W    Q       +   + ++  G + I +    D G + C AG       +K   L  G R    R +  +S+
Sbjct:  667 PARWEIGKWSPCSLTCGVGLQ--TRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPP--AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFCSA-SKPACQQACKKDDCPSEWLLSDWTEC--STSCGEGTQTRSAICRKMLKTGLSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPH-------------IAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQH----LISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIK---LIGGNRKLVARPLSPRSE 977          

HSP 3 Score: 79.337 bits (194), Expect = 1.554e-14
Identity = 56/193 (29.02%), Postives = 88/193 (45.60%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD------SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   ++ CS++CG G Q+ +  C   QT     EN+    C         ++ CN   C     W  G W+ CS +CG  G+QTR+V C        +E   + D+ C +  KP   + C R+NCPP +  + W+PC     C  G+Q R + C   + +G+ ++LP   C       P  +++C    C  E
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQTREPAEENL----CVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCG-VGLQTRDVFCSHLLSREMNETVILADELCRQ-PKPSTVQACNRFNCPPAWYPAQWQPC--SRTCGGGVQKREVLCKQRMADGSFLELPETFCSAS---KPACQQACKKDDCPSE 791          

HSP 4 Score: 63.1586 bits (152), Expect = 1.628e-9
Identity = 50/175 (28.57%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  223 KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +P IH   E + +  CS TCG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C++ + +    SV++  C    K   ++ C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  295 QPIIHRWRETDFFP-CSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCT--VTCGQGLRYRVVLCI 464          

HSP 5 Score: 59.3066 bits (142), Expect = 2.018e-8
Identity = 61/215 (28.37%), Postives = 92/215 (42.79%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYL---VENIPFEYCSNQLTVIPTIRKCNYGDC-----------TNG-----------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEG-ESVDDKFCEKFRK-PEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD---NGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            FI E   WS+C+ TCG G Q ++  C Q  L     V ++P + C        + R C  G C           T+G           + W    +T+CS SCG  G+Q   V CL+ +  E  ++  C   R+ P+  ++C    CP ++    W PC     C  G+Q R + C  LL    N TV+ L  E C +     P+  ++C+   C
Sbjct:  526 FIPE--AWSACTVTCGVGTQVRIVRC-QVLLSFSQSVADLPIDECEGPKPA--SQRACYAGPCSGEIPEFNPDETDGLFGGLQDFDELYDWEYEGFTKCSESCGG-GVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPC--SLTCGVGLQTRDVFCSHLLSREMNETVI-LADELCRQP---KPSTVQACNRFNC 728          

HSP 6 Score: 56.6102 bits (135), Expect = 1.471e-7
Identity = 59/187 (31.55%), Postives = 77/187 (41.18%), Query Frame = 1
Query: 1138 RDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGCP-KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCD----IKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            R+    N+ + S  P  L K   +    ARW  GKWS CS++C   G Q R V+C  L          L DE C    + KP++ + C+  F CP  W  +      CS  C   G  +    V C  R                +KP     C    C  +W +S WT+CS SCGE G Q R  IC
Sbjct:  640 REPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNR-FNCPPAWYPAQ--WQPCSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          

HSP 7 Score: 55.8398 bits (133), Expect = 2.351e-7
Identity = 53/217 (24.42%), Postives = 79/217 (36.41%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   W++CS +CG G Q +   C +  +        E+       +P  + CN  DC     W    W+ C+ +CG  G++ R V C+D  G  +    C    KP     C         +   P                       P FI  AW  C     C  G Q R + C  LL  + +V  LP + C       P ++R+C++  C  E
Sbjct:  381 EATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPK---WLAQEWSPCTVTCGQ-GLRYRVVLCIDHRG--MHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACT--VTCGVGTQVRIVRCQVLLSFSQSVADLPIDECEGP---KPASQRACYAGPCSGE 586          

HSP 8 Score: 53.1434 bits (126), Expect = 1.683e-6
Identity = 31/123 (25.20%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN G+Q   + CL +  E        K R       C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct: 1489 YWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS--CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAK-RPVDTQACNQQLCV 1608          

HSP 9 Score: 52.373 bits (124), Expect = 3.472e-6
Identity = 45/199 (22.61%), Postives = 79/199 (39.70%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVEN-IPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +  WS+C+ +CG G Q +   C +     +   +  + C+         + CN   C     W    W +C+  C   +  +Q R+V C   +G ++  + C    +P +++NC    C   +  S W  C +    + G Q R + CV    N  V +      P  A +++  ITP     C       EK   L++
Sbjct: 1551 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCG-NYGFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCENMECRDTTRYCEKVKQLKL 1745          
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Match: ADAMTS9 (ADAM metallopeptidase with thrombospondin type 1 motif 9 [Source:HGNC Symbol;Acc:HGNC:13202])

HSP 1 Score: 85.5001 bits (210), Expect = 1.711e-16
Identity = 124/512 (24.22%), Postives = 188/512 (36.72%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLV---------------ENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVS----HIIFGTRL------SLKCSIKKFPKRNIIWIHKSQQFRY----KFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYC-EKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC-IFRDQPTDLKRCDIKAKPMME--CANLGCRV-KWKISPWTQCSRSCGENGIQARYLICV 1671
            +   W  CS TCG GYQ +   C   T   V               ++     C +     P  R+  Y        W  G WT CS +CG  G + R V C D  G   D+  C    +P A   C    C  ++ +  W  C     C  G   R + CV+  D+  + +   +  Y      P   + C    C          +  +  L Q  P +  D +    S    H++ G +       +   +     +R ++       +      +    D  R  ++G      +    E   +C  G +  +L +  R+  E + D     +    D     T         A W  G WS CS+SC   GH+ R+VYC  K   H    LE + C KHL  KP   R+C     CPKW+      SQCS  C   GR +   +V C I   +      C+   +P  E  C    C +  W+   W +C+++CGE G + R ++CV
Sbjct:  168 QAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSC-HPPPAAPETRRSTYS--APRTQWRFGSWTPCSATCGK-GTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCG-QWKALDWSSC--SVTCGQGRATRQVMCVNYSDH-VIDRSECDQDY-----IPETDQDCSMSPCPQ--------RTPDSGLAQH-PFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCPQWAYGNWGECTKLC-GGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTH---ACPHDAAWSTGPWSSCSVSC-GRGHKQRNVYCMAKDGSH----LESDYC-KHL-AKPHGHRKCRGGR-CPKWKAGA--WSQCSVSC---GRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGE-GSRYRKVVCV 639          

HSP 2 Score: 68.5514 bits (166), Expect = 2.994e-11
Identity = 116/530 (21.89%), Postives = 192/530 (36.23%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVE-----NIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISS--AWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDE----GEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMK----DIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQ-PTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKC 1776
               W+ CS TCG G + +   C      + +      +P      + +V P  +            W    W+ CS +CG  G  TR+V C++     +D   C++   PE  ++C    CP +   S  A  P  ++   D   +  S     +L        P+ AC      + T       R  + +          N  + ++ P ++   + G      +G             +  ++   +S   R+   + + L    +     T    HD     G W   + SVS     K R ++   +D       L+SD    L K     K       +W AG WS+CS+SC   G Q R V C+ +  H   R  + EC  +   +P S+R C  P  CP +     +  +C+  C   G       V C+  ++      RCD+  +P+    C+   C   W    W++CS +CG+ G + R + C    TG    +   Q  +  P        P  L  C
Sbjct:  244 FGSWTPCSATCGKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQ------------WKALDWSSCSVTCGQ-GRATRQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNE---DYRPRSASPSRTHVLGGNQWRTGPWGAC------SSTCAGGSQRRVVVCQDENGYTA---NDCVERIKPDEQRACESGPCPQWAYGNWGECTKLCGGGIRTRLVVCQRSNGERFPDLSCEILDKPPDREQCNTHACPHDAAWSTGPW--SSCSVSCGRGHKQRNVYCMAKD----GSHLESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSC-GRGVQQRHVGCQ-IGTHKIAR--ETECNPYT--RPESERDCQGPR-CPLYTWRAEEWQECTKTC---GEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGK-GYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDC 731          

HSP 3 Score: 63.1586 bits (152), Expect = 1.261e-9
Identity = 43/125 (34.40%), Postives = 60/125 (48.00%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLV-ENIPFEYCSN---QLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKR-YNC 588
            ++     WS CS TCG GY+Q+L  C +  +Y   EN  + Y +      T  P++  C   DC     W  G+W  CS SCG  G+  R V+CL +E +      C    KPE  + C+  YNC
Sbjct:  670 YVWITGEWSECSVTCGKGYKQRLVSCSE--IYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCG-VGVMQRSVQCLTNEDQP--SHLCHTDLKPEERKTCRNVYNC 789          

HSP 4 Score: 59.3066 bits (142), Expect = 2.043e-8
Identity = 51/167 (30.54%), Postives = 76/167 (45.51%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHC------------IGIGRAIMNTNVRCIFRDQPTDLKRCDIK------AKPMMECANLGC-RVKWKISPWTQCSRSCGENGIQARYLIC 1668
            +W +G WS+C ++C   GH+ R V+C+   D    RL D  C    E KPTS + C  P  C  W+       QCS  C            IG   ++++ N  C    +PTD + C++       A P    +     R +W+   WT CS +CG+ G + RY+ C
Sbjct:  111 QWKSGDWSECLVTC-GKGHKHRQVWCQFGED----RLNDRMC--DPETKPTSMQTCQQPE-CASWQAG--PWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDN-DCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK-GTRMRYVSC 265          

HSP 5 Score: 56.6102 bits (135), Expect = 1.255e-7
Identity = 50/154 (32.47%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1216 DIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            +   W    W++CS SC+  G Q R   C    +     L+D +C    +EK T +R CS  F CP+W+  + D S+C   C   G+   +  V C F +   + + CD + KP  M  C    C   W+  PW QCS +CG+ G Q R + C+
Sbjct:   53 NTGGWRYSAWTECSKSCDG-GTQRRRAICVNTRNDV---LDDSKCTH--QEKVTIQR-CSE-FPCPQWK--SGDWSECLVTC---GKGHKHRQVWCQFGEDRLNDRMCDPETKPTSMQTCQQPEC-ASWQAGPWGQCSVTCGQ-GYQLRAVKCI 191          

HSP 6 Score: 55.0694 bits (131), Expect = 4.019e-7
Identity = 113/520 (21.73%), Postives = 184/520 (35.38%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLY--LVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHI-----IFGTRLSL----KCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWI-CKAGSVSGKLQLKSRTLFEGYRD--WEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLE---------DEEC--------------LKHLEEKPTSKRQCSVP-----FGCPKWEISNVDLSQCSNHCIGIG--RAIM------NTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            CS  CG GY+     C + +      E +   +CS+     P+ R+   G+C  G  W    WT CS SC + G Q R   C+++  + +DD  C    K    R C  + C P++ S  W  C+    C  G ++R + C    D     +L    C  +    PT+ ++C   +C                  Q  P  +  +  GQ   +     I GT +S+     C+    P         S          +  R + +      +F     G W  C A    G     +R  +   RD    + +    + LP  + K    +    +W A  WS CS++C   G   R V C    DH   R E         D++C               +H  +    + + + P      G  +W         CS+ C G    R ++       T   C+ R +P + + C+    P           +W    W +C++ CG  GI+ R ++C
Sbjct:    3 CSAQCGLGYRTLDIYCAKYSRLDGKTEKVDDGFCSSHPK--PSNREKCSGECNTGG-WRYSAWTECSKSC-DGGTQRRRAICVNTRNDVLDDSKCTHQEKVTIQR-CSEFPC-PQWKSGDWSECL--VTCGKGHKHRQVWCQFGED-----RLNDRMCDPE--TKPTSMQTCQQPECAS---------------WQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPS--CHPPPAAPETRRSTYSAPRTQWRF-----GSWTPCSATCGKG-----TRMRYVSCRDENGSVADESACATLPRPVAKEECSVTPCGQWKALDWSSCSVTC-GQGRATRQVMCVNYSDHVIDRSECDQDYIPETDQDCSMSPCPQRTPDSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTG--PWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCP-----------QWAYGNWGECTKLCG-GGIRTRLVVC 465          

HSP 7 Score: 53.9138 bits (128), Expect = 9.374e-7
Identity = 39/145 (26.90%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            + W+ CS +C  G Q++  +C  T   ++++     C++Q  V  TI++C+   C     W +G W+ C  +CG  G + R+V C   E + ++D+ C+   KP + + C++  C   + +  W  C     C  G Q R++ C+
Sbjct:   60 SAWTECSKSCDGGTQRRRAICVNTRNDVLDD---SKCTHQEKV--TIQRCSEFPCPQ---WKSGDWSECLVTCGK-GHKHRQVWCQFGE-DRLNDRMCDPETKPTSMQTCQQPEC-ASWQAGPWGQC--SVTCGQGYQLRAVKCI 191          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8937718:-1 gene:WBGene00009958.1 transcript:F53B6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 179.104 bits (453), Expect = 9.870e-48
Identity = 157/621 (25.28%), Postives = 254/621 (40.90%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD--SEGESVD------DKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQL--QSDLPN--------------------VLTKLSVIMKD----------------------IARWVAGKWSKC-SISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNH-CIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTP----PKCLLKCIDVYK---ICEKKKKYCHIEIFYY---------RCCKTC 1857
            E   P+      W+ CS +C  G Q+    C Q +    +++ +  C  +       R CN   C     W T  ++ CS SCG+ G   R V+C    S+ +  D      D  C  F+KP+ +  C    CP  ++++ W  C     CDSG + R + C      G   + P   C         N +      C     +  E+ + NR   Q    K+L + +G V+ +  GT + +KC  KKF K+ I W    +    K +    +++S NG + +      D G + C    + G +     TL   YRD+    + L  +  +P+                    VL K++V + +                      +ARW  G WS+C   +C   G+Q R + C+  +      +++  C      +P   R C     CP+WE S    S+CS+  C+    A    NV C F +  + D++ CDI  +P   M+C N  C+ +W+ S W  CS  CG  G+Q R L CVW  +G PAG  C Q  ++ P   ++C      P C+     +Y+    C+ + ++C I   ++         +CC TC
Sbjct:  113 EDEAPYQWRYGDWTQCSASCLGGKQKAALKCIQVSTG--KSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCH-FKKPQETETCNVVACPATWVTAQWTEC--SRSCDSGERRRQVWCEIRDSRGKTQRRPDVEC-------DANTKPQTVEVCSFGSCSRPEL-LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGK----KIKNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNV-----TLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCEQ--MRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTC 703          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 178.333 bits (451), Expect = 8.052e-47
Identity = 152/608 (25.00%), Postives = 248/608 (40.79%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD--SEGESVD------DKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQS----------------------DLPNVLTKLSVIMKD----------------------IARWVAGKWSKC-SISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNH-CIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTP----PKCLLKCIDVYK---ICEKKKKYCHIEIFYYRC 1845
            E   P+      W+ CS +C  G Q+    C Q +    +++ +  C  +       R CN   C     W T  ++ CS SCG+ G   R V+C    S+ +  D      D  C  F+KP+ +  C    CP  ++++ W  C     CDSG + R + C      G   + P   C         N +      C     +  E+ + NR   Q    K+L + +G V+ +  GT + +KC  KKF K+ I W    +    K +    +++S NG + +      D G + C    + G + L  +     YRD+    + L                        +  +VL K++V + +                      +ARW  G WS+C   +C   G+Q R + C+  +      +++  C      +P   R C     CP+WE S    S+CS+  C+    A    NV C F +  + D++ CDI  +P   M+C N  C+ +W+ S W  CS  CG  G+Q R L CVW  +G PAG  C Q  ++ P   ++C      P C+     +Y+    C+ + ++C I   ++ C
Sbjct:  447 EDEAPYQWRYGDWTQCSASCLGGKQKAALKCIQVSTG--KSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCH-FKKPQETETCNVVACPATWVTAQWTEC--SRSCDSGERRRQVWCEIRDSRGKTQRRPDVEC-------DANTKPQTVEVCSFGSCSRPEL-LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGK----KIKNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCEQ--MRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSC 1024          

HSP 2 Score: 61.6178 bits (148), Expect = 1.450e-9
Identity = 82/381 (21.52%), Postives = 146/381 (38.32%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-----DSEGESVDDKFCEKFRKPEASRNCKRYN-------------------CPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFG--TRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI--RNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCE 1305
            W+ C   CG G +++   C QT   +  ++P  +C N  T       C    C     W  G W++C+ SCG  G++ R V C+     D  G    +  C        + N   +N                     P+ ++  W  C   S C +G+  R++ CV++   +   +KLP   C ++    P    SC  R C +++        D++      P +       Q S    G   + +LKC I+    +++ W     + R   ++      +++        SK+ +    C +G+    ++           D  I  R+ +     P      +V+    A WV  +W++CS SC+S G + R V+CE
Sbjct:  244 WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCENG-TRPAAEENCVSTSCGR---WEAGKWSKCTASCGQ-GVRRRHVACVGGSDCDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTC--SSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQE--QPKLFESCEVRSCPLQE--------DSKLSEDEAPYQWRYGDWTQCSASCLGGKQKAALKC-IQVSTGKSVQWSQCDARRRPPEKSRP---CNQHPCPPFWLTSKYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACP-ATWVTAQWTECSRSCDS-GERRRQVWCE 601          

HSP 3 Score: 53.5286 bits (127), Expect = 5.049e-7
Identity = 43/154 (27.92%), Postives = 64/154 (41.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE---SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD 690
            +I  WS    +  S   Q + VC       V  +P + C+++L      R C    C +   W    WT C   CG  G + REV C+ +       V D FCE   +P A  NC   +C  ++ +  W  C   + C  G++ R + CV   D
Sbjct:  180 DIVDWSGAGRSIAS-TSQPIVVCVNAITGRV--VPEKLCADKLRPKVEARPCPMLICPSRCRWMAADWTECVPHCGE-GTRKREVYCVQTAHNVTVHVPDTFCENGTRPAAEENCVSTSC-GRWEAGKWSKCT--ASCGQGVRRRHVACVGGSD 326          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 177.948 bits (450), Expect = 1.011e-46
Identity = 152/608 (25.00%), Postives = 248/608 (40.79%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD--SEGESVD------DKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQS----------------------DLPNVLTKLSVIMKD----------------------IARWVAGKWSKC-SISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNH-CIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTP----PKCLLKCIDVYK---ICEKKKKYCHIEIFYYRC 1845
            E   P+      W+ CS +C  G Q+    C Q +    +++ +  C  +       R CN   C     W T  ++ CS SCG+ G   R V+C    S+ +  D      D  C  F+KP+ +  C    CP  ++++ W  C     CDSG + R + C      G   + P   C         N +      C     +  E+ + NR   Q    K+L + +G V+ +  GT + +KC  KKF K+ I W    +    K +    +++S NG + +      D G + C    + G + L  +     YRD+    + L                        +  +VL K++V + +                      +ARW  G WS+C   +C   G+Q R + C+  +      +++  C      +P   R C     CP+WE S    S+CS+  C+    A    NV C F +  + D++ CDI  +P   M+C N  C+ +W+ S W  CS  CG  G+Q R L CVW  +G PAG  C Q  ++ P   ++C      P C+     +Y+    C+ + ++C I   ++ C
Sbjct:  445 EDEAPYQWRYGDWTQCSASCLGGKQKAALKCIQVSTG--KSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCH-FKKPQETETCNVVACPATWVTAQWTEC--SRSCDSGERRRQVWCEIRDSRGKTQRRPDVEC-------DANTKPQTVEVCSFGSCSRPEL-LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGK----KIKNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCEQ--MRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSC 1022          

HSP 2 Score: 61.2326 bits (147), Expect = 1.705e-9
Identity = 82/381 (21.52%), Postives = 146/381 (38.32%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-----DSEGESVDDKFCEKFRKPEASRNCKRYN-------------------CPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFG--TRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI--RNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCE 1305
            W+ C   CG G +++   C QT   +  ++P  +C N  T       C    C     W  G W++C+ SCG  G++ R V C+     D  G    +  C        + N   +N                     P+ ++  W  C   S C +G+  R++ CV++   +   +KLP   C ++    P    SC  R C +++        D++      P +       Q S    G   + +LKC I+    +++ W     + R   ++      +++        SK+ +    C +G+    ++           D  I  R+ +     P      +V+    A WV  +W++CS SC+S G + R V+CE
Sbjct:  242 WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCENG-TRPAAEENCVSTSCGR---WEAGKWSKCTASCGQ-GVRRRHVACVGGSDCDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTC--SSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQE--QPKLFESCEVRSCPLQE--------DSKLSEDEAPYQWRYGDWTQCSASCLGGKQKAALKC-IQVSTGKSVQWSQCDARRRPPEKSRP---CNQHPCPPFWLTSKYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACP-ATWVTAQWTECSRSCDS-GERRRQVWCE 599          

HSP 3 Score: 50.8322 bits (120), Expect = 3.573e-6
Identity = 110/477 (23.06%), Postives = 175/477 (36.69%), Query Frame = 1
Query:  400 GD-CTNG-FVWNTGH-WTRCSHSCGNF-----------GIQTREVECLDS-EGESVDDKFC-EKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTR--------LSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEG------------------YRDWEIRNIQLQSDLPNVLTKLSVIMKDIA--RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLK---------RCDIKAKPMMECANL-GCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            GD C NG F+W     +T C+ +C +                  V C+++  G  V +K C +K R    +R C    CP +++++ W  CV    C  G + R ++CV    N TV  +P   C E G   P  + +C S  C   ++     K    T      ++R  +     S    G R          + CSI      ++ W  ++      F + D     +  R+V  ++S        C  G +S  ++  +                        +   E+R+  LQ D        S + +D A  +W  G W++CS SC   G Q  ++ C ++      +    +  +   EK     Q   P   P W  S    S CS  C   G      +V+C      TD           RC  K     E  N+  C   W  + WT+CSRSC ++G + R + C
Sbjct:  155 GDTCDNGKFIWKVSEEYTACASNCDDIVDWSGAGRSIASTSQPIVVCVNAITGRVVPEKLCADKLRPKVEARPCPMLICPSRWMAADWTECVP--HCGEGTRKREVYCVQTAHNVTV-HVPDTFC-ENG-TRPAAEENCVSTSCGRWEAG----KWSKCTASCGQGVRRRHVACVGGSDCDEGGRPRQETTCYAGIPCSIAT---NSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTCSS---TCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQED--------SKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCIQVSTGKSVQWSQCDARRRPPEKSRPCNQHPCP---PFWLTSK--YSDCSMSC---GSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSC-DSGERRRQVWC 598          

HSP 4 Score: 50.0618 bits (118), Expect = 5.028e-6
Identity = 43/154 (27.92%), Postives = 64/154 (41.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE---SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD 690
            +I  WS    +  S   Q + VC       V  +P + C+++L      R C    C +   W    WT C   CG  G + REV C+ +       V D FCE   +P A  NC   +C  ++ +  W  C   + C  G++ R + CV   D
Sbjct:  180 DIVDWSGAGRSIAS-TSQPIVVCVNAITGRV--VPEKLCADKLRPKVEARPCPMLICPS--RWMAADWTECVPHCGE-GTRKREVYCVQTAHNVTVHVPDTFCENGTRPAAEENCVSTSC-GRWEAGKWSKCT--ASCGQGVRRRHVACVGGSD 324          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 85.1149 bits (209), Expect = 9.585e-17
Identity = 121/524 (23.09%), Postives = 203/524 (38.74%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFR-KPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLE-IKIDNRTLVQMLPMKRLDIQLGQVSHIIF---GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPK-------WEISNVDLSQCSNHCIGI--GRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDI-CNQINLKLPQVMKSCTPPKC 1764
            +  VWS CS  CG G Q +   C      +   +P   C     +I   + C+   C     +  G W++CS SC + G  +R V C+   G  VD   C     +P + + C    CP  + ++ W  C     C  G + R+  C+         +   +A +      P   ++CH   C   K ++     +   + +Q   +       G +    F    TR  LK + +K                    T D  R+ +  +  +    +   G W   + +     Q +     +  RD      +  + L   ++  +  ++D + W   +W +C  +C +   Q R+V C    D     L+D +C   ++++PTS R C +   CPK       W I   D S+CS  C G    R++  T+  C    +P    +C+ +  P +          W+ISPWT CS SCG  G+Q R + C    +G    DI C++I    P+  + C  P C
Sbjct: 1118 QFGVWSDCSAKCGDGVQYRDANCTDRHRSV---LPEHRCLKMEKII--TKPCHRESCPK---YKLGEWSQCSVSCED-GWSSRRVSCVSGNGTEVDMSLCGTASDRPASHQTCNLGTCP-FWRNTDWSAC--SVSCGIGHRERTTECI-------YREQSVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSGIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEK-------------------DTCDGPRVLQKLQADVPPI-RWATGPWTACSATCGNGTQRRLLKCRDHVRDLPD---EYCNHLDKEVSTRNCRLRDCSYWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDC--DVQKRPTSARNCRLE-PCPKGEEHIGSWIIG--DWSKCSASCGGGWRRRSVSCTSSSCDETRKPKMFDKCNEELCPPLT------NNSWQISPWTHCSVSCG-GGVQRRKIWCEDVLSGRKQDDIECSEIK---PREQRDCEMPPC 1584          

HSP 2 Score: 80.8777 bits (198), Expect = 1.950e-15
Identity = 142/586 (24.23%), Postives = 212/586 (36.18%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP-TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-DSEGESVDDKFCEKFRKPEASRNCKRYNC--------------PPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFD-----RLRISKNGRMVITKFSKHDEGEWICK-----AGSVSGKLQLKSRTLFEGYRDWEIRNIQL----QSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVP-------------------------------FGCP------KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLK--RCDIKAKPMMECANLGCRVK----WKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            PF    + WS+CS +CG G++++   C    +Y  +++   +C +  T +P T + C+   CT+   W   HW+ CS +CG+ GIQTR V C   SEG  VD+ FC++  +P   + C++  C              P ++ +  W  C   + C +G Q R + C        V  LP E C    L    + R+C  R C   K    E                                    C       RN+  +      R   +  D     R   ++N R+      +   G WI       + S  G  + +S +      D E R  ++      +L   LT  S        W    W+ CS+SC   G Q R ++CE +      + +D EC    E KP  +R C +P                                  P       W+ S    S CS  C   GR      V C+       +    CD   KP+ E   + CR K    WK + W+ CS +CG  GI+ R + C      L +   CN    KL  V  +C P  C
Sbjct: 1227 PFWRNTD-WSACSVSCGIGHRERTTEC----IYREQSVDASFCGD--TKMPETSQTCHLLPCTS---WKPSHWSPCSVTCGS-GIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTAC--SATCGNGTQRRLLKC-----RDHVRDLPDEYCNH--LDKEVSTRNCRLRDCSYWKMAEWE-------------------------------ECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDCDVQKRPTSARNCRLEPCPKGEEHIGSWIIGDWSKCSASCGGGWRRRSVSCTSSSCD-ETRKPKMFDKCNEELCPPLTNNS--------WQISPWTHCSVSC-GGGVQRRKIWCEDVLSG--RKQDDIEC---SEIKPREQRDCEMPPCRSHYHNKTSSASMTSLSSSNSNTTSSASASSLPILPPVVSWQTSA--WSACSAKC---GRGTKRRVVECVNPSLNVTVASTECDQTKKPVEE---VRCRTKHCPRWKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSECNP-KTKLNSVA-NCFPVAC 1735          

HSP 3 Score: 77.0258 bits (188), Expect = 2.976e-14
Identity = 44/160 (27.50%), Postives = 73/160 (45.62%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPF 717
            +   WSSCS TCG G +++   C++    LV +       N  T + ++  C    C   + WN   W++C   C     QTR V C+ + G+    + CE  R P + R C   NCP +++   W+ C     C  G+Q R + C   ++  + + + F
Sbjct: 1683 KTTTWSSCSVTCGRGIRRREVQCYRGRKNLVSDSE----CNPKTKLNSVANCFPVACP-AYRWNVTPWSKCKDECARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTC--SKSCGEGVQTREVRCRRKINFNSTIPIIF 1835          

HSP 4 Score: 73.1738 bits (178), Expect = 5.189e-13
Identity = 49/149 (32.89%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  253 SSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGT 699
            SSCS  CGSG Q++ RV         +    E+  ++ +    I  C Y DC+ G  WN G WT CS +CG+ G   R+  C+D     VD+  C + +K    R C R  C P+++   W  C     CD G++ R   C+   D  T
Sbjct:  953 SSCSAKCGSG-QKRQRVSCVKMEGDRQTPASEHLCDRNSKPSDIASC-YIDCS-GRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNRRVDESLCGREQKEATERECNRIPC-PRWVYGHWSEC--SRSCDGGVKMRHAQCLDAADRET 1095          

HSP 5 Score: 65.855 bits (159), Expect = 8.445e-11
Identity = 57/176 (32.39%), Postives = 74/176 (42.05%), Query Frame = 1
Query:  208 EKEIRKPFIHE------INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPF 717
            EK I KP   E      +  WS CS +C  G+  +   C       V+      C        + + CN G C     W    W+ CS SCG  G + R  EC+  E +SVD  FC   + PE S+ C    C   +  S W PC     C SGIQ RS+ C    + GT+V   F
Sbjct: 1157 EKIITKPCHRESCPKYKLGEWSQCSVSCEDGWSSRRVSCVSGNGTEVD---MSLCGTASDRPASHQTCNLGTCP---FWRNTDWSACSVSCG-IGHRERTTECIYRE-QSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPC--SVTCGSGIQTRSVSCTRGSE-GTIVDEYF 1320          

HSP 6 Score: 63.5438 bits (153), Expect = 4.856e-10
Identity = 68/222 (30.63%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRV-CFQTTLYLVENIPFEYCSNQLTVIPT-IRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--------------LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISS--AWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME-----KSTNLEIKIDNRTLV 837
            +  WS C D C  G +Q  RV C  T+    +      C  +L   PT IR+C+  +C   + W  G W  CS SCG  G+QTREV C              +  +  +V  + CE F KP  S+ C+   C  +F  S   W  C  +  C  GI+ R + CV+  ++G  V+     C  K    P   + C  R CL       KS N++ K  N T++
Sbjct: 1742 VTPWSKCKDECARGQKQTRRVHCISTS---GKRAAPRMC--ELARAPTSIRECDTSNCP--YEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKN--CGQGIRRRRVKCVA--NDGRRVER--VKCTTK---KPRRTQYCFERNCLPSTCQELKSQNVKAKDGNYTIL 1946          

HSP 7 Score: 56.225 bits (134), Expect = 8.428e-8
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCS-VPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCI-FRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            +W  G+W+ CS +C S G   R  YC    D    R+++  C +  E+K  ++R+C+ +P  CP+W   +   S+CS  C G    +   + +C+   D+ T   RC   A+    C    C   W+   W+ CS  CG+ G+Q R   C 
Sbjct: 1006 KWNYGEWTSCSETCGSNGKMHRKSYC---VDDSNRRVDESLCGR--EQKEATERECNRIP--CPRWVYGH--WSECSRSCDG---GVKMRHAQCLDAADRETHTSRCG-PAQTQEHCNEHAC-TWWQFGVWSDCSAKCGD-GVQYRDANCT 1141          

HSP 8 Score: 55.8398 bits (133), Expect = 1.017e-7
Identity = 53/176 (30.11%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  250 WSSCSDTCGS-GYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC--YEKGLITPTNKRSC 768
            W+SCS+TCGS G   +   C   +   V+    E    +     T R+CN   C     W  GHW+ CS SC + G++ R  +CLD+         C   +  E   +C  + C   +    W  C   +KC  G+QYR  +C    D    V LP   C   EK +  P ++ SC
Sbjct: 1012 WTSCSETCGSNGKMHRKSYCVDDSNRRVD----ESLCGREQKEATERECNRIPCPR---WVYGHWSECSRSC-DGGVKMRHAQCLDAADRETHTSRCGPAQTQE---HCNEHAC-TWWQFGVWSDC--SAKCGDGVQYRDANCT---DRHRSV-LPEHRCLKMEKIITKPCHRESC 1169          

HSP 9 Score: 55.4546 bits (132), Expect = 1.346e-7
Identity = 50/187 (26.74%), Postives = 77/187 (41.18%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPP-KFISSAWEPCVSDSKCDSGI-QYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            + + WS+CS  CG G ++++  C   +L +   +    C      +  +R C    C     W T  W+ CS +CG  GI+ REV+C       V D  C    K  +  NC    CP  ++  + W  C    +C  G  Q R +HC+S        ++   A        PT+ R C +  C  E
Sbjct: 1626 QTSAWSACSAKCGRGTKRRVVECVNPSLNVT--VASTECDQTKKPVEEVR-CRTKHCPR---WKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSECNPKTKLNSVANCFPVACPAYRWNVTPWSKC--KDECARGQKQTRRVHCISTSGKRAAPRMCELA------RAPTSIRECDTSNCPYE 1797          

HSP 10 Score: 50.8322 bits (120), Expect = 3.166e-6
Identity = 50/168 (29.76%), Postives = 65/168 (38.69%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC--------------IFRDQPTDLK-RCDIKAKP----MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            RW    WSKC   C     Q R V+C         R     C   L   PTS R+C     CP +E    D   CS  C   G  +    VRC              +  D+P   K +C++  KP      E        KW   PW +CS++CG+ GI+ R + CV
Sbjct: 1739 RWNVTPWSKCKDECARGQKQTRRVHCISTSGK---RAAPRMC--ELARAPTSIRECDTS-NCP-YEWVPGDWQTCSKSC---GEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKNCGQ-GIRRRRVKCV 1895          

HSP 11 Score: 50.0618 bits (118), Expect = 5.695e-6
Identity = 47/156 (30.13%), Postives = 66/156 (42.31%), Query Frame = 1
Query: 1213 KDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTN-VRCIFRDQPTDLKR-CDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            K   RW    WS CS++C   G + R V C +   +    + D EC  + + K  S   C  P  CP +  +    S+C + C    R    T  V CI         R C++   P  + EC    C  +W    W  CS+SCGE G+Q R + C
Sbjct: 1677 KHCPRWKTTTWSSCSVTC-GRGIRRREVQCYRGRKNL---VSDSEC--NPKTKLNSVANC-FPVACPAYRWNVTPWSKCKDEC---ARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRC 1821          
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Match: gon-1 (A disintegrin and metalloproteinase with thrombospondin motifs gon-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19791])

HSP 1 Score: 85.1149 bits (209), Expect = 1.073e-16
Identity = 121/524 (23.09%), Postives = 203/524 (38.74%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFR-KPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLE-IKIDNRTLVQMLPMKRLDIQLGQVSHIIF---GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPK-------WEISNVDLSQCSNHCIGI--GRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDI-CNQINLKLPQVMKSCTPPKC 1764
            +  VWS CS  CG G Q +   C      +   +P   C     +I   + C+   C     +  G W++CS SC + G  +R V C+   G  VD   C     +P + + C    CP  + ++ W  C     C  G + R+  C+         +   +A +      P   ++CH   C   K ++     +   + +Q   +       G +    F    TR  LK + +K                    T D  R+ +  +  +    +   G W   + +     Q +     +  RD      +  + L   ++  +  ++D + W   +W +C  +C +   Q R+V C    D     L+D +C   ++++PTS R C +   CPK       W I   D S+CS  C G    R++  T+  C    +P    +C+ +  P +          W+ISPWT CS SCG  G+Q R + C    +G    DI C++I    P+  + C  P C
Sbjct: 1133 QFGVWSDCSAKCGDGVQYRDANCTDRHRSV---LPEHRCLKMEKII--TKPCHRESCPK---YKLGEWSQCSVSCED-GWSSRRVSCVSGNGTEVDMSLCGTASDRPASHQTCNLGTCP-FWRNTDWSAC--SVSCGIGHRERTTECI-------YREQSVDASFCGDTKMPETSQTCHLLPCTSWKPSHWSPCSVTCGSGIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEK-------------------DTCDGPRVLQKLQADVPPI-RWATGPWTACSATCGNGTQRRLLKCRDHVRDLPD---EYCNHLDKEVSTRNCRLRDCSYWKMAEWEECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDC--DVQKRPTSARNCRLE-PCPKGEEHIGSWIIG--DWSKCSASCGGGWRRRSVSCTSSSCDETRKPKMFDKCNEELCPPLT------NNSWQISPWTHCSVSCG-GGVQRRKIWCEDVLSGRKQDDIECSEIK---PREQRDCEMPPC 1599          

HSP 2 Score: 80.8777 bits (198), Expect = 1.969e-15
Identity = 142/586 (24.23%), Postives = 212/586 (36.18%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP-TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-DSEGESVDDKFCEKFRKPEASRNCKRYNC--------------PPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFD-----RLRISKNGRMVITKFSKHDEGEWICK-----AGSVSGKLQLKSRTLFEGYRDWEIRNIQL----QSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVP-------------------------------FGCP------KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLK--RCDIKAKPMMECANLGCRVK----WKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            PF    + WS+CS +CG G++++   C    +Y  +++   +C +  T +P T + C+   CT+   W   HW+ CS +CG+ GIQTR V C   SEG  VD+ FC++  +P   + C++  C              P ++ +  W  C   + C +G Q R + C        V  LP E C    L    + R+C  R C   K    E                                    C       RN+  +      R   +  D     R   ++N R+      +   G WI       + S  G  + +S +      D E R  ++      +L   LT  S        W    W+ CS+SC   G Q R ++CE +      + +D EC    E KP  +R C +P                                  P       W+ S    S CS  C   GR      V C+       +    CD   KP+ E   + CR K    WK + W+ CS +CG  GI+ R + C      L +   CN    KL  V  +C P  C
Sbjct: 1242 PFWRNTD-WSACSVSCGIGHRERTTEC----IYREQSVDASFCGD--TKMPETSQTCHLLPCTS---WKPSHWSPCSVTCGS-GIQTRSVSCTRGSEGTIVDEYFCDRNTRPRLKKTCEKDTCDGPRVLQKLQADVPPIRWATGPWTAC--SATCGNGTQRRLLKC-----RDHVRDLPDEYCNH--LDKEVSTRNCRLRDCSYWKMAEWE-------------------------------ECPATCGTHVQQSRNVTCVSAEDGGRTILKDVDCDVQKRPTSARNCRLEPCPKGEEHIGSWIIGDWSKCSASCGGGWRRRSVSCTSSSCD-ETRKPKMFDKCNEELCPPLTNNS--------WQISPWTHCSVSC-GGGVQRRKIWCEDVLSG--RKQDDIEC---SEIKPREQRDCEMPPCRSHYHNKTSSASMTSLSSSNSNTTSSASASSLPILPPVVSWQTSA--WSACSAKC---GRGTKRRVVECVNPSLNVTVASTECDQTKKPVEE---VRCRTKHCPRWKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSECNP-KTKLNSVA-NCFPVAC 1750          

HSP 3 Score: 77.0258 bits (188), Expect = 3.164e-14
Identity = 44/160 (27.50%), Postives = 73/160 (45.62%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPF 717
            +   WSSCS TCG G +++   C++    LV +       N  T + ++  C    C   + WN   W++C   C     QTR V C+ + G+    + CE  R P + R C   NCP +++   W+ C     C  G+Q R + C   ++  + + + F
Sbjct: 1698 KTTTWSSCSVTCGRGIRRREVQCYRGRKNLVSDSE----CNPKTKLNSVANCFPVACP-AYRWNVTPWSKCKDECARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTC--SKSCGEGVQTREVRCRRKINFNSTIPIIF 1850          

HSP 4 Score: 72.7886 bits (177), Expect = 5.422e-13
Identity = 49/149 (32.89%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  253 SSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGT 699
            SSCS  CGSG Q++ RV         +    E+  ++ +    I  C Y DC+ G  WN G WT CS +CG+ G   R+  C+D     VD+  C + +K    R C R  C P+++   W  C     CD G++ R   C+   D  T
Sbjct:  968 SSCSAKCGSG-QKRQRVSCVKMEGDRQTPASEHLCDRNSKPSDIASC-YIDCS-GRKWNYGEWTSCSETCGSNGKMHRKSYCVDDSNRRVDESLCGREQKEATERECNRIPC-PRWVYGHWSEC--SRSCDGGVKMRHAQCLDAADRET 1110          

HSP 5 Score: 65.855 bits (159), Expect = 8.599e-11
Identity = 57/176 (32.39%), Postives = 74/176 (42.05%), Query Frame = 1
Query:  208 EKEIRKPFIHE------INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPF 717
            EK I KP   E      +  WS CS +C  G+  +   C       V+      C        + + CN G C     W    W+ CS SCG  G + R  EC+  E +SVD  FC   + PE S+ C    C   +  S W PC     C SGIQ RS+ C    + GT+V   F
Sbjct: 1172 EKIITKPCHRESCPKYKLGEWSQCSVSCEDGWSSRRVSCVSGNGTEVD---MSLCGTASDRPASHQTCNLGTCP---FWRNTDWSACSVSCG-IGHRERTTECIYRE-QSVDASFCGDTKMPETSQTCHLLPC-TSWKPSHWSPC--SVTCGSGIQTRSVSCTRGSE-GTIVDEYF 1335          

HSP 6 Score: 63.1586 bits (152), Expect = 5.293e-10
Identity = 68/222 (30.63%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRV-CFQTTLYLVENIPFEYCSNQLTVIPT-IRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--------------LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISS--AWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME-----KSTNLEIKIDNRTLV 837
            +  WS C D C  G +Q  RV C  T+    +      C  +L   PT IR+C+  +C   + W  G W  CS SCG  G+QTREV C              +  +  +V  + CE F KP  S+ C+   C  +F  S   W  C  +  C  GI+ R + CV+  ++G  V+     C  K    P   + C  R CL       KS N++ K  N T++
Sbjct: 1757 VTPWSKCKDECARGQKQTRRVHCISTS---GKRAAPRMC--ELARAPTSIRECDTSNCP--YEWVPGDWQTCSKSCGE-GVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKN--CGQGIRRRRVKCVA--NDGRRVERV--KCTTK---KPRRTQYCFERNCLPSTCQELKSQNVKAKDGNYTIL 1961          

HSP 7 Score: 56.225 bits (134), Expect = 8.877e-8
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCS-VPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCI-FRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            +W  G+W+ CS +C S G   R  YC    D    R+++  C +  E+K  ++R+C+ +P  CP+W   +   S+CS  C G    +   + +C+   D+ T   RC   A+    C    C   W+   W+ CS  CG+ G+Q R   C 
Sbjct: 1021 KWNYGEWTSCSETCGSNGKMHRKSYC---VDDSNRRVDESLCGR--EQKEATERECNRIP--CPRWVYGH--WSECSRSCDG---GVKMRHAQCLDAADRETHTSRCG-PAQTQEHCNEHAC-TWWQFGVWSDCSAKCGD-GVQYRDANCT 1156          

HSP 8 Score: 55.8398 bits (133), Expect = 1.062e-7
Identity = 53/176 (30.11%), Postives = 76/176 (43.18%), Query Frame = 1
Query:  250 WSSCSDTCGS-GYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC--YEKGLITPTNKRSC 768
            W+SCS+TCGS G   +   C   +   V+    E    +     T R+CN   C     W  GHW+ CS SC + G++ R  +CLD+         C   +  E   +C  + C   +    W  C   +KC  G+QYR  +C    D    V LP   C   EK +  P ++ SC
Sbjct: 1027 WTSCSETCGSNGKMHRKSYCVDDSNRRVD----ESLCGREQKEATERECNRIPCPR---WVYGHWSECSRSC-DGGVKMRHAQCLDAADRETHTSRCGPAQTQE---HCNEHAC-TWWQFGVWSDC--SAKCGDGVQYRDANCT---DRHRSV-LPEHRCLKMEKIITKPCHRESC 1184          

HSP 9 Score: 55.4546 bits (132), Expect = 1.406e-7
Identity = 50/187 (26.74%), Postives = 77/187 (41.18%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPP-KFISSAWEPCVSDSKCDSGI-QYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            + + WS+CS  CG G ++++  C   +L +   +    C      +  +R C    C     W T  W+ CS +CG  GI+ REV+C       V D  C    K  +  NC    CP  ++  + W  C    +C  G  Q R +HC+S        ++   A        PT+ R C +  C  E
Sbjct: 1641 QTSAWSACSAKCGRGTKRRVVECVNPSLNVT--VASTECDQTKKPVEEVR-CRTKHCPR---WKTTTWSSCSVTCGR-GIRRREVQCYRGRKNLVSDSECNPKTKLNSVANCFPVACPAYRWNVTPWSKC--KDECARGQKQTRRVHCISTSGKRAAPRMCELA------RAPTSIRECDTSNCPYE 1812          

HSP 10 Score: 50.8322 bits (120), Expect = 3.479e-6
Identity = 50/168 (29.76%), Postives = 65/168 (38.69%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC--------------IFRDQPTDLK-RCDIKAKP----MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            RW    WSKC   C     Q R V+C         R     C   L   PTS R+C     CP +E    D   CS  C   G  +    VRC              +  D+P   K +C++  KP      E        KW   PW +CS++CG+ GI+ R + CV
Sbjct: 1754 RWNVTPWSKCKDECARGQKQTRRVHCISTSGK---RAAPRMC--ELARAPTSIRECDTS-NCP-YEWVPGDWQTCSKSC---GEGVQTREVRCRRKINFNSTIPIIFMLEDEPAVPKEKCELFPKPNESQTCELNPCDSEFKWSFGPWGECSKNCGQ-GIRRRRVKCV 1910          

HSP 11 Score: 50.0618 bits (118), Expect = 5.699e-6
Identity = 47/156 (30.13%), Postives = 66/156 (42.31%), Query Frame = 1
Query: 1213 KDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTN-VRCIFRDQPTDLKR-CDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            K   RW    WS CS++C   G + R V C +   +    + D EC  + + K  S   C  P  CP +  +    S+C + C    R    T  V CI         R C++   P  + EC    C  +W    W  CS+SCGE G+Q R + C
Sbjct: 1692 KHCPRWKTTTWSSCSVTC-GRGIRRREVQCYRGRKNL---VSDSEC--NPKTKLNSVANC-FPVACPAYRWNVTPWSKCKDEC---ARGQKQTRRVHCISTSGKRAAPRMCELARAPTSIRECDTSNCPYEWVPGDWQTCSKSCGE-GVQTREVRC 1836          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0307497)

HSP 1 Score: 102.064 bits (253), Expect = 5.072e-22
Identity = 72/237 (30.38%), Postives = 109/237 (45.99%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGH--QFRSVYCEKLY---------DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCS-NHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLK--------CIDVYKICEKKKKY--CHIEIFYYRCCKTC 1857
            + RW+ G+WS+CS  C + G   Q R+V C++           D     +++ EC  H  E P   + C     CP+W  S  D + C  +HC G   A+    V C + +  T+   CD   +P M  EC N  C   W++ PW++C+  CG  GI+ R L CVW  +  PAG++C   +   P VMK C  P C  +        C D  + C   +    C +  +  +CC +C
Sbjct: 1154 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNG-TEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSC 1384          

HSP 2 Score: 98.9821 bits (245), Expect = 5.196e-21
Identity = 82/308 (26.62%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKF----RKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMK-RLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWI--HKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E  K ++     ++SCS +C  G ++ +  C +     V + PF  CS +      +R CN   C     WN   +T CS SCG  GI+TREV+C+       D+          + P A R  C   +CP ++    W  C     C  G + R + C  ++     ++ P   C       P +K+ C+ + C  E    + I+I+N T +Q  P K ++ +++G    + FGT++ +KC +K++ +  I W   HK  Q   K+      ++SK G + I   +  D G + C AG  S ++ ++
Sbjct:  622 EPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVS-PF-LCSPETKPEARVRTCNDRPCPP--RWNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPCNVKPCPPEDPKPV-IQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKY------KVSKKGALRILDITFRDAGVYSCHAGLSSAEISIE 912          

HSP 3 Score: 53.1434 bits (126), Expect = 9.080e-7
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC 573
            WS+CS  CG GY++++ VC + +  +   +    C  +    PT   C   +C +   W    WT CS SCG  GIQ R VEC  ++G S+  K C+   KP + + C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC--RTPKPPTQETCIIEECPH---WEVEDWTGCSVSCGQ-GIQMRGVECKSTDG-SLSAK-CDPLTKPGSMQQC 419          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0110959)

HSP 1 Score: 102.064 bits (253), Expect = 5.072e-22
Identity = 72/237 (30.38%), Postives = 109/237 (45.99%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGH--QFRSVYCEKLY---------DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCS-NHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLK--------CIDVYKICEKKKKY--CHIEIFYYRCCKTC 1857
            + RW+ G+WS+CS  C + G   Q R+V C++           D     +++ EC  H  E P   + C     CP+W  S  D + C  +HC G   A+    V C + +  T+   CD   +P M  EC N  C   W++ PW++C+  CG  GI+ R L CVW  +  PAG++C   +   P VMK C  P C  +        C D  + C   +    C +  +  +CC +C
Sbjct: 1154 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNG-TEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSC 1384          

HSP 2 Score: 98.9821 bits (245), Expect = 5.196e-21
Identity = 82/308 (26.62%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKF----RKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMK-RLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWI--HKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E  K ++     ++SCS +C  G ++ +  C +     V + PF  CS +      +R CN   C     WN   +T CS SCG  GI+TREV+C+       D+          + P A R  C   +CP ++    W  C     C  G + R + C  ++     ++ P   C       P +K+ C+ + C  E    + I+I+N T +Q  P K ++ +++G    + FGT++ +KC +K++ +  I W   HK  Q   K+      ++SK G + I   +  D G + C AG  S ++ ++
Sbjct:  622 EPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVS-PF-LCSPETKPEARVRTCNDRPCPP--RWNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPCNVKPCPPEDPKPV-IQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKY------KVSKKGALRILDITFRDAGVYSCHAGLSSAEISIE 912          

HSP 3 Score: 53.1434 bits (126), Expect = 9.080e-7
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC 573
            WS+CS  CG GY++++ VC + +  +   +    C  +    PT   C   +C +   W    WT CS SCG  GIQ R VEC  ++G S+  K C+   KP + + C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC--RTPKPPTQETCIIEECPH---WEVEDWTGCSVSCGQ-GIQMRGVECKSTDG-SLSAK-CDPLTKPGSMQQC 419          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0301000)

HSP 1 Score: 102.064 bits (253), Expect = 5.107e-22
Identity = 72/237 (30.38%), Postives = 109/237 (45.99%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGH--QFRSVYCEKLY---------DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCS-NHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLK--------CIDVYKICEKKKKY--CHIEIFYYRCCKTC 1857
            + RW+ G+WS+CS  C + G   Q R+V C++           D     +++ EC  H  E P   + C     CP+W  S  D + C  +HC G   A+    V C + +  T+   CD   +P M  EC N  C   W++ PW++C+  CG  GI+ R L CVW  +  PAG++C   +   P VMK C  P C  +        C D  + C   +    C +  +  +CC +C
Sbjct: 1148 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNG-TEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSC 1378          

HSP 2 Score: 98.9821 bits (245), Expect = 5.465e-21
Identity = 82/308 (26.62%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKF----RKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMK-RLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWI--HKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E  K ++     ++SCS +C  G ++ +  C +     V + PF  CS +      +R CN   C     WN   +T CS SCG  GI+TREV+C+       D+          + P A R  C   +CP ++    W  C     C  G + R + C  ++     ++ P   C       P +K+ C+ + C  E    + I+I+N T +Q  P K ++ +++G    + FGT++ +KC +K++ +  I W   HK  Q   K+      ++SK G + I   +  D G + C AG  S ++ ++
Sbjct:  622 EPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVS-PF-LCSPETKPEARVRTCNDRPCPP--RWNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPCNVKPCPPEDPKPV-IQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKY------KVSKKGALRILDITFRDAGVYSCHAGLSSAEISIE 912          

HSP 3 Score: 52.7582 bits (125), Expect = 9.715e-7
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC 573
            WS+CS  CG GY++++ VC + +  +   +    C  +    PT   C   +C +   W    WT CS SCG  GIQ R VEC  ++G S+  K C+   KP + + C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC--RTPKPPTQETCIIEECPH---WEVEDWTGCSVSCGQ-GIQMRGVECKSTDG-SLSAK-CDPLTKPGSMQQC 419          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085901)

HSP 1 Score: 102.064 bits (253), Expect = 5.658e-22
Identity = 72/237 (30.38%), Postives = 109/237 (45.99%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGH--QFRSVYCEKLY---------DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCS-NHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLK--------CIDVYKICEKKKKY--CHIEIFYYRCCKTC 1857
            + RW+ G+WS+CS  C + G   Q R+V C++           D     +++ EC  H  E P   + C     CP+W  S  D + C  +HC G   A+    V C + +  T+   CD   +P M  EC N  C   W++ PW++C+  CG  GI+ R L CVW  +  PAG++C   +   P VMK C  P C  +        C D  + C   +    C +  +  +CC +C
Sbjct: 1113 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNG-TEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSC 1343          

HSP 2 Score: 98.9821 bits (245), Expect = 4.668e-21
Identity = 82/308 (26.62%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKF----RKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMK-RLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWI--HKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E  K ++     ++SCS +C  G ++ +  C +     V + PF  CS +      +R CN   C     WN   +T CS SCG  GI+TREV+C+       D+          + P A R  C   +CP ++    W  C     C  G + R + C  ++     ++ P   C       P +K+ C+ + C  E    + I+I+N T +Q  P K ++ +++G    + FGT++ +KC +K++ +  I W   HK  Q   K+      ++SK G + I   +  D G + C AG  S ++ ++
Sbjct:  622 EPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVS-PF-LCSPETKPEARVRTCNDRPCPP--RWNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPCNVKPCPPEDPKPV-IQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKY------KVSKKGALRILDITFRDAGVYSCHAGLSSAEISIE 912          

HSP 3 Score: 52.7582 bits (125), Expect = 1.001e-6
Identity = 37/108 (34.26%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC 573
            WS+CS  CG GY++++ VC + +  +   +    C  +    PT   C   +C +   W    WT CS SCG  GIQ R VEC  ++G S+  K C+   KP + + C
Sbjct:  320 WSTCSRLCGHGYRERMVVCAEESNGIKTRVADIMC--RTPKPPTQETCIIEECPH---WEVEDWTGCSVSCGQ-GIQMRGVECKSTDG-SLSAK-CDPLTKPGSMQQC 419          
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339132)

HSP 1 Score: 102.064 bits (253), Expect = 6.000e-22
Identity = 72/237 (30.38%), Postives = 109/237 (45.99%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGH--QFRSVYCEKLY---------DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCS-NHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLK--------CIDVYKICEKKKKY--CHIEIFYYRCCKTC 1857
            + RW+ G+WS+CS  C + G   Q R+V C++           D     +++ EC  H  E P   + C     CP+W  S  D + C  +HC G   A+    V C + +  T+   CD   +P M  EC N  C   W++ PW++C+  CG  GI+ R L CVW  +  PAG++C   +   P VMK C  P C  +        C D  + C   +    C +  +  +CC +C
Sbjct: 1106 VYRWMLGEWSQCSQECGAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNG-TEGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRKGIKYRILQCVWYGSRRPAGNVCK--HQPRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSC 1336          

HSP 2 Score: 98.9821 bits (245), Expect = 5.351e-21
Identity = 82/308 (26.62%), Postives = 140/308 (45.45%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKF----RKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMK-RLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWI--HKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E  K ++     ++SCS +C  G ++ +  C +     V + PF  CS +      +R CN   C     WN   +T CS SCG  GI+TREV+C+       D+          + P A R  C   +CP ++    W  C     C  G + R + C  ++     ++ P   C       P +K+ C+ + C  E    + I+I+N T +Q  P K ++ +++G    + FGT++ +KC +K++ +  I W   HK  Q   K+      ++SK G + I   +  D G + C AG  S ++ ++
Sbjct:  615 EPGKTYVWREQGYTSCSASCLGGVEELIINCVREDNGRVVS-PF-LCSPETKPEARVRTCNDRPCPP--RWNYSDYTPCSKSCG-IGIKTREVQCIHEVTRGGDNTMVVPNSMCPQPPPADRQYCNVLDCPVRWEVGEWSKC--SHTCGYGFKDRKVECKQIMAQEHKIERPESMCPS---AKPADKKPCNVKPCPPEDPKPV-IQINNSTHIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKWSKDHKPLQRSRKY------KVSKKGALRILDITFRDAGVYSCHAGLSSAEISIE 905          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 88.1965 bits (217), Expect = 1.516e-17
Identity = 83/305 (27.21%), Postives = 127/305 (41.64%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTL-YLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCP-PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN---LEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            P   E++VW+ CS +CG G Q +   C ++      E++  + C  +      ++ CN   C     W    W +CSHSCG  G Q R+V C           + D+ C    KP+  R C   +C  P+     W  C     C  G+Q R   C     +G +V L   +C +  L  P   RSC    C   K +     ++    R  +Q  P KRL   +G  ++++  T + +KC ++ FPK  I W     +      +  RL I+K+G + I      D G + C A   S    LK
Sbjct:  705 PSRWEVSVWNLCSVSCGVGLQTRSVSCVRSVAGNRTESLSSKDCVEKRPN--ELQACNQVACPPS--WEAEEWQQCSHSCGR-GSQWRKVYCKQRLATGSYRRLRDEDCSG-PKPDVHRICTNADCLLPRLEGGEWSKC--SVTCGKGVQRREPVCRRQTASGQLVTLDRTSCSD--LPLPPLIRSCRMSPCNKHKHSKKRCPQVIGLKRIYIQNRPEKRLSFTIGGRAYLLPKTTVIIKCPVRHFPKAQIRWEKDGDE----LTSSKRLSITKSGALRIYNLEAEDIGVYRCWANQDSDTFILK 995          

HSP 2 Score: 82.0333 bits (201), Expect = 1.361e-15
Identity = 42/124 (33.87%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            F W  G W+ CS SCGN G Q ++++C+ SEG       C    KP + +R C   +CPP ++S+ W  C   S C  G + R + C  +  +G+V  LP   C  +G   P +++ C S+ C+
Sbjct: 1487 FEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVWSRC--SSSCGRGFRERRVSCQQVEASGSVKVLPSSEC--EGSPRPEDRQECSSQACV 1606          

HSP 3 Score: 77.0258 bits (188), Expect = 4.510e-14
Identity = 68/233 (29.18%), Postives = 107/233 (45.92%), Query Frame = 1
Query: 1180 PNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR-LEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPT--GLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTC 1857
            P+  T+   ++     WV+  WS+CS SC   G + R V C+++      + L   EC      +P  +++CS    C +W IS     +C+  C+G   A     V C      T  K CD K +P  +  C++  C V WK+ PW  C+ +CG +G Q+R + CV +     LP      Q   + P   + C    C  +C D    C   K+ K C ++++  RCC+TC
Sbjct: 1532 PSSQTRPCNLLHCPPSWVSTVWSRCSSSC-GRGFRERRVSCQQVEASGSVKVLPSSEC--EGSPRPEDRQECSSQ-ACVEW-ISG-PWGKCAGRCLGPAMATQTRTVSCRLFSNSTS-KTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVACG-SGFQSRRVECVHRQNKKTLPDQHCAWQ---RRPVTWQHCNITSCGSECKDRTHYCPAVKRLKLCSVDLYRQRCCQTC 1753          

HSP 4 Score: 75.0998 bits (183), Expect = 1.762e-13
Identity = 109/435 (25.06%), Postives = 172/435 (39.54%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLY-LVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDI--QLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKF-------SKHDEGEW-ICKAGSVSGKLQLKSRTL-----FEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYC-EKLYDHFYYRLEDEECLKHLEEKPTSKRQCS 1395
            E N W+SCS +CG G Q++  VC +  ++  +  +    C++    I + + CN  DC     W    W++C+ +CG  G++ R V C+D  G+      C    KP    +C         R N P                       P F+   W  C     C  GIQ R + C  LL      V+LP E C+E+    P+++RSC S  CL    ++              P++  +   Q G     I  T  S  C++ K      + + +      K    D L       + + +        S+ +   W +C   SVS  + L++R++       G R   + +       PN L   + +    + W A +W +CS SC   G Q+R VYC ++L    Y RL DE+C      KP   R C+
Sbjct:  423 EQNPWTSCSVSCGGGSQERSIVCVEEDVHGQIVQVEDWKCTHSPRPI-SKQNCNTFDCPQ---WMAMEWSQCTVTCGP-GLRYRVVLCVDYNGQHAGG--CNPHLKPHIKEDCLVPIACHKPRENQPVEAKLPWLKQAQELEETKVALEDPTFVPEPWSSC--SVSCGLGIQRRQVKCKVLLSFTQAEVELPDEECHEE---KPSSQRSCDSGPCLAAPDSS------------RWPLRTPEGPNQHGYAWEYIGFTACSASCAVGK-----QMAVVRCVNTLKKEIVDDLLCNGSKAPVSLLRICNPQPCPSRWEVSVWNLC---SVSCGVGLQTRSVSCVRSVAGNRTESLSSKDCVEKRPNELQACNQVACPPS-WEAEEWQQCSHSC-GRGSQWRKVYCKQRLATGSYRRLRDEDCSG---PKPDVHRICT 820          

HSP 5 Score: 56.9954 bits (136), Expect = 8.027e-8
Identity = 47/161 (29.19%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVC--FQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECL--DSEGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            CS TCG GYQ     C   +    + E++   +  N     P +++CN   C  ++GF              W    WT CS SCG  G Q R + C+  D  G+   V+D  C    +P + +NC  ++C P++++  W  C     C  G++YR + CV
Sbjct:  351 CSVTCGGGYQLNSADCVDIRYNRSVAEHLCHSFPEN-TKPTPKLKECNMEPCPESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQERSIVCVEEDVHGQIVQVEDWKCTHSPRPISKQNCNTFDC-PQWMAMEWSQCT--VTCGPGLRYRVVLCV 506          

HSP 6 Score: 53.9138 bits (128), Expect = 5.749e-7
Identity = 58/193 (30.05%), Postives = 83/193 (43.01%), Query Frame = 1
Query: 1189 LTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKL--YDHFYYRLEDEECLKHLEEKPTSKRQCSV------------PFGCPK--------WEISNVDLSQCSNHCIGIGRAIMNTNVRCI--FRDQPTDLKRCDIKAKP---MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTG 1686
            L +  V ++D   +V   WS CS+SC   G Q R V C+ L  +      L DEEC    EEKP+S+R C              P   P+        WE   +  + CS  C  +G+ +    VRC+   + +  D   C+    P   +  C    C  +W++S W  CS SCG  G+Q R + CV    G
Sbjct:  556 LEETKVALEDPT-FVPEPWSSCSVSC-GLGIQRRQVKCKVLLSFTQAEVELPDEEC---HEEKPSSQRSCDSGPCLAAPDSSRWPLRTPEGPNQHGYAWEY--IGFTACSASC-AVGKQM--AVVRCVNTLKKEIVDDLLCNGSKAPVSLLRICNPQPCPSRWEVSVWNLCSVSCGV-GLQTRSVSCVRSVAG 737          

HSP 7 Score: 53.5286 bits (127), Expect = 8.363e-7
Identity = 51/166 (30.72%), Postives = 70/166 (42.17%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLY-LVENIPFEYCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVEC-LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC 726
             VWS CS +CG G++++   C Q      V+ +P   C    +  P  R+ C+   C     W +G W +C+  C       QTR V C L S   S   K C+   +P A RNC    C   +    W  C     C SG Q R + CV   +  T   LP + C
Sbjct: 1551 TVWSRCSSSCGRGFRERRVSCQQVEASGSVKVLPSSECEG--SPRPEDRQECSSQACVE---WISGPWGKCAGRCLGPAMATQTRTVSCRLFSNSTS---KTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCT--VACGSGFQSRRVECVHRQNKKT---LPDQHC 1703          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 82.0333 bits (201), Expect = 7.460e-16
Identity = 42/124 (33.87%), Postives = 65/124 (52.42%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            F W  G W+ CS SCGN G Q ++++C+ SEG       C    KP + +R C   +CPP ++S+ W  C   S C  G + R + C  +  +G+V  LP   C  +G   P +++ C S+ C+
Sbjct:  440 FEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVWSRC--SSSCGRGFRERRVSCQQVEASGSVKVLPSSEC--EGSPRPEDRQECSSQACV 559          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: si:ch211-267e7.3 (si:ch211-267e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-265])

HSP 1 Score: 80.1073 bits (196), Expect = 4.464e-15
Identity = 54/153 (35.29%), Postives = 78/153 (50.98%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            + RW   +WS+CS +C   G QFR+V C K+    F   + DE C     +KP +++ C      P+WEIS  D S+CS  C G  R + + +VRC       + + C+   KP+   EC    C  +W +S W  CS  CGE G   RY++C
Sbjct:  634 LPRWETSRWSECSRTC-GEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEIS--DWSECSARCGG--RGVRSRDVRCSM-----EARLCNESTKPVSQRECEGPPCDRRWTVSDWGPCSGPCGE-GRMKRYVVC 775          

HSP 2 Score: 63.929 bits (154), Expect = 4.140e-10
Identity = 47/158 (29.75%), Postives = 71/158 (44.94%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPF-EYCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVV 705
            E + WS CS TCG G+Q +   C++      ++  + E C       P  RK C    C  G  W    W+ CS  CG  G+++R+V C      S++ + C +  KP + R C+   C  ++  S W PC     C  G   R + C +   NG V+
Sbjct:  638 ETSRWSECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSC--GPQWEISDWSECSARCGGRGVRSRDVRC------SMEARLCNESTKPVSQRECEGPPCDRRWTVSDWGPC--SGPCGEGRMKRYVVCKN--SNGKVI 783          

HSP 3 Score: 63.1586 bits (152), Expect = 7.612e-10
Identity = 53/184 (28.80%), Postives = 76/184 (41.30%), Query Frame = 1
Query:  238 EINVWSSCSDTCGS-GYQQK-LRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            EI+ WS CS  CG  G + + +R   +  L            N+ T   + R+C    C     W    W  CS  CG  G   R V C +S G+ + D  C+   KP A   C   NCP  ++   WE C  +S C  G++ R + C   L+ G   + P   C     + P +  +C  R C
Sbjct:  701 EISDWSECSARCGGRGVRSRDVRCSMEARL-----------CNESTKPVSQRECEGPPCDR--RWTVSDWGPCSGPCGE-GRMKRYVVCKNSNGKVISDGQCDPELKPLAVHPCGDKNCPAHWVEQEWEQC--NSTCGRGVKTRQVVCAG-LEAGVFKEFPERMCDRA--LRPADTAACFERPC 865          

HSP 4 Score: 59.3066 bits (142), Expect = 1.143e-8
Identity = 33/123 (26.83%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            + W    +  CS +C   GI T    C+  +G  VD+ +C+   +PE +   C    C P++ +S W  C     C  G Q+R++ C  ++  G    +  E C    L  P  +++C S+ C
Sbjct:  577 YRWKVSAYAPCSSTC-TTGISTSYALCVKYDGTEVDESYCDALTRPEPTHEFCTGKECLPRWETSRWSEC--SRTCGEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSC 696          

HSP 5 Score: 54.6842 bits (130), Expect = 3.196e-7
Identity = 43/153 (28.10%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--LDSEG--ESVDDKFCE--KFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHC 675
            +++ ++ CS TC +G      +C +   Y    +   YC       PT   C   +C     W T  W+ CS +CG  G Q R V C  + + G   SV D+ C+  + +KP   + CK  +C P++  S W  C   ++C   G++ R + C
Sbjct:  580 KVSAYAPCSSTCTTGISTSYALCVK---YDGTEVDESYCDALTRPEPTHEFCTGKECLP--RWETSRWSECSRTCGE-GFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEISDWSEC--SARCGGRGVRSRDVRC 724          

HSP 6 Score: 50.8322 bits (120), Expect = 4.979e-6
Identity = 54/196 (27.55%), Postives = 83/196 (42.35%), Query Frame = 1
Query: 1204 VIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP-------TDLKRCDIKAKPMME--CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            V M D+ RW    ++ CS +C +TG       C K YD     +++  C      +PT +  C+     P+WE S    S+CS  C   G       VRC     P        +L +     KPM    C +  C  +W+IS W++CS  CG  G+++R + C  +        +CN+    + Q  + C  P C
Sbjct:  571 VSMSDMYRWKVSAYAPCSSTC-TTGISTSYALCVK-YDG--TEVDESYCDALTRPEPTHEF-CTGKECLPRWETSR--WSECSRTC---GEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEISDWSECSARCGGRGVRSRDVRCSME------ARLCNESTKPVSQ--RECEGPPC 748          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: si:ch211-267e7.3 (si:ch211-267e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-265])

HSP 1 Score: 78.1814 bits (191), Expect = 6.420e-15
Identity = 54/153 (35.29%), Postives = 78/153 (50.98%), Query Frame = 1
Query: 1219 IARWVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            + RW   +WS+CS +C   G QFR+V C K+    F   + DE C     +KP +++ C      P+WEIS  D S+CS  C G  R + + +VRC       + + C+   KP+   EC    C  +W +S W  CS  CGE G   RY++C
Sbjct:   59 LPRWETSRWSECSRTC-GEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEIS--DWSECSARCGG--RGVRSRDVRCSM-----EARLCNESTKPVSQRECEGPPCDRRWTVSDWGPCSGPCGE-GRMKRYVVC 200          

HSP 2 Score: 63.5438 bits (153), Expect = 3.153e-10
Identity = 47/158 (29.75%), Postives = 71/158 (44.94%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPF-EYCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVV 705
            E + WS CS TCG G+Q +   C++      ++  + E C       P  RK C    C  G  W    W+ CS  CG  G+++R+V C      S++ + C +  KP + R C+   C  ++  S W PC     C  G   R + C +   NG V+
Sbjct:   63 ETSRWSECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSC--GPQWEISDWSECSARCGGRGVRSRDVRC------SMEARLCNESTKPVSQRECEGPPCDRRWTVSDWGPC--SGPCGEGRMKRYVVCKN--SNGKVI 208          

HSP 3 Score: 63.1586 bits (152), Expect = 3.602e-10
Identity = 63/241 (26.14%), Postives = 92/241 (38.17%), Query Frame = 1
Query:  100 ECLLICERFIQKMRFLQWVV----FIHSIFTILLTKAQFEEKEIRKPFIH-------EINVWSSCSDTCGS-GYQQK-LRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            EC   C    Q      W +    F  S++  L    + ++   RK           EI+ WS CS  CG  G + + +R   +  L            N+ T   + R+C    C     W    W  CS  CG  G   R V C +S G+ + D  C+   KP A   C   NCP  ++   WE C  +S C  G++ R + C   L+ G   + P   C     + P +  +C  R C
Sbjct:   69 ECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEISDWSECSARCGGRGVRSRDVRCSMEARL-----------CNESTKPVSQRECEGPPCDR--RWTVSDWGPCSGPCGE-GRMKRYVVCKNSNGKVISDGQCDPELKPLAVHPCGDKNCPAHWVEQEWEQC--NSTCGRGVKTRQVVCAG-LEAGVFKEFPERMCDR--ALRPADTAACFERPC 290          

HSP 4 Score: 58.5362 bits (140), Expect = 1.260e-8
Identity = 72/353 (20.40%), Postives = 127/353 (35.98%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIG 1473
            + W    +  CS +C   GI T    C+  +G  VD+ +C+   +PE +   C    C P++ +S W  C     C  G Q+R++ C  ++  G    +  E C    L  P  +++C S+ C                              G    I   +  S +C  +    R++    +++      +   +      G     +++  D G          G+ ++K   + +      I + Q   +L  +           A WV  +W +C+ +C   G + R V C  L    +    +  C + L  +P     C     C KW  ++   SQCS  C GIG
Sbjct:    2 YRWKVSAYAPCSSTC-TTGISTSYALCVKYDGTEVDESYCDALTRPEPTHEFCTGKECLPRWETSRWSEC--SRTCGEGFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSC------------------------------GPQWEISDWSECSARCGGRGVRSRDVRCSMEARLCNESTKPVSQREC--EGPPCDRRWTVSDWG----PCSGPCGEGRMKRYVVCKNSNGKVISDGQCDPELKPLAVHPCGDKNCPAHWVEQEWEQCNSTC-GRGVKTRQVVCAGLEAGVFKEFPERMCDRAL--RPADTAAC-FERPCSKWFTTS--WSQCSKTC-GIG 308          

HSP 5 Score: 53.1434 bits (126), Expect = 5.840e-7
Identity = 43/153 (28.10%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--LDSEG--ESVDDKFCE--KFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHC 675
            +++ ++ CS TC +G      +C +   Y    +   YC       PT   C   +C     W T  W+ CS +CG  G Q R V C  + + G   SV D+ C+  + +KP   + CK  +C P++  S W  C   ++C   G++ R + C
Sbjct:    5 KVSAYAPCSSTCTTGISTSYALCVK---YDGTEVDESYCDALTRPEPTHEFCTGKECLP--RWETSRWSECSRTCGE-GFQFRTVRCWKMMAPGFDSSVYDELCQAVELQKPMTRKACKSKSCGPQWEISDWSEC--SARCGGRGVRSRDVRC 149          
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Match: adamts10 (ADAM metallopeptidase with thrombospondin type 1 motif, 10 [Source:ZFIN;Acc:ZDB-GENE-081104-414])

HSP 1 Score: 74.3294 bits (181), Expect = 3.107e-13
Identity = 62/183 (33.88%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCF-QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD----SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            WS CS  C  G Q +  VC  Q  L +V N    +C  +       R CN   C     W TG W+ CS SC N G++TREV C      +E + +DD  C   R P  +  C  + CPP++ +  W  C     C  G +YR I C S  DNG    LP   C ++    PT +  C+ ++C
Sbjct:  839 WSRCSALCAGGVQVQQVVCKKQADLSVVYN---HFCDKKNKPKDKKRPCNQEPCPP--TWWTGDWSECSRSC-NGGVRTREVLCKRKMSVTEEKVLDDTACTTTR-PSVTEPCNNHTCPPEWHALDWSECTPG--CGPGYRYRVILCRS-GDNGET--LPESECPKQS--RPTTRVRCNIQRC 1007          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 114.005 bits (284), Expect = 1.863e-25
Identity = 84/297 (28.28%), Postives = 136/297 (45.79%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKS-----TNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            WS CS TCG G Q +   C  +++    N   + C  +      I+ CN  DC     W+T  W +CS +CG  G+Q R V C     D     + D+ C+  +KP + + C + +CPP+  +  W  C   +KC  GIQ R + C+ +   G ++ +    C+  GL +P   RSCH   C  + S      + EI   +R  +Q    KR++  +G  ++++  T + +KC ++   K  I W    Q  +Y      +L ++K+G + I      D G + C A S      LK
Sbjct:  691 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECGAEKPS--AIQPCNQIDCPP--AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQ-MQKPGSHKPCGKADCPPQLTTGEWSKC--SAKCSVGIQRRKMICLKITAKGHLIPINDSHCH--GLPSPALVRSCHMGVCQSKTSKLGDPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYS----KKLGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLK 971          

HSP 2 Score: 97.4413 bits (241), Expect = 3.240e-20
Identity = 100/374 (26.74%), Postives = 149/374 (39.84%), Query Frame = 1
Query:  898 GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKL---------QLKSRTLFEG---------YRDWE-----IRNIQLQSDL--------------------PNVLTKLSVIMKD-IARWVAGKWSKCSISCESTGHQFRSVYCEKL-YDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPMME-----CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTC 1857
            G  + ++C +K FP+  + W+ K  ++     +F    +  NG +++T  S  +EG + C A +  GK          + K+R +            Y DW        N   QS                      P V+   +   KD  ARW  G WS CS SC  TG Q R V C++   D     L    C     ++P +++ CS    C  W        QC N CIG G  + +  V C   +  T     CD K + +       C +  C V W+  PW  C+ +CG NG Q+R + C+ K       D  C  +  + P   + C    C  KC D    C   K  K CHI+++  RCC++C
Sbjct: 1286 GVNVMVQCPVKGFPQPKLTWLKK--EYALANNSF----LLSNGSLLLTNVSDGNEGTYFCIATNALGKTVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSC-GTGFQQRQVICQQTKLDGSIKVLPSGSC--QYADRPVTQKPCSSD-ACVDWIPQ--PWGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACG-NGFQSRKVDCMHKKNSKAVADQYC--VWKRRPTTWQHCKATSC-GKCKDTTHYCTFVKHLKLCHIDLYKQRCCESC 1643          

HSP 3 Score: 69.707 bits (169), Expect = 1.259e-11
Identity = 38/125 (30.40%), Postives = 62/125 (49.60%), Query Frame = 1
Query:  415 GFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            G+    G WT+CS +CGN G Q+    C++ +G  V+D +CE        S+ C R +CP ++   AW  C   + C +G Q R + C     +G++  LP  +C  +    P  ++ C S  C+
Sbjct: 1372 GYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDC--STSCGTGFQQRQVICQQTKLDGSIKVLPSGSC--QYADRPVTQKPCSSDACV 1492          

HSP 4 Score: 57.3806 bits (137), Expect = 8.475e-8
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTI-RKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC-------------------------------KRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLL 687
            E N W++CS +CG G Q++  VC + T++  E +  E         PTI + CN  DC     W    W++C+ +CG  G++ R V C D  G+      C    KP     C                               K  +  P FIS AW PC     C  G+Q R + C  LL
Sbjct:  402 EHNPWTACSVSCGGGIQRRSIVCVEETMH-GEILQVEEWKCMYAPKPTIMQTCNLFDCPK---WMAMEWSQCTVTCGR-GLRYRVVLCNDHRGQHTGG--CNPQLKPHIKEECVVPVPCFKPRERFPVEAKHPWLKQAQELEETKTASDEPTFISEAWSPC--SVSCGRGMQVRQVKCRILL 574          

HSP 5 Score: 56.9954 bits (136), Expect = 1.067e-7
Identity = 41/152 (26.97%), Postives = 70/152 (46.05%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTL-YLVENIPFEYCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRK---PEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
              WS CS +CG+G+QQ+  +C QT L   ++ +P   C  Q    P  +K C+   C +   W    W +C + C     G+Q R+V C    G ++ +  C++ ++       + C    C   + +  W PC   + C +G Q R + C+
Sbjct: 1437 GAWSDCSTSCGTGFQQRQVICQQTKLDGSIKVLPSGSC--QYADRPVTQKPCSSDACVD---WIPQPWGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCT--AACGNGFQSRKVDCM 1581          

HSP 6 Score: 55.4546 bits (132), Expect = 3.233e-7
Identity = 47/159 (29.56%), Postives = 68/159 (42.77%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPF-EYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDS--EGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            C+ TCG GYQ     C    L    N  +  Y        P +++CN   C  ++GF              W    WT CS SCG  GIQ R + C++    GE   V++  C    KP   + C  ++C PK+++  W  C     C  G++YR + C
Sbjct:  330 CTVTCGGGYQLNSAECVDIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCT--VTCGRGLRYRVVLC 484          

HSP 7 Score: 53.9138 bits (128), Expect = 9.790e-7
Identity = 55/217 (25.35%), Postives = 93/217 (42.86%), Query Frame = 1
Query:  169 SIFTILLTKAQFEEKEIRKP-----FIHEINVWSSCSDTCG-SGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHCVSLLDNGTVVKLPFEAC-YEKGLITPTNKRSCHSRKC 783
            ++   +L  ++F+ + +  P     +  E   W+ CS TCG +G Q   + C     + V +    +C +   ++   + CN  DC     W  G W+ CS SCG  G Q R+V C    LD   + +    C+   +P   + C    C   +I   W  C++       G+Q+R + C     NGT   LP  +C  +K  +    +++C S  C
Sbjct: 1348 TVAMSVLRLSEFKTRAMNSPRGKAGYQLEYGDWTQCSSTCGNNGTQSSTQHCVNVKGHRVND---SWCEHLHPLVIRSQACNRKDCP--ARWFPGAWSDCSTSCGT-GFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSSDAC-VDWIPQPWGQCLNQCIGQGMGLQHRQVLCQH--HNGTT--LPEASCDRKKRYLFHGTRKTCPSEMC 1553          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 111.309 bits (277), Expect = 1.318e-24
Identity = 83/299 (27.76%), Postives = 136/299 (45.48%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKID-------NRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            WS CS TCG G Q +   C  +++    N   + C  +      I+ CN  DC     W+T  W +CS +CG  G+Q R V C     D     + D+ C+  +KP + + C + +CPP+  +  W  C   +KC  GIQ R + C+ +   G ++ +    C+  GL +P   RSCH  K   + + N E   +       +R  +Q    KR++  +G  ++++  T + +KC ++   K  I W    Q  +Y      +L ++K+G + I      D G + C A S      LK
Sbjct:  630 WSRCSATCGVGIQTRDVYC--SSVSESGNNSEQECGAEKP--SAIQPCNQIDCPP--AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQ-MQKPGSHKPCGKADCPPQLTTGEWSKC--SAKCSVGIQRRKMICLKITAKGHLIPINDSHCH--GLPSPALVRSCHMAK---QHNPNRETSPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKYS----KKLGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLK 909          

HSP 2 Score: 73.1738 bits (178), Expect = 1.168e-12
Identity = 63/216 (29.17%), Postives = 93/216 (43.06%), Query Frame = 1
Query: 1222 ARWVAGKWSKCSISCESTGHQFRSVYCEKL-YDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTC 1857
            ARW  G WS CS SC  TG Q R V C++   D     L    C     ++P +++ CS    C  W        QC N CIG G  + +  V C   +  T  +    +      C +  C V W+  PW  C+ +CG NG Q+R + C+ K       D  C  +  + P   ++    +     +D    C   K  K CHI+++  RCC++C
Sbjct: 1390 ARWFPGAWSDCSTSC-GTGFQQRQVICQQTKLDGSIKVLPSGSC--QYADRPVTQKPCSSD-ACVDWIPQ--PWGQCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASSARKT----CPSEMCDVYWRTGPWRPCTAACG-NGFQSRKVDCMHKKNSKAVADQYC--VWKRRPTTWQA----RQHSHNLDTTHYCTFVKHLKLCHIDLYKQRCCESC 1588          

HSP 3 Score: 60.4622 bits (145), Expect = 8.491e-9
Identity = 34/114 (29.82%), Postives = 55/114 (48.25%), Query Frame = 1
Query:  448 CSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            CS +CGN G Q+    C++ +G  V+D +CE        S+ C R +CP ++   AW  C   + C +G Q R + C     +G++  LP  +C       P  ++ C S  C+
Sbjct: 1341 CSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDC--STSCGTGFQQRQVICQQTKLDGSIKVLPSGSCQYAD--RPVTQKPCSSDACV 1450          

HSP 4 Score: 58.5362 bits (140), Expect = 3.270e-8
Identity = 45/144 (31.25%), Postives = 65/144 (45.14%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPF-EYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS--EGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            C+ TCG GYQ     C    L    N  +  Y        P +++CN   C +   W    WT CS SCG  GIQ R + C++    GE   V++  C    KP   + C  ++C PK+++  W  C     C  G++YR + C
Sbjct:  286 CTVTCGGGYQLNSAECVDIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPS--RWEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCT--VTCGRGLRYRVVLC 423          

HSP 5 Score: 57.7658 bits (138), Expect = 6.696e-8
Identity = 52/182 (28.57%), Postives = 72/182 (39.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTI-RKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC-------------------------------KRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLL 687
            E N W++CS +CG G Q++  VC + T++  E +  E         PTI + CN  DC     W    W++C+ +CG  G++ R V C D  G+      C    KP     C                               K  +  P FIS AW PC     C  G+Q R + C  LL
Sbjct:  341 EHNPWTACSVSCGGGIQRRSIVCVEETMH-GEILQVEEWKCMYAPKPTIMQTCNLFDCPK---WMAMEWSQCTVTCGR-GLRYRVVLCNDHRGQHTGG--CNPQLKPHIKEECVVPVPCFKPRERFPVEAKHPWLKQAQELEETKTASDEPTFISEAWSPC--SVSCGRGMQVRQVKCRILL 513          

HSP 6 Score: 54.6842 bits (130), Expect = 5.645e-7
Identity = 44/152 (28.95%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTL-YLVENIPFEYCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEAS---RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
              WS CS +CG+G+QQ+  +C QT L   ++ +P   C  Q    P  +K C+   C +   W    W +C + C     G+Q R+V C    G ++          PEAS   + C    C   + +  W PC   + C +G Q R + C+
Sbjct: 1395 GAWSDCSTSCGTGFQQRQVICQQTKLDGSIKVLPSGSC--QYADRPVTQKPCSSDACVD---WIPQPWGQCLNQCIGQGMGLQHRQVLCQHHNGTTL----------PEASSARKTCPSEMCDVYWRTGPWRPCT--AACGNGFQSRKVDCM 1529          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 94.3597 bits (233), Expect = 2.535e-19
Identity = 86/362 (23.76%), Postives = 148/362 (40.88%), Query Frame = 1
Query:  211 KEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD------SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME-----------------------------------------KSTNLEI-----------KIDNRTLVQMLPMKRLDIQ----------LGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAG 1086
            K+I + +  E   ++ CS++CG G Q+ + VC   QT + + E++    C       P ++ CN   C     W  G+W+ CS +CG  G+QTR+V C        +E   + D FC +  KP   + C R++CPP + SS W+ C     C  GI  R + C   L +G++++LP   C       P ++  C +  C  E                                          S NL +           K  ++   Q+  +++L IQ          +G  ++++  T L L+C +++F K  IIW    +       + + + ++ +G + I      D G + C AG
Sbjct:  614 KDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRVTVGESL----CVASRRPPPLLKSCNMEACPP--RWEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQC--SQTCGGGIHTREVLCKQRLSDGSILELPETFCSSS---KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKH----LISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 958          

HSP 2 Score: 80.1073 bits (196), Expect = 8.172e-15
Identity = 66/215 (30.70%), Postives = 90/215 (41.86%), Query Frame = 1
Query: 1222 ARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            ARW+   WS CS SC   G Q R V C+KL           +      ++P   + CS    C +W  S     QC   CIG   A+ +  V C  RD         +  +    C    C V W++S WT C+ +CG  G Q+R + CV   T     D +C+  +  +     + TP      C D  + CEK K  K C +  F  RCC TC
Sbjct: 1134 ARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTS--PWGQCHGPCIGPRMALQHRQVYCKTRDGTI------VSPEQCQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSWRSRPINWQRCNITP----FDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1334          

HSP 3 Score: 64.3142 bits (155), Expect = 5.750e-10
Identity = 54/217 (24.88%), Postives = 84/217 (38.71%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRY-------------------------------NCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG-TVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   W++CS +CG G Q +   C +  ++   +   E+       +P ++ CN  DC     W    W+ C+ +CG+ G++ R V C+D  G  +    C    KP     C  +                               +  P FI   W PC     C  GIQ+R++ C  LL    T+  LP E C       P  +++C+S  C  E
Sbjct:  392 ENTPWTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPC--SVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCYSGPCNGE 597          

HSP 4 Score: 60.077 bits (144), Expect = 1.291e-8
Identity = 57/214 (26.64%), Postives = 97/214 (45.33%), Query Frame = 1
Query:  118 ERFIQKMRFLQWVVFIHSIFTILLTKAQFEEKEIR----KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECL--DSEGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +RF  K   L+    + + F++ +  A   +  ++    +P IH   E + +  CS +CG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C+  D  G+  SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  268 QRFPDK-EILRMAGPLSADFSVKVHYAGAADSVVQFIFYQPIIHRWRETDFFP-CSASCGGGYQLTSAECYDLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLASDGYKQIMPYDLYHPLPRWENTPWTACSSSCGG-GIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDC-PKWLAQEWSPCT--VTCGHGLRYRVVLCI 475          

HSP 5 Score: 58.151 bits (139), Expect = 3.887e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFC-EKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC--YEKGLITPTNKRSCHSRKCL 786
            + W+   +T CS SCGN GIQ  ++ C+  + E V+  +C EK R       C R +CP +++ ++W  C     C  G Q R + C  L   G  V +  +AC  + K    P + +SC  + C+
Sbjct: 1076 YQWSAVGFTPCSASCGNRGIQHPQLRCV-LDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSC--SQSCGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSK---RPVDSQSCSRQLCV 1195          

HSP 6 Score: 55.8398 bits (133), Expect = 2.003e-7
Identity = 61/190 (32.11%), Postives = 83/190 (43.68%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-----CDIKAKPMME-CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWK-PTG---LPAGDICNQINLKL-PQVMKSCT 1752
            RW  G WS CS++C   G Q R V+C  L          L D+ C    + KPT  + C+  F CP    S+ +  QCS  C   G  I    V C  R     +       C     P  + C N  C  +W I+ W+QCS +CGE G Q +  +C  K  TG   +    +C  INL + P  + +CT
Sbjct:  680 RWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNR-FDCPPAWYSS-EWKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCT 859          

HSP 7 Score: 54.6842 bits (130), Expect = 4.908e-7
Identity = 52/182 (28.57%), Postives = 73/182 (40.11%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVC--FQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNG-----------------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD---NGTVV 705
            WS CS +CG G Q +   C    T    + ++P E C    T   T + C  G C NG                       + W    +T CS SCG  G+Q   V CL+ +   +V +  C   R+P    ++C    CPP++    W  C     C  G+Q R + C  L+    N TVV
Sbjct:  542 WSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG--TKPATQQTCYSGPC-NGEAMDYNPDEDELSYGGLKDIEELYDWEYEGFTECSESCGG-GLQEAIVVCLNKQTRVTVGESLCVASRRPPPLLKSCNMEACPPRWEIGNWSTC--SLTCGVGLQTRDVFCSHLISRETNETVV 717          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 94.3597 bits (233), Expect = 3.256e-19
Identity = 86/362 (23.76%), Postives = 148/362 (40.88%), Query Frame = 1
Query:  211 KEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD------SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME-----------------------------------------KSTNLEI-----------KIDNRTLVQMLPMKRLDIQ----------LGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAG 1086
            K+I + +  E   ++ CS++CG G Q+ + VC   QT + + E++    C       P ++ CN   C     W  G+W+ CS +CG  G+QTR+V C        +E   + D FC +  KP   + C R++CPP + SS W+ C     C  GI  R + C   L +G++++LP   C       P ++  C +  C  E                                          S NL +           K  ++   Q+  +++L IQ          +G  ++++  T L L+C +++F K  IIW    +       + + + ++ +G + I      D G + C AG
Sbjct:  577 KDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRVTVGESL----CVASRRPPPLLKSCNMEACPP--RWEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQC--SQTCGGGIHTREVLCKQRLSDGSILELPETFCSSS---KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 921          

HSP 2 Score: 93.5893 bits (231), Expect = 4.844e-19
Identity = 95/363 (26.17%), Postives = 147/363 (40.50%), Query Frame = 1
Query:  889 IIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV-ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWE-----------------IRNIQLQSDLPNVLTKLSVIMKDI---------------ARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP-TDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            +  G    + C +K     NI WIH+SQ      +   R  + +NG+++ +T  SK  +GE+ C   + S  +  ++    +  R+++                 I++ QL+  L      +S  ++                 ARW+   WS CS SC   G Q R V C+KL           +      ++P   + CS    C +W  S     QC   CIG   A+ +  V C  RD      ++C    +P+    C    C V W++S WT C+ +CG  G Q+R + CV   T     D +C+      P   + C    C  + C D  + CEK K  K C +  F  RCC TC
Sbjct: 1381 VNLGGSALIGCPLKGHIMPNISWIHESQPLGTNVRL--RHELLENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTS--PWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSW--RSRPINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1735          

HSP 3 Score: 64.6994 bits (156), Expect = 4.269e-10
Identity = 54/217 (24.88%), Postives = 84/217 (38.71%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRY-------------------------------NCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG-TVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   W++CS +CG G Q +   C +  ++   +   E+       +P ++ CN  DC     W    W+ C+ +CG+ G++ R V C+D  G  +    C    KP     C  +                               +  P FI   W PC     C  GIQ+R++ C  LL    T+  LP E C       P  +++C+S  C  E
Sbjct:  355 ENTPWTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPC--SVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCYSGPCNGE 560          

HSP 4 Score: 63.5438 bits (153), Expect = 1.011e-9
Identity = 56/199 (28.14%), Postives = 93/199 (46.73%), Query Frame = 1
Query:  118 ERFIQKMRFLQWVVFIHSIFTILLTKAQFEEKEIR----KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL--DSEGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +RF  K   L+    + + F++ +  A   +  ++    +P IH   E + +  CS +CG GYQ     C+   +  +V +    Y    +   P +++CN   C     W    WT CS SCG  GIQ+R V C+  D  G+  SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  248 QRFPDK-EILRMAGPLSADFSVKVHYAGAADSVVQFIFYQPIIHRWRETDFFP-CSASCGGGYQLTSAECYDLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCL--ARWENTPWTACSSSCGG-GIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDC-PKWLAQEWSPCT--VTCGHGLRYRVVLCI 438          

HSP 5 Score: 58.9214 bits (141), Expect = 2.869e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFC-EKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC--YEKGLITPTNKRSCHSRKCL 786
            + W+   +T CS SCGN GIQ  ++ C+  + E V+  +C EK R       C R +CP +++ ++W  C     C  G Q R + C  L   G  V +  +AC  + K    P + +SC  + C+
Sbjct: 1465 YQWSAVGFTPCSASCGNRGIQHPQLRCV-LDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSC--SQSCGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSK---RPVDSQSCSRQLCV 1584          

HSP 6 Score: 58.151 bits (139), Expect = 4.993e-8
Identity = 43/158 (27.22%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFV--WNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTV 702
            +  WSSCS +CG G+Q +   C + T      +P    ++  TV  + R  +   C+      W T  W +C   C      +Q R+V C   +G  V  + C+   +P  ++NC    C   +  SAW  C +    + G Q R + CV    N +V
Sbjct: 1527 VTSWSSCSQSCGGGFQTRRVTCQKLTSM---GLPVAVANDACTVF-SKRPVDSQSCSRQLCVEWTTSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCG-NYGFQSRRVECVHHRTNKSV 1679          

HSP 7 Score: 56.6102 bits (135), Expect = 1.309e-7
Identity = 61/190 (32.11%), Postives = 83/190 (43.68%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-----CDIKAKPMME-CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWK-PTG---LPAGDICNQINLKL-PQVMKSCT 1752
            RW  G WS CS++C   G Q R V+C  L          L D+ C    + KPT  + C+  F CP    S+ +  QCS  C   G  I    V C  R     +       C     P  + C N  C  +W I+ W+QCS +CGE G Q +  +C  K  TG   +    +C  INL + P  + +CT
Sbjct:  643 RWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNR-FDCPPAWYSS-EWKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCT 822          

HSP 8 Score: 55.4546 bits (132), Expect = 3.095e-7
Identity = 52/182 (28.57%), Postives = 73/182 (40.11%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVC--FQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNG-----------------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD---NGTVV 705
            WS CS +CG G Q +   C    T    + ++P E C    T   T + C  G C NG                       + W    +T CS SCG  G+Q   V CL+ +   +V +  C   R+P    ++C    CPP++    W  C     C  G+Q R + C  L+    N TVV
Sbjct:  505 WSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG--TKPATQQTCYSGPC-NGEAMDYNPDEDELSYGGLKDIEELYDWEYEGFTECSESCGG-GLQEAIVVCLNKQTRVTVGESLCVASRRPPPLLKSCNMEACPPRWEIGNWSTC--SLTCGVGLQTRDVFCSHLISRETNETVV 680          
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 93.9745 bits (232), Expect = 3.618e-19
Identity = 86/362 (23.76%), Postives = 148/362 (40.88%), Query Frame = 1
Query:  211 KEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD------SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME-----------------------------------------KSTNLEI-----------KIDNRTLVQMLPMKRLDIQ----------LGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAG 1086
            K+I + +  E   ++ CS++CG G Q+ + VC   QT + + E++    C       P ++ CN   C     W  G+W+ CS +CG  G+QTR+V C        +E   + D FC +  KP   + C R++CPP + SS W+ C     C  GI  R + C   L +G++++LP   C       P ++  C +  C  E                                          S NL +           K  ++   Q+  +++L IQ          +G  ++++  T L L+C +++F K  IIW    +       + + + ++ +G + I      D G + C AG
Sbjct:  592 KDIEELYDWEYEGFTECSESCGGGLQEAIVVCLNKQTRVTVGESL----CVASRRPPPLLKSCNMEACPP--RWEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQ-PKPTLVQACNRFDCPPAWYSSEWKQC--SQTCGGGIHTREVLCKQRLSDGSILELPETFCSSS---KPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQITGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGKHLI----SSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 936          

HSP 2 Score: 93.2041 bits (230), Expect = 6.127e-19
Identity = 95/363 (26.17%), Postives = 147/363 (40.50%), Query Frame = 1
Query:  889 IIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV-ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWE-----------------IRNIQLQSDLPNVLTKLSVIMKDI---------------ARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP-TDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGD-ICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            +  G    + C +K     NI WIH+SQ      +   R  + +NG+++ +T  SK  +GE+ C   + S  +  ++    +  R+++                 I++ QL+  L      +S  ++                 ARW+   WS CS SC   G Q R V C+KL           +      ++P   + CS    C +W  S     QC   CIG   A+ +  V C  RD      ++C    +P+    C    C V W++S WT C+ +CG  G Q+R + CV   T     D +C+      P   + C    C  + C D  + CEK K  K C +  F  RCC TC
Sbjct: 1392 VNLGGSALIGCPLKGHIMPNISWIHESQPLGTNVRL--RHELLENGQILRLTNISKDHQGEYRCIIKNPSESVIQRAFLSIQASREYQWSAVGFTPCSASCGNRGIQHPQLRCVLDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSCSQSC-GGGFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSCSRQL-CVEWTTS--PWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCGNYGFQSRRVECVHHRTNKSVPDHLCSW--RSRPINWQRCNITPCENIDCRDTTRYCEKVKQLKLCQLAQFRSRCCGTC 1746          

HSP 3 Score: 64.6994 bits (156), Expect = 4.422e-10
Identity = 54/217 (24.88%), Postives = 84/217 (38.71%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRY-------------------------------NCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG-TVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   W++CS +CG G Q +   C +  ++   +   E+       +P ++ CN  DC     W    W+ C+ +CG+ G++ R V C+D  G  +    C    KP     C  +                               +  P FI   W PC     C  GIQ+R++ C  LL    T+  LP E C       P  +++C+S  C  E
Sbjct:  370 ENTPWTACSSSCGGGIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDCPK---WLAQEWSPCTVTCGH-GLRYRVVLCIDHRG--IHTGGCSSKTKPHIKEECTVHIPCYKAKEKLPVEAKLPWYKQAQELEEVTAVSEEPSFIPEPWSPC--SVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEG---TKPATQQTCYSGPCNGE 575          

HSP 4 Score: 60.077 bits (144), Expect = 1.114e-8
Identity = 57/214 (26.64%), Postives = 97/214 (45.33%), Query Frame = 1
Query:  118 ERFIQKMRFLQWVVFIHSIFTILLTKAQFEEKEIR----KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECL--DSEGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +RF  K   L+    + + F++ +  A   +  ++    +P IH   E + +  CS +CG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C+  D  G+  SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  246 QRFPDK-EILRMAGPLSADFSVKVHYAGAADSVVQFIFYQPIIHRWRETDFFP-CSASCGGGYQLTSAECYDLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLASDGYKQIMPYDLYHPLPRWENTPWTACSSSCGG-GIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDC-PKWLAQEWSPCT--VTCGHGLRYRVVLCI 453          

HSP 5 Score: 58.5362 bits (140), Expect = 3.181e-8
Identity = 39/126 (30.95%), Postives = 62/126 (49.21%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFC-EKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC--YEKGLITPTNKRSCHSRKCL 786
            + W+   +T CS SCGN GIQ  ++ C+  + E V+  +C EK R       C R +CP +++ ++W  C     C  G Q R + C  L   G  V +  +AC  + K    P + +SC  + C+
Sbjct: 1476 YQWSAVGFTPCSASCGNRGIQHPQLRCV-LDKEEVNISYCLEKPRPSIKPTACNRRDCPARWMVTSWSSC--SQSCGGGFQTRRVTCQKLTSMGLPVAVANDACTVFSK---RPVDSQSCSRQLCV 1595          

HSP 6 Score: 58.151 bits (139), Expect = 5.306e-8
Identity = 43/158 (27.22%), Postives = 68/158 (43.04%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFV--WNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTV 702
            +  WSSCS +CG G+Q +   C + T      +P    ++  TV  + R  +   C+      W T  W +C   C      +Q R+V C   +G  V  + C+   +P  ++NC    C   +  SAW  C +    + G Q R + CV    N +V
Sbjct: 1538 VTSWSSCSQSCGGGFQTRRVTCQKLTSM---GLPVAVANDACTVF-SKRPVDSQSCSRQLCVEWTTSPWGQCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCG-NYGFQSRRVECVHHRTNKSV 1690          

HSP 7 Score: 56.6102 bits (135), Expect = 1.476e-7
Identity = 61/190 (32.11%), Postives = 83/190 (43.68%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-----CDIKAKPMME-CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWK-PTG---LPAGDICNQINLKL-PQVMKSCT 1752
            RW  G WS CS++C   G Q R V+C  L          L D+ C    + KPT  + C+  F CP    S+ +  QCS  C   G  I    V C  R     +       C     P  + C N  C  +W I+ W+QCS +CGE G Q +  +C  K  TG   +    +C  INL + P  + +CT
Sbjct:  658 RWEIGNWSTCSLTC-GVGLQTRDVFCSHLISRETNETVVLGDDFCR---QPKPTLVQACNR-FDCPPAWYSS-EWKQCSQTC---GGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGE-GTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCT 837          

HSP 8 Score: 55.0694 bits (131), Expect = 3.705e-7
Identity = 49/179 (27.37%), Postives = 72/179 (40.22%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVC--FQTTLYLVENIPFEYC-----------------SNQLTVIPTIRKCNYG---DCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD---NGTVV 705
            WS CS +CG G Q +   C    T    + ++P E C                    +   P   + +YG   D    + W    +T CS SCG  G+Q   V CL+ +   +V +  C   R+P    ++C    CPP++    W  C     C  G+Q R + C  L+    N TVV
Sbjct:  520 WSPCSVSCGVGIQHRTVKCQVLLTFAQTIADLPLEECEGTKPATQQTCYSGPCNGEAMDYNPDEDELSYGGLKDIEELYDWEYEGFTECSESCGG-GLQEAIVVCLNKQTRVTVGESLCVASRRPPPLLKSCNMEACPPRWEIGNWSTC--SLTCGVGLQTRDVFCSHLISRETNETVV 695          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 90.8929 bits (224), Expect = 2.563e-18
Identity = 91/344 (26.45%), Postives = 137/344 (39.83%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP---TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG--TVVK------LPFEACYEKGLIT-------PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVL 1191
            P   EI  WS CS TCG G Q +  VC  + L   E       +++L   P   T++ CN  +C     W    W  CS +CG  GIQ R+V C     D     + + FC    KP + + CK+ +CP +++ S W  C     C  G Q RS  C  +L  G  TVV       LPF +     ++        P+ K S H             I       +Q    ++L   +G  ++++  T + L+C  ++F K  I W    Q           + ++  G + I +    D G + C AG    +  +K   L  G R    R + L S+    L
Sbjct:  650 PARWEIGKWSPCSLTCGVGLQTRDVVC--SHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPP--AWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSA-SKPTSHQGCKKDDCPSEWLLSEWSEC--SVSCGEGTQTRSAICQRVLKTGVSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPH-------------IAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQHSISSAH----VTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK---LIGGNRKLVARPLSLWSEEEEAL 965          

HSP 2 Score: 87.4261 bits (215), Expect = 3.091e-17
Identity = 90/357 (25.21%), Postives = 139/357 (38.94%), Query Frame = 1
Query:  898 GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV-ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQL----------------------QSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            G    L C IK  P  NI W    Q             I   G+++ +   S   +GE+ C A + +G L  K+  + + Y  W +  +                        + D  +   K    ++ +A        RW+   WS C+ SC   G Q R V C+KL           +    L ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     +       + P   + C    C   +C D  + CEK +  K C +  F  RCC TC
Sbjct: 1402 GNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHH--IWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGPR-PANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1750          

HSP 3 Score: 78.9518 bits (193), Expect = 1.367e-14
Identity = 59/193 (30.57%), Postives = 86/193 (44.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC---LDSEGESV---DDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   ++ CS++CG G Q+ +  C   QT     EN+    C         ++ CN   C     W  G W+ CS +CG  G+QTR+V C   L  E   V    D+ C    KP   + C R+NCPP +  + W+ C     C  GIQ R + C   + +G+ ++LP   C       PT+ + C    C  E
Sbjct:  595 EYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENL----CVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCG-VGLQTRDVVCSHLLSREMNEVVVLADELCH-HPKPSTVQACNRFNCPPAWYPAQWQLC--SRTCGGGIQKRDVLCKQRMADGSFLELPETFCSAS---KPTSHQGCKKDDCPSE 774          

HSP 4 Score: 65.855 bits (159), Expect = 1.426e-10
Identity = 49/160 (30.63%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  223 KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +P IH   E + +  CS TCG GYQ     C+   +  +V +    Y    +   P +++CN   C     W    WT CS SCG  GIQ+R V C++ + +    SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  295 QPIIHRWRETDFFP-CSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCP--ARWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCT--VTCGQGLRYRVVLCI 447          

HSP 5 Score: 60.4622 bits (145), Expect = 6.936e-9
Identity = 61/214 (28.50%), Postives = 90/214 (42.06%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYL---VENIPFEYCSNQLTVIPTIRKCNYGDCT---------NG-------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEG-ESVDDKFCEKFRK-PEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLL--DNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            FI E   WS+C+ TCG G Q ++  C Q  L     V ++P + C        + R C  G C          NG             + W    +T+CS SCG  G+Q   V CL+ +  E  D+  C   R+ P+  ++C    CP ++    W PC     C  G+Q R + C  LL  +   VV L  E C+      P+  ++C+   C
Sbjct:  509 FIPE--AWSACTVTCGVGTQVRIIRC-QVLLPFSQSVADLPADECEGPKPA--SQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCGG-GVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPC--SLTCGVGLQTRDVVCSHLLSREMNEVVVLADELCHHP---KPSTVQACNRFNC 711          

HSP 6 Score: 58.9214 bits (141), Expect = 1.803e-8
Identity = 59/232 (25.43%), Postives = 84/232 (36.21%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDN 825
            P   E   W++CS +CG G Q +   C +  +        E+       +P ++ CN  DC     W    W+ C+ +CG  G++ R V C+D  G  +    C    KP     C         R   P                       P FI  AW  C     C  G Q R I C  LL  + +V  LP + C       P ++R+C++  C  E     E   DN
Sbjct:  360 PARWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPK---WLAQEWSPCTVTCGQ-GLRYRVVLCIDHRG--MHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACT--VTCGVGTQVRIIRCQVLLPFSQSVADLPADECEGP---KPASQRACYAGPCNGETP---EFNPDN 577          

HSP 7 Score: 56.225 bits (134), Expect = 1.271e-7
Identity = 60/188 (31.91%), Postives = 77/188 (40.96%), Query Frame = 1
Query: 1138 RDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGC-PKWEISNVDLSQCSNHCIGIGRAIMNTNVRC-------IFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            R+    N+ + S  P  L K   +    ARW  GKWS CS++C   G Q R V C  L          L DE C      KP++ + C+  F C P W  +   L  CS  C   G  I   +V C        F + P        K      C    C  +W +S W++CS SCGE G Q R  IC
Sbjct:  623 RELADENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVVCSHLLSREMNEVVVLADELC---HHPKPSTVQACNR-FNCPPAWYPAQWQL--CSRTC---GGGIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVSCGE-GTQTRSAIC 798          

HSP 8 Score: 53.5286 bits (127), Expect = 9.176e-7
Identity = 33/124 (26.61%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASR-NCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN GI    + CL +  E VD + C    +P      C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct: 1480 YWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE-VDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLCV 1599          

HSP 9 Score: 53.5286 bits (127), Expect = 1.034e-6
Identity = 46/199 (23.12%), Postives = 79/199 (39.70%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPT-IRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +  WS+C+ +CG G Q +   C +     +         +QL   P   + CN   C     W    W +C+  C      +Q R+V C   +G ++  + C    +P +++NC    C   +  S W  C +    + G Q R + CV +  N  V +      P  A +++  +TP     C       EK   L++
Sbjct: 1542 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCG-NYGFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTECRDTTRYCEKVRQLKL 1736          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl3 (ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499])

HSP 1 Score: 90.5077 bits (223), Expect = 3.624e-18
Identity = 79/303 (26.07%), Postives = 128/303 (42.24%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKG---LITPTNKRSCHSRKCLMEKSTNL-----EIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            +  W +CS TCG G Q +   C     +       E C  +      +R CN  DC     W+   W +CS +CG  G Q R V C     D    ++ D+ C+   K  + ++C R +CPP+  +  W  C     C  G Q R   C  L   G  V +    C +     L+ P     C   K  +   T L     +I    R  +Q    KR+++ +G  ++++  T + +KC +++F K  I W    ++  +  +   +L I+K+G + I   +  D G + C AGS    + LK
Sbjct:  722 MGSWGACSATCGVGIQTRDVYCLHPEEFPAPP---EECREEKPH--ALRACNQFDCPPS--WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQG-PKASSHKSCARTDCPPQLAAGDWSKC--SVTCGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLVRPCQMPICSKAK--LGTKTKLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQW----EKDGHCLKNSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLK 1007          

HSP 2 Score: 85.1149 bits (209), Expect = 1.658e-16
Identity = 55/177 (31.07%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  196 AQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC 726
             + +EK+    +  E   ++ C+ TC  G+Q+ + VC  T  +   N     C       P  + CN   C     W+ G W  CS +CG  GIQTR+V CL  E      + C +  KP A R C +++CPP +    W+ C     C  G Q R + C  LL +G+ + L  E C
Sbjct:  648 GRLQEKDSEMTYDWEYAGFTPCTATCLGGHQEAIAVCLHTQTHQTVNDSL--CDTVHRPPPMSQACNMEPCPP--RWHMGSWGACSATCG-VGIQTRDVYCLHPEEFPAPPEECRE-EKPHALRACNQFDCPPSWHIEEWQQC--SRTCGGGTQNRRVTCRQLLTDGSFLNLSDELC 816          

HSP 3 Score: 72.0182 bits (175), Expect = 1.677e-12
Identity = 38/124 (30.65%), Postives = 59/124 (47.58%), Query Frame = 1
Query:  424 WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEAS-RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            W  G+WT CS +CG  G + +   C+ + G+ V +  C   RKP A  ++C   +CP ++ +S W  C   + C  G   R + C     NGTV  +   AC  K    P  ++ C  R C+ +
Sbjct: 1442 WEPGNWTHCSATCGPLGFRLQRPRCVMASGQEVSEALCGPHRKPLAGFQSCNIRDCPARWFTSMWSEC--SASCGEGFHSRQVTCKQTKANGTVQVVSPRACAPKD--RPLGRKPCSIRPCVQQ 1561          

HSP 4 Score: 68.1662 bits (165), Expect = 3.126e-11
Identity = 89/413 (21.55%), Postives = 140/413 (33.90%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIAR----------------WVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCP-KWEISNVDLSQCSNHC--------IGIGRAIMNTNVR------CIFRDQPTDLKRCDIKA------KPMMECAN--------------------------------------LG-CRVKWKISPWTQCSRSCGENGIQARYLICVWKPT-GLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTCR 1860
            L + +G          +++ C +K  P+ N+ W+             D + +  NG +++   S  +EG +IC A +  GK    S     G R  E R    ++  P V  K  V+    +R                W  G W+ CS +C   G + +   C           E  E L     KP +  Q      CP +W  S    S+CS  C        +   +   N  V+      C  +D+P   K C I+        P  +C                                        LG C   W++ PW  C+  CG  G Q+R + C+   +  + A   C Q+    P   + C  P C   C D    C   K    C + ++  RCC++C+
Sbjct: 1315 LSVVVGGTVEAALQANVTIHCPVKGVPQPNVTWLKTGGSLS------DNVSLLFNGSLLLQSASLENEGTYICTATNALGKAVATS-----GLRLLERREPGGKAAFPKV-QKTRVLQAPRSRINSNNLTGKSLPQEHFWEPGNWTHCSATCGPLGFRLQRPRCVMASGQ-----EVSEALCGPHRKPLAGFQSCNIRDCPARWFTSM--WSECSASCGEGFHSRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSIRPCVQQAIDPGNQCPGRCMGHATRMQHHHTACSHNSSSSDCEDGRRPAFGRNCTLGPCEACWRVGPWKPCTAVCGR-GFQSRKVDCIHTGSCKIVADRYCVQVK---PAAWRHCLGPSCDRNCTDTTHYCMFVKHLNLCSLAVYRQRCCQSCQ 1704          

HSP 5 Score: 58.5362 bits (140), Expect = 3.021e-8
Identity = 47/163 (28.83%), Postives = 72/163 (44.17%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYC---SNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLD----SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVS 681
            C+ TCG GYQ     C    L  V  +P  YC      +   P +++C+   C  ++GF              W    WT CS SCG  GIQ R   C++    +E   V++  C    KP   + C  ++C PK+++  W  C     C  G++YR + C++
Sbjct:  363 CTVTCGGGYQLNSAECMDIRLKRV--VPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHAEILQVEEWKCMYAPKPTVMQACNLFDC-PKWVAMEWSQCT--VTCGRGLRYRVVLCIN 519          

HSP 6 Score: 53.1434 bits (126), Expect = 1.093e-6
Identity = 49/182 (26.92%), Postives = 72/182 (39.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTI-RKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLL 687
            E N W++CS +CG G Q++  VC + +++  E +  E         PT+ + CN  DC     W    W++C+ +CG  G++ R V C++  G+ V    C    K      C         R   P                       PKFI   W  C   + C  GIQ R + C  LL
Sbjct:  435 EHNPWTACSVSCGGGIQRRSFVCVEESMH-AEILQVEEWKCMYAPKPTVMQACNLFDCPK---WVAMEWSQCTVTCGR-GLRYRVVLCINHRGQHVGG--CNPQMKLHIKEECVIPIPCYKPREKSPVEAKLPWLKQAQELEETRIATEEPKFIPEPWSAC--STTCGPGIQVREVRCRVLL 607          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 87.0409 bits (214), Expect = 3.862e-17
Identity = 90/357 (25.21%), Postives = 139/357 (38.94%), Query Frame = 1
Query:  898 GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV-ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQL----------------------QSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            G    L C IK  P  NI W    Q             I   G+++ +   S   +GE+ C A + +G L  K+  + + Y  W +  +                        + D  +   K    ++ +A        RW+   WS C+ SC   G Q R V C+KL           +    L ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     +       + P   + C    C   +C D  + CEK +  K C +  F  RCC TC
Sbjct: 1394 GNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHH--IWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGPR-PANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1742          

HSP 2 Score: 78.1814 bits (191), Expect = 2.364e-14
Identity = 88/372 (23.66%), Postives = 141/372 (37.90%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENI-------------------PFEYC----SNQLTVIP----------TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG--TVVK------LPFEACYEKGLIT-------PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVL 1191
            E   ++ CS++CG G Q+ +  C   QT     EN+                   P  +      N++ V+           T++ CN  +C     W    W  CS +CG  GIQ R+V C     D     + + FC    KP + + CK+ +CP +++ S W  C     C  G Q RS  C  +L  G  TVV       LPF +     ++        P+ K S H             I       +Q    ++L   +G  ++++  T + L+C  ++F K  I W    Q       +   + ++  G + I +    D G + C AG    +  +K   L  G R    R + L S+    L
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPP--AWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSA-SKPTSHQGCKKDDCPSEWLLSEWSEC--SVSCGEGTQTRSAICQRVLKTGVSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPH-------------IAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQH----SISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK---LIGGNRKLVARPLSLWSEEEEAL 957          

HSP 3 Score: 62.3882 bits (150), Expect = 1.943e-9
Identity = 50/175 (28.57%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  223 KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +P IH   E + +  CS TCG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C++ + +    SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  295 QPIIHRWRETDFFP-CSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCT--VTCGQGLRYRVVLCI 464          

HSP 4 Score: 62.003 bits (149), Expect = 2.081e-9
Identity = 64/252 (25.40%), Postives = 92/252 (36.51%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYL---VENIPFEYCSNQLTVIPTIRKCNYGDCT---------NG-------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEG-ESVDDKFCEKFR--------------------------------------KPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            FI E   WS+C+ TCG G Q ++  C Q  L     V ++P + C        + R C  G C          NG             + W    +T+CS SCG  G+Q   V CL+ +  E  D+  C   R                                      KP   + C R+NCPP +  + W+ C     C  GIQ R + C   + +G+ ++LP   C       PT+ + C    C  E
Sbjct:  526 FIPE--AWSACTVTCGVGTQVRIIRC-QVLLPFSQSVADLPADECEGPKPA--SQRACYAGPCNGETPEFNPDNGDGLLGGLQDLDELYDWEYEGFTKCSESCGG-GVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLC--SRTCGGGIQKRDVLCKQRMADGSFLELPETFCSAS---KPTSHQGCKKDDCPSE 766          

HSP 5 Score: 58.9214 bits (141), Expect = 2.013e-8
Identity = 58/228 (25.44%), Postives = 83/228 (36.40%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDN 825
            E   W++CS +CG G Q +   C +  +        E+       +P ++ CN  DC     W    W+ C+ +CG  G++ R V C+D  G  +    C    KP     C         R   P                       P FI  AW  C     C  G Q R I C  LL  + +V  LP + C       P ++R+C++  C  E     E   DN
Sbjct:  381 EATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPK---WLAQEWSPCTVTCGQ-GLRYRVVLCIDHRG--MHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACT--VTCGVGTQVRIIRCQVLLPFSQSVADLPADECEGP---KPASQRACYAGPCNGETP---EFNPDN 594          

HSP 6 Score: 53.5286 bits (127), Expect = 9.986e-7
Identity = 33/124 (26.61%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASR-NCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN GI    + CL +  E VD + C    +P      C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct: 1472 YWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE-VDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLCV 1591          

HSP 7 Score: 53.1434 bits (126), Expect = 1.154e-6
Identity = 48/200 (24.00%), Postives = 82/200 (41.00%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVEN-IPFEYCSNQLTVIPT-IRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +  WS+C+ +CG G Q +   C +     +   +  + CS QL   P   + CN   C     W    W +C+  C      +Q R+V C   +G ++  + C    +P +++NC    C   +  S W  C +    + G Q R + CV +  N  V +      P  A +++  +TP     C       EK   L++
Sbjct: 1534 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCS-QLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCG-NYGFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTECRDTTRYCEKVRQLKL 1728          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Thsd4 (thrombospondin, type I, domain containing 4 [Source:MGI Symbol;Acc:MGI:2672033])

HSP 1 Score: 77.411 bits (189), Expect = 2.529e-14
Identity = 63/203 (31.03%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  241 INVWSS-CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEG---ESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLV 837
            +  WS  CS  CG+G + +  VC       V ++P E C N   V  T   C+ G CT    W TG W++CS  CG+ G Q REV C+       E +D   C    KP + + C    C  K+ S+ W  C     C  G + R + C+S  D+ T    P   C  +  + P  + SC+++ C+ E   N + K  N  +V
Sbjct:  439 LTEWSERCSAECGAGVRTRSVVCMTNH---VSSLPLEGCGNNRPVEAT--PCDNGPCTGKVEWFTGSWSQCSIECGS-GTQQREVICVRKNADTFEVLDPYECSFLEKPPSQQACHLKPCGAKWFSTEWSMC--SKSCQGGFRVREVRCLS--DDMT----PSSLCDPQ--LKPEERESCNTQDCVPEVDENCKDKYYNCNVV 625          

HSP 2 Score: 63.929 bits (154), Expect = 4.039e-10
Identity = 44/150 (29.33%), Postives = 65/150 (43.33%), Query Frame = 1
Query:  253 SSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC---LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDN 693
            + CS TCG G Q  +  C     +  E +P  YC + +   P    CN   C     W+ G W+ CS +CG  G+Q R+V C     +   +V    C+   KPE +  C+   C    I + W  C     C  G + R + CVS + +
Sbjct:  267 TECSTTCGKGSQYPIFRCVHRNTH--EEVPESYCDSSMKPTPEEEPCNLFPCP--AFWDIGEWSECSKTCG-LGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSC--SVPCGVGQRTRDVKCVSNIGD 409          

HSP 3 Score: 63.929 bits (154), Expect = 4.519e-10
Identity = 54/187 (28.88%), Postives = 82/187 (43.85%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFE-YCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            P   +I  WS CS TCG G Q +  +C Q  +Y   ++  + Y    L    T   C    C+   +     WT CS  CG  G +TR+V+C+ + G+ V D+ C    +P    NC    C   +  + W    S ++C +G++ RS+ C++      V  LP E C   G   P     C +  C
Sbjct:  317 PAFWDIGEWSECSKTCGLGMQHRQVLCRQ--VYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRT--DWTSCSVPCG-VGQRTRDVKCVSNIGDMVHDEECNMKLRPNDIENCDMGPCAKSWFLTEWSERCS-AECGAGVRTRSVVCMT----NHVSSLPLEGC---GNNRPVEATPCDNGPC 490          

HSP 4 Score: 57.3806 bits (137), Expect = 5.011e-8
Identity = 47/153 (30.72%), Postives = 80/153 (52.29%), Query Frame = 1
Query: 1222 ARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPM-MECANLG-CRVKWKISPWTQ-CSRSCGENGIQARYLICV 1671
            A W  G+WS+CS +C   G Q R V C ++Y +    ++   C +HL EKP +   C +   C +W+I   D + CS  C G+G+   +        D   D + C++K +P  +E  ++G C   W ++ W++ CS  CG  G++ R ++C+
Sbjct:  318 AFWDIGEWSECSKTC-GLGMQHRQVLCRQVYANRSLTVQPYRC-QHL-EKPETTSTCQLKI-CSEWQI-RTDWTSCSVPC-GVGQRTRDVKCVSNIGDMVHD-EECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGA-GVRTRSVVCM 462          
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Match: Adamts9 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 [Source:MGI Symbol;Acc:MGI:1916320])

HSP 1 Score: 77.0258 bits (188), Expect = 5.407e-14
Identity = 112/507 (22.09%), Postives = 181/507 (35.70%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            + W+ CS +C  G Q++  +C  T   ++++     C++Q  V+  ++ CN   C +   W TG W+ C  +CG  G + R+V C   E + + D+ C+   KPE  + C++  C   + +  W  C     C  G Q R++                                    KC+M   T + +  DN       P    D +L      I    L+L+      P+RN   I ++ Q+R+   T       K  RM        D        GSV+ +    +                    LP  + K    +    +W A  WS CS++C   G   R V C    DH   R E +      +  P + + CS+   CP+W               G+     N + R           R D  ++  +   N     +W+  PW  CS +C   G Q R ++C     G  A D   +I    P   ++C    C
Sbjct:  423 SAWTECSRSCDGGTQRRRAICVNTRNDVLDD---SKCTHQEKVV--VQSCNEFSCPH---WKTGDWSECLVTCGK-GHKHRQVWCQFGE-DRLSDRMCDPEAKPEPMQTCQQPEC-AAWQAGPWGQC--SVTCGQGYQLRAV------------------------------------KCIM--GTYMSVVDDNDCNAATRPTDTQDCELASCHPSI----LALE------PRRNAQSIPRT-QWRFGSWTPCSATCGKGTRMRYVSCRDED--------GSVADESACAT--------------------LPKPVAKEECSVTPCGQWKALDWSSCSVTC-GQGKATRQVVCVNYSDHVIDRSECDP-----DYIPETDQDCSMSP-CPQW--------------TGLAHPFQNEDFR----------PRSDSPSRTHVLGGN-----QWRTGPWGACSSTCA-GGSQRRVVVCQ-DENGYTANDCVERIK---PDEQRACESGPC 798          

HSP 2 Score: 63.1586 bits (152), Expect = 8.801e-10
Identity = 45/121 (37.19%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLV-ENIPFEYCSNQLTV------IPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKR-YNC 588
            WS CS TCG GY+Q+L  C +  +Y   EN  + Y   Q TV       P++  C   DC     W  G+W  CS SCG  G+  R V+CL +E +      C    KPE  + C+  YNC
Sbjct: 1036 WSECSVTCGKGYRQRLVSCSE--IYTGKENYEYSY---QTTVNCPGAQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCG-IGVMHRSVQCLTNEDQP--SHLCPTDTKPEERKACRNVYNC 1148          

HSP 3 Score: 59.6918 bits (143), Expect = 1.086e-8
Identity = 114/528 (21.59%), Postives = 184/528 (34.85%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVE-----NIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDE----GEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSD----LPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP-TDLKRCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKC 1776
               W+ CS TCG G + +   C      + +      +P      + +V P  +            W    W+ CS +CG  G  TR+V C++     +D   C+    PE  ++C    C P++   A      D +  S    R+     +L        P+ AC      + T       R  + +          N  + ++ P ++   + G      +G+            +  ++   ++   R+   + + L    +     T     D     G W   + SVS     K R ++   +D       L+SD    LP              RW AG WS+CS+SC   G Q R V C+ +  H   R  + EC  +   +P S+R C     CP +        QC+  C   G       V C+  DQ       CD   +P     C+   C   W    W++CS +CG+ G + R + C    TG    +   Q  +  P        P  L  C
Sbjct:  607 FGSWTPCSATCGKGTRMRYVSCRDEDGSVADESACATLPKPVAKEECSVTPCGQ------------WKALDWSSCSVTCGQ-GKATRQVVCVNYSDHVIDRSECDPDYIPETDQDCSMSPC-PQWTGLAHPFQNEDFRPRSDSPSRT----HVLGGNQWRTGPWGAC------SSTCAGGSQRRVVVCQDENGYTA---NDCVERIKPDEQRACESGPCPQWAYGSWGECTKLCGGGMRTRLVVCQRANGDRFPDLSCEVLDKPTDREQCNTHACPQDAAWSTGPW--SSCSVSCGRGHKHRNVYCLAKD----GSHLESDNCKHLPKPHGHRRCRGGRCPRWKAGAWSQCSVSC-GQGVQQRHVGCQ-IGTHKAAR--ESECSSY--SRPESERVCQASP-CPLYTWRAEQWQQCTKTC---GEGSRYRQVVCVAEDQSEVHSTHCDSDQRPPDRESCSLQPCEYVWITGEWSECSVTCGK-GYRQRLVSCSEIYTGKENYEYSYQTTVNCPGAQPPSVHPCYLRDC 1090          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|P90884|MADD4_CAEEL (Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5)

HSP 1 Score: 178.333 bits (451), Expect = 1.024e-45
Identity = 152/608 (25.00%), Postives = 248/608 (40.79%), Query Frame = 1
Query:  214 EIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD--SEGESVD------DKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQS----------------------DLPNVLTKLSVIMKD----------------------IARWVAGKWSKC-SISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNH-CIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTP----PKCLLKCIDVYK---ICEKKKKYCHIEIFYYRC 1845
            E   P+      W+ CS +C  G Q+    C Q +    +++ +  C  +       R CN   C     W T  ++ CS SCG+ G   R V+C    S+ +  D      D  C  F+KP+ +  C    CP  ++++ W  C     CDSG + R + C      G   + P   C         N +      C     +  E+ + NR   Q    K+L + +G V+ +  GT + +KC  KKF K+ I W    +    K +    +++S NG + +      D G + C    + G + L  +     YRD+    + L                        +  +VL K++V + +                      +ARW  G WS+C   +C   G+Q R + C+  +      +++  C      +P   R C     CP+WE S    S+CS+  C+    A    NV C F +  + D++ CDI  +P   M+C N  C+ +W+ S W  CS  CG  G+Q R L CVW  +G PAG  C Q  ++ P   ++C      P C+     +Y+    C+ + ++C I   ++ C
Sbjct:  447 EDEAPYQWRYGDWTQCSASCLGGKQKAALKCIQVSTG--KSVQWSQCDARRRPPEKSRPCNQHPCPP--FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCH-FKKPQETETCNVVACPATWVTAQWTEC--SRSCDSGERRRQVWCEIRDSRGKTQRRPDVEC-------DANTKPQTVEVCSFGSCSRPEL-LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGK----KIKNDAHIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFK-----YRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLIEALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCHVAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHRE-DCPRWEASQ--WSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECGTGGVQLRLLSCVWISSGRPAGRNCEQ--MRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSC 1024          

HSP 2 Score: 61.6178 bits (148), Expect = 1.844e-8
Identity = 82/381 (21.52%), Postives = 146/381 (38.32%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-----DSEGESVDDKFCEKFRKPEASRNCKRYN-------------------CPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFG--TRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI--RNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCE 1305
            W+ C   CG G +++   C QT   +  ++P  +C N  T       C    C     W  G W++C+ SCG  G++ R V C+     D  G    +  C        + N   +N                     P+ ++  W  C   S C +G+  R++ CV++   +   +KLP   C ++    P    SC  R C +++        D++      P +       Q S    G   + +LKC I+    +++ W     + R   ++      +++        SK+ +    C +G+    ++           D  I  R+ +     P      +V+    A WV  +W++CS SC+S G + R V+CE
Sbjct:  244 WTECVPHCGEGTRKREVYCVQTAHNVTVHVPDTFCENG-TRPAAEENCVSTSCGR---WEAGKWSKCTASCGQ-GVRRRHVACVGGSDCDEGGRPRQETTCYAGIPCSIATNSLDWNDRAYLDGNTFGSMDNHNDWQAPRLVAGEWSTC--SSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQE--QPKLFESCEVRSCPLQE--------DSKLSEDEAPYQWRYGDWTQCSASCLGGKQKAALKC-IQVSTGKSVQWSQCDARRRPPEKSRP---CNQHPCPPFWLTSKYSDCSMSCGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACP-ATWVTAQWTECSRSCDS-GERRRQVWCE 601          

HSP 3 Score: 53.5286 bits (127), Expect = 6.423e-6
Identity = 43/154 (27.92%), Postives = 64/154 (41.56%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE---SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD 690
            +I  WS    +  S   Q + VC       V  +P + C+++L      R C    C +   W    WT C   CG  G + REV C+ +       V D FCE   +P A  NC   +C  ++ +  W  C   + C  G++ R + CV   D
Sbjct:  180 DIVDWSGAGRSIAS-TSQPIVVCVNAITGRV--VPEKLCADKLRPKVEARPCPMLICPSRCRWMAADWTECVPHCGE-GTRKREVYCVQTAHNVTVHVPDTFCENGTRPAAEENCVSTSC-GRWEAGKWSKCT--ASCGQGVRRRHVACVGGSD 326          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|P82987|ATL3_HUMAN (ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4)

HSP 1 Score: 98.2117 bits (243), Expect = 8.732e-20
Identity = 84/303 (27.72%), Postives = 127/303 (41.91%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKS--------TNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            +  W  CS TCG G Q +   C           P E C ++      ++ CN  DC  G  W+   W +CS +CG  G Q R V C     D    ++ D+ C+   K  + ++C R +CPP      W  C     C  GIQ R   C  L   G  + L    C  + L      RSC   +C   KS           +I    R  +Q    KR+++ +G  ++++  T + +KC +++F K  I W    ++     Q   RL I+K+G + I   +  D G + C AGS    + LK
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCLHPGETPA---PPEECRDEKPH--ALQACNQFDCPPG--WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQG-PKASSHKSCARTDCPPHLAVGDWSKC--SVSCGVGIQRRKQVCQRLAAKGRRIPLSEMMC--RDLPGLPLVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQW----EKDGRCLQNSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLK 994          

HSP 2 Score: 77.7962 bits (190), Expect = 2.256e-13
Identity = 88/405 (21.73%), Postives = 144/405 (35.56%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDW-EIRNIQLQSDLPNVL--TKLSVIMKDIAR--------WVAGKWSKCSISCESTGHQFRSVYC---------EKLYDHFYYRLEDEE----------------------CLKHLEEKP--------------TSKRQCSV---PFG--------CPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMM--ECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTCR 1860
            L + +G +     G  ++++C +K  P+ NI W+ +             + +  NG +++   S  +EG ++C A +  GK  + +  L    R W E R + LQ     +L  T       D           W  G WS CS +C   G + +   C         E L DH    L   E                      C +    +                S R C+    P G        C +WE  N    +C   C+G    +   +  C      ++   CD + +P +   C +  C V W   PW  C+ +CG  G Q+R + C+   +  P     + +  K P   + C  P C   C D    C   K    C ++ +  RCC++C+
Sbjct: 1301 LSVVVGGIVEAALGANVTIRCPVKGVPQPNITWLKRGGSLS------GNVSLLFNGSLLLQNVSLENEGTYVCIATNALGKA-VATSVLHLLERRWPESRIVFLQGHKKYILQATNTRTNSNDPTGEPPPQEPFWEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGN----RCPGRCMGRAVRMQQRHTACQHNSSDSN---CDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR-GFQSRKVDCIHTRSCKPVAKR-HCVQKKKPISWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQ 1689          

HSP 3 Score: 68.1662 bits (165), Expect = 2.202e-10
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  424 WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEAS-RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN 804
            W  G+W+ CS +CG+ G + +  +C+ + G+ V +  C+  +KP A    C   +CP ++ +S W  C     C  G   R + C     NGTV  +   AC  K    P  ++ C    C+  +  N
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFEPCNIRDCPARWFTSVWSQC--SVSCGEGYHSRQVTCKRTKANGTVQVVSPRACAPKD--RPLGRKPCFGHPCVQWEPGN 1551          

HSP 4 Score: 59.3066 bits (142), Expect = 9.878e-8
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYC---SNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDS--EGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVS 681
            C+ TCG GYQ     C    L  V  +P  YC      +   P +++C+   C  ++GF              W    WT CS SCG  GIQ R   C++    GE   V++  C    KP+  + C  ++C PK+I+  W  C     C  G++YR + C++
Sbjct:  351 CTVTCGGGYQLNSAECVDIRLKRV--VPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDC-PKWIAMEWSQCT--VTCGRGLRYRVVLCIN 507          

HSP 5 Score: 54.299 bits (129), Expect = 4.243e-6
Identity = 45/169 (26.63%), Postives = 68/169 (40.24%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNG-----------------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEA-SRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            FI E   WS+CS TCG G Q +   C     +            +   +PT R C    C                    + W    +T C+ +C   G Q     CL  + + +V+D  C+   +P A S+ C    CPP++   +W PC   + C  GIQ R ++C+
Sbjct:  568 FIPE--PWSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPC--SATCGVGIQTRDVYCL 731          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q8N6G6|ATL1_HUMAN (ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4)

HSP 1 Score: 94.7449 bits (234), Expect = 1.184e-18
Identity = 94/369 (25.47%), Postives = 147/369 (39.84%), Query Frame = 1
Query:  859 LDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEI------------RNIQ----------LQSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            L   LG    +  G    L C IK  P  NI W H  Q           + ++    + +   S   +GE+ C A + +G L  K+  + + Y  W +            R +Q           + +  +   K+   ++ IA        RW+   WS C+ SC   G Q R V C+KL           +    + ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     +       + P   + C    C  ++C D  + CEK K  K C +  F  RCC TC
Sbjct: 1398 LTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHI-LAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYW-WSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHARTNKAVPEHLCSWGPR-PANWQRCNITPCENMECRDTTRYCEKVKQLKLCQLSQFKSRCCGTC 1759          

HSP 2 Score: 88.1965 bits (217), Expect = 1.396e-16
Identity = 88/339 (25.96%), Postives = 135/339 (39.82%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP---TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG--TVVK------LPFEACYEKGLIT-------PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSD 1176
            P   EI  WS CS TCG G Q   R  F + L   E       +++L   P   T++ CN  +C     W    W  CS +CG  G+Q REV C     D     + + FC    KP   + CK+ +CP +++ S W  C   + C  G Q RS  C  +L  G  TVV       LPF +     ++        P+ K S H             I    +  +Q    ++L   +G  ++++  T + L+C  ++  K  I W    Q       +   + ++  G + I +    D G + C AG       +K   L  G R    R +  +S+
Sbjct:  667 PARWEIGKWSPCSLTCGVGLQ--TRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPP--AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFCSA-SKPACQQACKKDDCPSEWLLSDWTEC--STSCGEGTQTRSAICRKMLKTGLSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPH-------------IAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQH----LISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAGPAREHFVIK---LIGGNRKLVARPLSPRSE 977          

HSP 3 Score: 79.337 bits (194), Expect = 7.464e-14
Identity = 56/193 (29.02%), Postives = 88/193 (45.60%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD------SEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   ++ CS++CG G Q+ +  C   QT     EN+    C         ++ CN   C     W  G W+ CS +CG  G+QTR+V C        +E   + D+ C +  KP   + C R+NCPP +  + W+PC     C  G+Q R + C   + +G+ ++LP   C       P  +++C    C  E
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQTREPAEENL----CVTSRRPPQLLKSCNLDPCP--ARWEIGKWSPCSLTCG-VGLQTRDVFCSHLLSREMNETVILADELCRQ-PKPSTVQACNRFNCPPAWYPAQWQPC--SRTCGGGVQKREVLCKQRMADGSFLELPETFCSAS---KPACQQACKKDDCPSE 791          

HSP 4 Score: 63.1586 bits (152), Expect = 7.818e-9
Identity = 50/175 (28.57%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  223 KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +P IH   E + +  CS TCG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C++ + +    SV++  C    K   ++ C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  295 QPIIHRWRETDFFP-CSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCT--VTCGQGLRYRVVLCI 464          

HSP 5 Score: 59.3066 bits (142), Expect = 9.690e-8
Identity = 61/215 (28.37%), Postives = 92/215 (42.79%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYL---VENIPFEYCSNQLTVIPTIRKCNYGDC-----------TNG-----------FVWNTGHWTRCSHSCGNFGIQTREVECLDSEG-ESVDDKFCEKFRK-PEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD---NGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            FI E   WS+C+ TCG G Q ++  C Q  L     V ++P + C        + R C  G C           T+G           + W    +T+CS SCG  G+Q   V CL+ +  E  ++  C   R+ P+  ++C    CP ++    W PC     C  G+Q R + C  LL    N TV+ L  E C +     P+  ++C+   C
Sbjct:  526 FIPE--AWSACTVTCGVGTQVRIVRC-QVLLSFSQSVADLPIDECEGPKPA--SQRACYAGPCSGEIPEFNPDETDGLFGGLQDFDELYDWEYEGFTKCSESCGG-GVQEAVVSCLNKQTREPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPC--SLTCGVGLQTRDVFCSHLLSREMNETVI-LADELCRQP---KPSTVQACNRFNC 728          

HSP 6 Score: 56.6102 bits (135), Expect = 7.066e-7
Identity = 59/187 (31.55%), Postives = 77/187 (41.18%), Query Frame = 1
Query: 1138 RDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYR---LEDEECLKHLEEKPTSKRQCSVPFGCP-KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCD----IKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            R+    N+ + S  P  L K   +    ARW  GKWS CS++C   G Q R V+C  L          L DE C    + KP++ + C+  F CP  W  +      CS  C   G  +    V C  R                +KP     C    C  +W +S WT+CS SCGE G Q R  IC
Sbjct:  640 REPAEENLCVTSRRPPQLLKSCNLDPCPARWEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNR-FNCPPAWYPAQ--WQPCSRTC---GGGVQKREVLCKQRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGE-GTQTRSAIC 815          

HSP 7 Score: 55.8398 bits (133), Expect = 1.129e-6
Identity = 53/217 (24.42%), Postives = 79/217 (36.41%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            E   W++CS +CG G Q +   C +  +        E+       +P  + CN  DC     W    W+ C+ +CG  G++ R V C+D  G  +    C    KP     C         +   P                       P FI  AW  C     C  G Q R + C  LL  + +V  LP + C       P ++R+C++  C  E
Sbjct:  381 EATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDCPK---WLAQEWSPCTVTCGQ-GLRYRVVLCIDHRG--MHTGGCSPKTKPHIKEECIVPTPCYKPKEKLPVEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACT--VTCGVGTQVRIVRCQVLLSFSQSVADLPIDECEGP---KPASQRACYAGPCSGE 586          

HSP 8 Score: 53.1434 bits (126), Expect = 8.084e-6
Identity = 31/123 (25.20%), Postives = 54/123 (43.90%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN G+Q   + CL +  E        K R       C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct: 1489 YWWSVDRLATCSASCGNRGVQQPRLRCLLNSTEVNPAHCAGKVRPAVQPIACNRRDCPSRWMVTSWSACTRS--CGGGVQTRRVTCQKLKASGISTPVSNDMCTQVAK-RPVDTQACNQQLCV 1608          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q8BLI0|ATL1_MOUSE (ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.701e-16
Identity = 90/357 (25.21%), Postives = 139/357 (38.94%), Query Frame = 1
Query:  898 GTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV-ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQL----------------------QSDLPNVLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPT-DLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICEKKK--KYCHIEIFYYRCCKTC 1857
            G    L C IK  P  NI W    Q             I   G+++ +   S   +GE+ C A + +G L  K+  + + Y  W +  +                        + D  +   K    ++ +A        RW+   WS C+ SC   G Q R V C+KL           +    L ++P   + C+    C +W  S+    QC+  CIG   A+ +  V C  RD  T   ++C    +P+    C +  C V W++S WT C+ +CG  G Q+R + CV   T     +       + P   + C    C   +C D  + CEK +  K C +  F  RCC TC
Sbjct: 1394 GNSALLGCPIKGHPTPNITWFQNGQPIATAPGLTHH--IWGAGQILRVANLSGGPQGEFSCLAQNEAGTLLQKASLVIQDYW-WSVDRLATCSASCGNRGIHQPRLRCLLNTTEVDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACTRSC-GGGVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQQL-CVEWAFSS--WGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNYGFQSRRVECVHVRTNKAVPEHLCSWGPR-PANWQRCNVTPCENTECRDTTRYCEKVRQLKLCQLGQFRSRCCGTC 1742          

HSP 2 Score: 78.1814 bits (191), Expect = 1.654e-13
Identity = 88/372 (23.66%), Postives = 141/372 (37.90%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCF--QTTLYLVENI-------------------PFEYC----SNQLTVIP----------TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNG--TVVK------LPFEACYEKGLIT-------PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVL 1191
            E   ++ CS++CG G Q+ +  C   QT     EN+                   P  +      N++ V+           T++ CN  +C     W    W  CS +CG  GIQ R+V C     D     + + FC    KP + + CK+ +CP +++ S W  C     C  G Q RS  C  +L  G  TVV       LPF +     ++        P+ K S H             I       +Q    ++L   +G  ++++  T + L+C  ++F K  I W    Q       +   + ++  G + I +    D G + C AG    +  +K   L  G R    R + L S+    L
Sbjct:  612 EYEGFTKCSESCGGGVQEAVVSCLNKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPP--AWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSA-SKPTSHQGCKKDDCPSEWLLSEWSEC--SVSCGEGTQTRSAICQRVLKTGVSTVVNSTLCPPLPFSSSIRPCMLATCARPGRPSTKHSPH-------------IAAARNIYIQTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQH----SISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIK---LIGGNRKLVARPLSLWSEEEEAL 957          

HSP 3 Score: 62.3882 bits (150), Expect = 1.359e-8
Identity = 50/175 (28.57%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  223 KPFIH---EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            +P IH   E + +  CS TCG GYQ     C+   +  +V +    Y    +   P +++CN   C  ++G+              W    WT CS SCG  GIQ+R V C++ + +    SV++  C    K    + C  ++C PK+++  W PC     C  G++YR + C+
Sbjct:  295 QPIIHRWRETDFFP-CSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCT--VTCGQGLRYRVVLCI 464          

HSP 4 Score: 58.9214 bits (141), Expect = 1.408e-7
Identity = 58/228 (25.44%), Postives = 83/228 (36.40%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDN 825
            E   W++CS +CG G Q +   C +  +        E+       +P ++ CN  DC     W    W+ C+ +CG  G++ R V C+D  G  +    C    KP     C         R   P                       P FI  AW  C     C  G Q R I C  LL  + +V  LP + C       P ++R+C++  C  E     E   DN
Sbjct:  381 EATPWTACSSSCGGGIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDCPK---WLAQEWSPCTVTCGQ-GLRYRVVLCIDHRG--MHTGGCSAKTKPHIKEECIIPTPCYKPREKLPIEAKLPWFKQAQELEEGAAVSEEPSFIPEAWSACT--VTCGVGTQVRIIRCQVLLPFSQSVADLPADECEGP---KPASQRACYAGPCNGETP---EFNPDN 594          

HSP 5 Score: 53.5286 bits (127), Expect = 6.985e-6
Identity = 33/124 (26.61%), Postives = 57/124 (45.97%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASR-NCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCL 786
            + W+      CS SCGN GI    + CL +  E VD + C    +P      C R +CP +++ ++W  C     C  G+Q R + C  L  +G    +  + C +     P + ++C+ + C+
Sbjct: 1472 YWWSVDRLATCSASCGNRGIHQPRLRCLLNTTE-VDPEHCTGKPRPAVQPVACNRRDCPSRWMVTSWSACT--RSCGGGVQTRRVTCQKLKASGISTPVSNDMCSQLAK-RPVDTQACNQQLCV 1591          

HSP 6 Score: 53.1434 bits (126), Expect = 8.073e-6
Identity = 48/200 (24.00%), Postives = 82/200 (41.00%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVEN-IPFEYCSNQLTVIPT-IRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +  WS+C+ +CG G Q +   C +     +   +  + CS QL   P   + CN   C     W    W +C+  C      +Q R+V C   +G ++  + C    +P +++NC    C   +  S W  C +    + G Q R + CV +  N  V +      P  A +++  +TP     C       EK   L++
Sbjct: 1534 VTSWSACTRSCGGGVQTRRVTCQKLKASGISTPVSNDMCS-QLAKRPVDTQACNQQLCVE---WAFSSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCG-NYGFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTECRDTTRYCEKVRQLKL 1728          
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9P2N4|ATS9_HUMAN (A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4)

HSP 1 Score: 85.1149 bits (209), Expect = 1.194e-15
Identity = 130/541 (24.03%), Postives = 205/541 (37.89%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESV-DDKFCEKFRKPEASRNCKRYNCPPKFIS-----------------SAWEPCVSDSKCDSGIQYRSIHC----VSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHII--------FGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFD-RLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEI-SNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP-TDLKRCDIKAKPMMECANLGCRV-KWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLL 1770
            WS C  TCG G++ +     Q      E+   +   +  T   +++ C   +C +   W  G W +CS +CG  G Q R V+C+     SV DD  C    +P  +++C+  +C P   +                  +W PC   + C  G + R + C     S+ D      LP     E+  +TP     C   K L   S ++      R   Q++ +   D       H+I        +       CS+   P+R       S   ++ FQ  D R R +   R  +   ++   G W   + + +G  Q   R +     +    N  ++   P+   + +       +W  G W +C+  C   G + R V C++       R  D  C   + +KP  + QC+    CP     S    S CS  C   GR     NV C+ +D    +   C   AKP       G R  KWK   W+QCS SCG  G+Q R++ C      +     CN      P+  + C  P+C L
Sbjct: 1061 WSECLVTCGKGHKHR-----QVWCQFGEDRLNDRMCDPETKPTSMQTCQQPECAS---WQAGPWGQCSVTCGQ-GYQLRAVKCIIGTYMSVVDDNDCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPC--SATCGKGTRMRYVSCRDENGSVADESACATLPRPVAKEECSVTP-----CGQWKALDWSSCSVTCG-QGRATRQVMCVNYSD-------HVIDRSECDQDYIPETDQDCSMSPCPQRTP----DSGLAQHPFQNEDYRPRSASPSRTHVLGGNQWRTGPWGACSSTCAGGSQ--RRVVVCQDENGYTANDCVERIKPD--EQRACESGPCPQWAYGNWGECTKLC-GGGIRTRLVVCQRSNGE---RFPDLSC--EILDKPPDREQCNT-HACPHDAAWSTGPWSSCSVSC---GRGHKQRNVYCMAKDGSHLESDYCKHLAKPHGHRKCRGGRCPKWKAGAWSQCSVSCGR-GVQQRHVGCQIGTHKIARETECNPYT--RPESERDCQGPRCPL 1556          

HSP 2 Score: 68.5514 bits (166), Expect = 1.672e-10
Identity = 47/144 (32.64%), Postives = 70/144 (48.61%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCP-PKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            WSSCS +CG G++Q+   C       +E+   +YC + L      RKC  G C     W  G W++CS SCG  G+Q R V C     +   +  C  + +PE+ R+C+   CP   + +  W+ C     C  G +YR + CV
Sbjct: 1450 WSSCSVSCGRGHKQRNVYCMAKDGSHLES---DYCKH-LAKPHGHRKCRGGRCPK---WKAGAWSQCSVSCGR-GVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECT--KTCGEGSRYRKVVCV 1583          

HSP 3 Score: 64.6994 bits (156), Expect = 2.361e-9
Identity = 43/118 (36.44%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLV-ENIPFEYCSN---QLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKR-YNC 588
            WS CS TCG GY+Q+L  C  + +Y   EN  + Y +      T  P++  C   DC     W  G+W  CS SCG  G+  R V+CL +E +      C    KPE  + C+  YNC
Sbjct: 1621 WSECSVTCGKGYKQRLVSC--SEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDCPVSATWRVGNWGSCSVSCG-VGVMQRSVQCLTNEDQP--SHLCHTDLKPEERKTCRNVYNC 1733          

HSP 4 Score: 63.5438 bits (153), Expect = 6.246e-9
Identity = 56/155 (36.13%), Postives = 76/155 (49.03%), Query Frame = 1
Query: 1222 ARWVAGKWSKCSISCESTGHQFRSVYC-EKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC-IFRDQPTDLKRCDIKAKPMME--CANLGCRV-KWKISPWTQCSRSCGENGIQARYLICV 1671
            A W  G WS CS+SC   GH+ R+VYC  K   H    LE + C KHL  KP   R+C     CPKW+      SQCS  C   GR +   +V C I   +      C+   +P  E  C    C +  W+   W +C+++CGE G + R ++CV
Sbjct: 1443 AAWSTGPWSSCSVSC-GRGHKQRNVYCMAKDGSH----LESDYC-KHL-AKPHGHRKCRGGR-CPKWKAGA--WSQCSVSC---GRGVQQRHVGCQIGTHKIARETECNPYTRPESERDCQGPRCPLYTWRAEEWQECTKTCGE-GSRYRKVVCV 1583          

HSP 5 Score: 61.2326 bits (147), Expect = 2.951e-8
Identity = 51/167 (30.54%), Postives = 76/167 (45.51%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHC------------IGIGRAIMNTNVRCIFRDQPTDLKRCDIK------AKPMMECANLGC-RVKWKISPWTQCSRSCGENGIQARYLIC 1668
            +W +G WS+C ++C   GH+ R V+C+   D    RL D  C    E KPTS + C  P  C  W+       QCS  C            IG   ++++ N  C    +PTD + C++       A P    +     R +W+   WT CS +CG+ G + RY+ C
Sbjct: 1055 QWKSGDWSECLVTC-GKGHKHRQVWCQFGED----RLNDRMC--DPETKPTSMQTCQQPE-CASWQAG--PWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDN-DCNAATRPTDTQDCELPSCHPPPAAPETRRSTYSAPRTQWRFGSWTPCSATCGK-GTRMRYVSC 1209          

HSP 6 Score: 58.151 bits (139), Expect = 2.303e-7
Identity = 50/154 (32.47%), Postives = 73/154 (47.40%), Query Frame = 1
Query: 1216 DIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            +   W    W++CS SC+  G Q R   C    +     L+D +C    +EK T +R CS  F CP+W+    D S+C   C   G+   +  V C F +   + + CD + KP  M  C    C   W+  PW QCS +CG+ G Q R + C+
Sbjct:  997 NTGGWRYSAWTECSKSCDG-GTQRRRAICVNTRNDV---LDDSKCTH--QEKVTIQR-CS-EFPCPQWKSG--DWSECLVTC---GKGHKHRQVWCQFGEDRLNDRMCDPETKPTSMQTCQQPEC-ASWQAGPWGQCSVTCGQ-GYQLRAVKCI 1135          

HSP 7 Score: 55.8398 bits (133), Expect = 1.451e-6
Identity = 39/145 (26.90%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            + W+ CS +C  G Q++  +C  T   ++++     C++Q  V  TI++C+   C     W +G W+ C  +CG  G + R+V C   E + ++D+ C+   KP + + C++  C   + +  W  C     C  G Q R++ C+
Sbjct: 1004 SAWTECSKSCDGGTQRRRAICVNTRNDVLDD---SKCTHQEKV--TIQRCSEFPCPQ---WKSGDWSECLVTCGK-GHKHRQVWCQFGE-DRLNDRMCDPETKPTSMQTCQQPEC-ASWQAGPWGQC--SVTCGQGYQLRAVKCI 1135          

HSP 8 Score: 54.299 bits (129), Expect = 4.355e-6
Identity = 52/187 (27.81%), Postives = 80/187 (42.78%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQ-PTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKC 1776
            +W AG WS+CS+SC   G Q R V C+ +  H   R  + EC  +   +P S+R C  P  CP +     +  +C+  C   G       V C+  ++      RCD+  +P+    C+   C   W    W++CS +CG+ G + R + C    TG    +   Q  +  P        P  L  C
Sbjct: 1500 KWKAGAWSQCSVSC-GRGVQQRHVGCQ-IGTHKIAR--ETECNPYT--RPESERDCQGPR-CPLYTWRAEEWQECTKTC---GEGSRYRKVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGK-GYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYLRDC 1675          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A504YRS1 (AdamTS protein 3 OS=Fasciola gigantica OX=46835 GN=FGIG_00549 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 4.801e-124
Identity = 208/595 (34.96%), Postives = 312/595 (52.44%), Query Frame = 1
Query:  145 LQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFE-YCSNQLTVIPTI--------RKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--LDSEGESVDDK-----FCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQ-QFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRN----IQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLF 1866
             Q V + +    +L+  +         P+  E + WSSCS TCG G Q++   C    +Y +  +  +  CS+Q   + T         R CN GDC +G+ W T  W  CS +CG FG  TR+V+C  +  +GE +  +     FC  + +PE   +C R +C P+F+   W  C+  + C  G Q R + C+S+  NGT  +LP  ACY  G       R C        +S    I  D  T+VQM   K L++Q+GQ +++I  TRL+++C +  F   +++W H++  + RY   + +R+++ K GR+ I  F   D GEW C AG  +  +    RT   G+ DW  RN      + SD P  +  +  I++    WV G WS CS+SC  TG QFR V CE++   FY  L+D+ CL  L  KP S+R+C     CP W +   D S C+++C+ + +  +  N+ C    Q  + K CD   KP M C N  C+VKW +S W+QCSRSCG  G++AR LICVW   G PAG +C    + +P+V++ C  P C L+C+D  K C K+ + C   ++ Y+CC +CR F
Sbjct:    9 FQSVTWTYPYLLLLVLGSTPLHAFTEPPYWQETDQWSSCSSTCGPGVQRRQYRCVSRDMYNILTVHEDSVCSSQPHPLTTNAGGDHVIERICNLGDC-HGYHWRTSPWGHCSQTCGGFGTMTRDVDCVYIGQDGEVIVQEQEAGYFCGHYPRPEKHGSCNRIDCKPEFVPEQWGKCIQSNPCQPGRQVRQVSCISVQVNGTHRQLPKAACYMTGRPQARTWRRCFVASTSNCESQEPTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRLNVRCPVHYFSVHDLVWKHRNHGEIRYTGLSNERVQVDKRGRLRIRSFRNEDAGEWTCIAGQKNATVTFSPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAIVQ----WVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVDGADSSVCTDNCLAVDQGSIRGNLTCRIGSQRVEDKLCDSSEKPDMTCPNSVCQVKWNVSAWSQCSRSCGGVGVRARQLICVWSHNGSPAGPLCYANQIPVPEVIEQCEAPPCQLECVDFSKHCPKRVELCKFTLYRYQCCASCRDF 598          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A4E0R7Q3 (AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D915_004461 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 1.704e-123
Identity = 207/595 (34.79%), Postives = 311/595 (52.27%), Query Frame = 1
Query:  145 LQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFE-YCSNQLTVIPTI--------RKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--LDSEGESVDDK-----FCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQ-QFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRN----IQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLF 1866
             Q V + +    +L+  +         P+  E + WSSCS TCG G Q++   C    +Y +  +  +  CS+Q   + T         R CN GDC +G+ W    W  CS +CG FG  TR+V+C  +  +GE +  +     FC  + +PE   +C R +C P+F+   W  C+  + C  G Q R + C+S+  NGT  +LP  ACY  G       R C        +S    I  D  T+VQM   K L++Q+GQ +++I  TRL+++C +  F   +++W H++  + RY   + +R+++ K GR+ I  F   D GEW C AG  +  +    RT   G+ DW  RN      + SD P  +  +  I++    WV G WS CS+SC  TG QFR V CE++   FY  L+D+ CL  L  KP S+R+C     CP W +   D S C+++C+ + +  +  N+ C    Q  + K CD   KP M C N  C+VKW +S W+QCSRSCG  G++AR LICVW   G PAG +C    + +P+V++ C  P C L+C+D  K C K+ + C   ++ Y+CC +CR F
Sbjct:    9 FQSVTWTYPYLLLLVLGSTPLHAFTEPPYWQETDQWSSCSSTCGPGVQRRQYRCVSRDMYNILTVHEDSVCSSQPHPLTTNAGGDHVIERICNLGDC-HGYHWRISPWGHCSQTCGGFGTMTRDVDCVYIGQDGEVIVQEQEAGYFCGHYPRPEKHSSCNRIDCKPEFVPEQWGKCIQSNPCQPGRQVRQVSCISVQVNGTHRQLPKAACYMAGRPQARTWRRCFVASTSNCESQEPTIDTDAMTIVQMRKAKILNLQVGQQAYVIPFTRLNVRCPVHYFSVHDLVWKHRNHGEIRYTGLSNERVQVDKRGRLRIRSFRNEDAGEWTCIAGQKNATVTFSPRTPAAGFHDWVQRNRLWTKGMMSDDPKDMAGVHAIVQ----WVEGPWSACSVSCGDTGQQFRVVRCERVDTRFYQILDDQACLDKLLPKPLSRRKCLKSKRCPGWFVDGADSSVCTDNCLAVDQGSIRGNLTCRIGSQRVEDKLCDSSEKPDMTCPNSVCQVKWNVSAWSQCSRSCGGVGVRARQLICVWSHNGSPAGPLCYANQIPVPEVIEQCEAPPCQLECVDFSKHCPKRVELCKFTLYRYQCCASCRDF 598          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A564ZBH0 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14329 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 2.660e-121
Identity = 202/563 (35.88%), Postives = 303/563 (53.82%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLYLVENI-PFEYCSNQLTVIPT--IRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS--EGESV-----DDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNR-TLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKS-QQFRYKFQTFDRLR---ISKNGRMVITKFSKHDEGEWICKAG--SVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLN 1881
            ++W  CS  CG+G QQK+  C +   Y    + P  YC      +P+  +R+CN+GDC     W   +W+ CSH CGN G  TREVEC+ S  EGE V     ++ FC+  +KPE+   C R+NCP +F    W+ C   + C++G+Q R + C SL+ NG  V+LP  ACY      P+  R C+  +   + + NL +  + +  +VQM  ++R+ +Q+GQ ++I+ GTRLS+KC +  FP  N++W HK    F Y     +      +SK+G +VI  F+  DEGEW C+AG       ++L      +G  DWE RN +  S++ N    + +  + + +WV G WS CS+ C   G Q R V CE L    Y+ L+DEEC +    KP ++R C     CP W++ N D ++C+++CIG+GR      + C+          C+   KP + C N  C+ KW +S W+QCS +CG  G + R   CVW  +  PAG  C    ++ P  +K C PP C  +CID+   C K + +C    F + CCKTCR +  +LN
Sbjct:   35 DLWERCSPHCGAGIQQKVFACVENDKYNCSRVKPGRYCGPLPVEMPSDAVRQCNWGDCQRKTWWRASNWSDCSHPCGNLGFATREVECVMSGDEGEIVINQKYENGFCDLNKKPESRGPCNRFNCPGEFQPLEWQKCEQKNPCNTGVQRRQLSCRSLMANGDYVELPKVACYNHFKPPPSEWRRCYVPEISAQCTRNLPVIDEMKMVVVQMRAVRRMRLQVGQEAYILPGTRLSIKCPVTFFPSSNLVWHHKKIGNFTYTGHPGNDPVSHFVSKSGNLVIRHFTSPDEGEWRCQAGQDGPQASIKLHYNLPSQGLADWEARNPKRNSEMQNEDPAVVMTRQKLVQWVEGPWSNCSVPCGGQGIQTRVVRCELLDTGVYHVLDDEECKRQFLVKPKTQRVCINLPKCPNWKLRNADYARCTDNCIGVGRGTYWGEMTCMLGGVAIPEHHCEQMTKPDISCDNPRCQAKWVVSNWSQCSVTCGGTGFRYREQKCVWVHSNKPAGSACYDAKIEAPPAVKQCQPPPCRTQCIDLSDQCPKYRHWCSFHTFKFNCCKTCRDYALELN 597          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A0R3S9E2 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS861 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 4.763e-121
Identity = 202/563 (35.88%), Postives = 303/563 (53.82%), Query Frame = 1
Query:  244 NVWSSCSDTCGSGYQQKLRVCFQTTLYLVENI-PFEYCSNQLTVIPT--IRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS--EGESV-----DDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNR-TLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKS-QQFRYKFQTFDRLR---ISKNGRMVITKFSKHDEGEWICKAG--SVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLN 1881
            ++W  CS  CG+G QQK+  C +   Y    + P  YC      +P+  +R+CN+GDC     W   +W+ CSH CGN G  TREVEC+ S  EGE V     ++ FC+  +KPE+   C R+NCP +F    W+ C   + C++G+Q R + C SL+ NG  V+LP  ACY      P+  R C+  +   + + NL +  + +  +VQM  ++R+ +Q+GQ ++I+ GTRLS+KC +  FP  N++W HK    F Y     +      +SK+G +VI  F+  DEGEW C+AG       ++L      +G  DWE RN +  S++ N    + +  + + +WV G WS CS+ C   G Q R V CE L    Y+ L+DEEC +    KP ++R C     CP W++ N D ++C+++CIG+GR      + C+          C+   KP + C N  C+ KW +S W+QCS +CG  G + R   CVW  +  PAG  C    ++ P  +K C PP C  +CID+   C K + +C    F + CCKTCR +  +LN
Sbjct:   30 DLWERCSPHCGAGIQQKVFACVENDKYNCSRVKPGRYCGPLPVEMPSDAVRQCNWGDCQRKTWWRASNWSDCSHPCGNLGFATREVECVMSGDEGEIVINQKYENGFCDLNKKPESRGPCNRFNCPGEFQPLEWQKCEQKNPCNTGVQRRQLSCRSLMANGDYVELPKVACYNHFKPPPSEWRRCYVPEISAQCTRNLPVIDEMKMVVVQMRAVRRMRLQVGQEAYILPGTRLSIKCPVTFFPSSNLVWHHKKIGNFTYTGHPGNDPVSHFVSKSGNLVIRHFTSPDEGEWRCQAGQDGPQASIKLHYNLPSQGLADWEARNPKRNSEMQNEDPAVVMTRQKLVQWVEGPWSNCSVPCGGQGIQTRVVRCELLDTGVYHVLDDEECKRQFLVKPKTQRVCINLPKCPNWKLRNADYARCTDNCIGVGRGTYWGEMTCMLGGVAIPEHHCEQMTKPDISCDNPRCQAKWVVSNWSQCSVTCGGTGFRYREQKCVWVHSNKPAGSACYDAKIEAPPAVKQCQPPPCRTQCIDLSDQCPKYRHWCSFHTFKFNCCKTCRDYALELN 592          
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Match: A0A183JCE1 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS349 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 7.747e-121
Identity = 205/569 (36.03%), Postives = 304/569 (53.43%), Query Frame = 1
Query:  217 IRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLY----LVENIPFEYCSN--QLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS--EGESVDDKF-----CEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKG-LITPTNKRSCH--SRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQ-FRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQ 1872
            +  PF      WSSCS  CG G + +  +C Q   Y    L++    E+  N          R C  G C  G+ W   +W  CS +CG  GI +R+V+C+ S  +G+ V   F     C  +R+PE   +C R+ C P+F+   W  C+    C  G Q R + C+S+  NG++ +LP  ACY  G  I PT +R     SRKC    S    I  D  T+VQM  +K +D+++GQ + +I  TR++++C ++ F  + + W + +     Y     DR+R+ K GR+ I  F   DEG+W C AGS++  + L +RT   G+ DW  RN      + +   K   I  +I +WV G WS CS SC  TG QFR V CEK+   FY  L D+ C+  L  KP S R+C     CP W + N D S C++ C+ +G+  ++ N+ C+  ++    K CD   KP MEC N  C+++W +S W+QCSRSCG  G+QAR+L+C W   G  AG +C    L +P V++SC  P C L C+D+ K C K+ + C   I+ Y+CC++C+ + Q
Sbjct:   19 VTPPFWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKGYRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEESSRKC---DSKPPMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSCGQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCGGVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVELCKFTIYRYQCCQSCQRYVQ 584          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: adamtsl3 (ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028701])

HSP 1 Score: 95.9005 bits (237), Expect = 5.039e-20
Identity = 86/305 (28.20%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTT-LYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNCKRYNC-PPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN---LEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            P   + + WS CS++CG G Q +   C ++    L E++    C    +  P ++ CN   C     W    W +CSH+C   G Q R+V C           + D+ C+   KP   R C    C  P      W  C     C  GIQ R   C  L  +G +V L   AC   GL  P   RSC    C   K +     ++    R  +Q    KRL   +G  ++++  T + +KC ++ FPK  I W    Q      Q    L I+K+G + +      D GE+ C A   S    LK
Sbjct:  705 PARWDFSEWSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSECKG--SRPPELQACNQHHCPP--AWEAEEWQQCSHACVR-GTQWRKVYCRQRLAGGSFRKLPDEECDGV-KPATQRPCTDPLCLQPHLDGGEWSKC--SVTCGKGIQRREPVCRRLSVSGQLVTLDRSAC--NGLQPPPLIRSCRMTPCNKHKYSKKRCPQVLGLKRIYIQTRQEKRLSFTIGGRAYLLPKTSVVIKCPVRHFPKAQIRWEKDGQD----LQNSKHLSITKSGALRLYSLETRDIGEYRCWANQASDIFILK 995          

HSP 2 Score: 67.0106 bits (162), Expect = 4.660e-11
Identity = 61/201 (30.35%), Postives = 87/201 (43.28%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQ---KLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTN------------------GFVWNTGHWTRCSHSCGNFGIQTREVECLDS-EGESVDDKFCEKFRKPEAS-RNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            WSSCS +CG G Q+   K RV    T   V ++P E C  +  V+   R C+ G C+                   GF+W    +T CS SC   G Q   V C+ +   E V+D FC++ R+P A  R C    CP ++  S W  C     C  G+Q R + CV  + +     +    C  KG   P   ++C+   C
Sbjct:  573 WSSCSVSCGVGLQKRWVKCRVLLSFTQAEV-DLPEEECEGEKPVL--QRTCSMGPCSGPGGSLQWPVEVPANPTQLGFLWEYRGFTACSVSCA-VGRQVAVVRCVRAGRQEVVEDFFCDELRRPPAMVRICNPQPCPARWDFSEWSQC--SESCGVGLQTRRVRCVRSVGSNLTESVELSEC--KG-SRPPELQACNQHHC 764          

HSP 3 Score: 56.225 bits (134), Expect = 1.077e-7
Identity = 46/162 (28.40%), Postives = 73/162 (45.06%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSN---QLTVIPTIRKCNYGDC--TNGFV-------------WNTGHWTRCSHSCGNFGIQTREVECL--DSEGE--SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            CS TCG GYQ     C +  +   + +P  +C +        P +++CN   C  ++GF              W    WT CS SCG  G Q R V C+  D +G+   V++  C    +P   + C  ++C PK+++  W  C     C  G++YR + C+
Sbjct:  351 CSVTCGGGYQLNSADCVE--IRYNKTVPDHHCHSYPENNKPKPKLKECNMDPCLESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQPCNTFDC-PKWVAMEWSQCT--VTCGRGLRYRVVLCI 506          

HSP 4 Score: 55.8398 bits (133), Expect = 1.391e-7
Identity = 55/180 (30.56%), Postives = 78/180 (43.33%), Query Frame = 1
Query: 1207 IMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKL--YDHFYYRLEDEECLKHLEEKPTSKRQCSV-----PFGCPKWEISNV-------------DLSQCSNHCIGIGRAIMNTNVRCI--FRDQPTDLKRCD-IKAKPMME--CANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            +  +   ++ G WS CS+SC   G Q R V C  L  +      L +EEC     EKP  +R CS+     P G  +W +                  + CS  C  +GR +    VRC+   R +  +   CD ++  P M   C    C  +W  S W+QCS SCG  G+Q R + CV
Sbjct:  561 VATEDPTFIPGPWSSCSVSC-GVGLQKRWVKCRVLLSFTQAEVDLPEEECEG---EKPVLQRTCSMGPCSGPGGSLQWPVEVPANPTQLGFLWEYRGFTACSVSC-AVGRQV--AVVRCVRAGRQEVVEDFFCDELRRPPAMVRICNPQPCPARWDFSEWSQCSESCGV-GLQTRRVRCV 732          

HSP 5 Score: 55.4546 bits (132), Expect = 1.766e-7
Identity = 60/218 (27.52%), Postives = 81/218 (37.16%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVC----FQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            E N W+SCS +CG G QQ+  VC     Q  +  VE     +    +T  P    CN  DC     W    W++C+ +CG  G++ R V C+D  G+      C    KP    +C         R + P                       P FI   W  C     C  G+Q R + C  LL      V LP E C  +    P  +R+C    C
Sbjct:  423 EQNPWTSCSVSCGGGSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQP----CNTFDCPK---WVAMEWSQCTVTCGR-GLRYRVVLCIDHNGQHTGG--CSSSLKPHIKEDCLVPIACHKPRESVPVEAKLPWLKQAQELEETKVATEDPTFIPGPWSSC--SVSCGVGLQKRWVKCRVLLSFTQAEVDLPEEECEGE---KPVLQRTCSMGPC 625          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000039281.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:25842872:25855936:-1 gene:ENSAMXG00000032437.1 transcript:ENSAMXT00000039281.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 2.555e-19
Identity = 84/331 (25.38%), Postives = 141/331 (42.60%), Query Frame = 1
Query:  904 RLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAG------SVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-CDIKAKPMME--CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC-LLKCIDVYKICEKKKK--YCHIEIFYYRCCKTCR 1860
            R+ LKC  +  P+  +IW    ++   +     R+ +  +G ++I    + D G + CKA       S+S ++Q+       G  +    +      LP              RW    WS CS  C   G Q RSV C  +        E  E       +P   R C++   C  W I+      C+  C+G   A+ + +V C  ++      R C  + +P     C    C + W++ PWTQC+ +CG +G Q+R+++CV + +G PA ++      + P   + C    C   +C D  + CEK ++   C +  F  RCC++CR
Sbjct:  321 RVELKCQAQGNPQPVVIW----KKDGVELTNSSRVGLMPDGSLLIEAPQETDSGLYTCKATNHLGFTSLSSQVQITESGCVNGADENNTSSCTDSLQLPYSCHGQHCRH----RWQVSSWSSCSADC-GGGLQTRSVTCLGV-------AEGAETCMGAGRRPVDSRACNIQ-PCVAW-ITRA-WGPCNGQCVGPQLALQHRHVFCQDKNSTRLQHRMCSSQPRPTSHRNCTTEACALHWRVGPWTQCTATCGRHGFQSRHVMCVHRRSGKPARELHCAWRPR-PASWQRCNILSCGRGECRDSTRYCEKVRQLELCPLPQFKARCCRSCR 631          

HSP 2 Score: 52.373 bits (124), Expect = 1.120e-6
Identity = 50/199 (25.13%), Postives = 70/199 (35.18%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKL-----PFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEI 813
            +++ WSSCS  CG G Q +   C    L + E    E C          R CN   C     W T  W  C+  C      +Q R V C D     +  + C    +P + RNC    C   +    W  C +      G Q R + CV         +L     P  A +++  I    +  C       EK   LE+
Sbjct:  428 QVSSWSSCSADCGGGLQTRSVTC----LGVAEGA--ETCMGAGRRPVDSRACNIQPC---VAWITRAWGPCNGQCVGPQLALQHRHVFCQDKNSTRLQHRMCSSQPRPTSHRNCTTEACALHWRVGPWTQCTATCG-RHGFQSRHVMCVHRRSGKPARELHCAWRPRPASWQRCNILSCGRGECRDSTRYCEKVRQLEL 616          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: adamts9 (ADAM metallopeptidase with thrombospondin type 1 motif, 9 [Source:ZFIN;Acc:ZDB-GENE-070814-6])

HSP 1 Score: 78.9518 bits (193), Expect = 1.150e-14
Identity = 116/507 (22.88%), Postives = 196/507 (38.66%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL-DSEGESVDDKFCEKFRKPEASRNCKRYNCP------------------PKFISSAWEPCVSDSKCDSGIQYRSIHC----VSLLDNGTVVKLPFEACYEKGLITPTNK------RSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDE---GEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRD-QPTDLKRCDIKAKPMMECANLGCRV-KWKISPWTQCSRSCGENGIQARYLIC 1668
            WS C  TCG GY+ +   C     +  + +   +C +  +   +++ C   +C +   W  G W +C+ SCG  G Q R V+C+  S G  +DD  C    +P  +++C+   CP                   ++   +W  C   + C  G + R + C      + ++ +   LP     E   +    +        C S  C   K+T   + ++     Q++ M   D      +          +C++ + P R+      S    +   +  R R   +GR    +  +  +   G W   + + +G  Q   R +     +    N   +S  PN   + S       +WV G W +CS  C   G + R V C++     +  L  E  +K  +++  + + CS     P W  S    S CS  C   GR     NV C+ R  +P   + C   ++P  +    G R  KWK S W +CS SCG  G Q R + C
Sbjct: 1021 WSECLVTCGKGYKHRQTWC----QFGEDRLDDRFCDS--SKPESVQACQQQECAS---WQVGPWGQCTTSCGP-GYQLRAVKCVVGSYGAVMDDTECNAATRPTHTQDCEISQCPITHPVSPETKMVPHPGHKTQWRYGSWTQC--SATCGKGTRMRYVSCRDNQGGVAEDSSCAHLPKPPAREVCSVGACGQWKALEWSQC-SVSCGQGKATRQVLCVNFSDQDQVVDMSECDPDDRPATE--------QECNMAQCPSRS------SDHGGFPPNSDARKRTPSSGRADRIRGGRSHQWRTGPWGACSSTCAGGFQ--RRVVVCQDENGYPANSCDESMQPN--EQRSCESGPCPQWVYGNWGECSKPC-GGGIKTRLVACQRPNGERFNDLSCEIFVKPSDQEQCNTQSCSAN---PHW--STDPWSSCSASC---GRGYRYRNVTCVGRSGRPIAEENCRHVSRPQKQRRCRGGRCPKWKTSAWGECSASCGA-GEQRREVFC 1486          

HSP 2 Score: 73.1738 bits (178), Expect = 5.862e-13
Identity = 118/508 (23.23%), Postives = 182/508 (35.83%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCT----------------NGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCS---IKKFPKRNIIWIHKSQQFRYKFQTFD------RLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQ-PTDLKRCDIKAKP--MMECANLGC--RVKWKISPWTQCSRSCGENGIQARYLICV 1671
            ++  W  C+ +CG GYQ +   C   +   V +   +   N  T     + C    C                 +   W  G WT+CS +CG  G + R V C D++G   +D  C    KP A   C    C  ++ +  W  C     C  G   R + CV+  D   VV +    C       P  ++ C+  +C    S +     ++    +     R D   G  SH  + T     CS      F +R ++      +  Y   + D        R  ++G      +    E    C  G +  +L    R   E + D         SD     T+          W    WS CS SC   G+++R+V C         R   EE  +H+  +P  +R+C     CPKW+ S     +CS  C   G       V C   DQ       C    +P     C+   C  R +W  + W  CS++CG  G + R ++C+
Sbjct: 1071 QVGPWGQCTTSCGPGYQLRAVKCVVGSYGAVMD---DTECNAATRPTHTQDCEISQCPITHPVSPETKMVPHPGHKTQWRYGSWTQCSATCGK-GTRMRYVSCRDNQGGVAEDSSCAHLPKPPAREVCSVGAC-GQWKALEWSQC--SVSCGQGKATRQVLCVNFSDQDQVVDM--SECDPDDR--PATEQECNMAQCPSRSSDHGGFPPNSDARKRTPSSGRADRIRGGRSH-QWRTGPWGACSSTCAGGFQRRVVVC---QDENGYPANSCDESMQPNEQRSCESGPCPQWVYGNWGECSKPC-GGGIKTRLVACQRPNGERFNDLSCEIFVKPSDQEQCNTQSCSAN---PHWSTDPWSSCSASC-GRGYRYRNVTCVGRSG----RPIAEENCRHV-SRPQKQRRCRGGR-CPKWKTSA--WGECSASC---GAGEQRREVFCQIGDQRRVPDSECSHLPRPPSTQTCSREECPARYRWSQTEWQTCSKTCGSGG-RHRTVVCL 1546          

HSP 3 Score: 72.7886 bits (177), Expect = 8.765e-13
Identity = 52/168 (30.95%), Postives = 70/168 (41.67%), Query Frame = 1
Query:  190 TKAQFEEKEIRKPFIHE--INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCP--PKFISSAWEPCVSDSKCDSGIQYRSIHCVS 681
            T +      IR    H+     W +CS TC  G+Q+++ VC     Y     P   C   +      R C  G C     W  G+W  CS  CG  GI+TR V C    GE  +D  CE F KP     C   +C   P + +  W  C   + C  G +YR++ CV 
Sbjct: 1277 TPSSGRADRIRGGRSHQWRTGPWGACSSTCAGGFQRRVVVCQDENGY-----PANSCDESMQPNEQ-RSCESGPCPQ---WVYGNWGECSKPCGG-GIKTRLVACQRPNGERFNDLSCEIFVKPSDQEQCNTQSCSANPHWSTDPWSSC--SASCGRGYRYRNVTCVG 1432          

HSP 4 Score: 62.3882 bits (150), Expect = 1.560e-9
Identity = 42/125 (33.60%), Postives = 59/125 (47.20%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP-----TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNC 588
            FI     W+ CS TCG GY+++L  C +     VEN  +EY     +  P     +   CN   C +G  W  G W  CS SCG  G   R V+C+ ++GE  D+  C    +PE  + C   +C
Sbjct: 1577 FIWITGDWTECSVTCGQGYRRRLVSCSEVHA-GVEN--YEYGHQASSNCPGTPPESYMACNLPSCPSGHTWRVGIWGPCSVSCGE-GWMERSVQCVSADGELSDE--CPSTSRPEGRKPCSNPSC 1695          

HSP 5 Score: 58.5362 bits (140), Expect = 1.947e-8
Identity = 39/149 (26.17%), Postives = 66/149 (44.30%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSL 684
            + + W  CS +CG+G Q++   C    +     +P   CS+ L   P+ + C+  +C   + W+   W  CS +CG+ G + R V CLD     V + +C    +P  +  C    C   +I+  W  C     C  G + R + C  +
Sbjct: 1464 KTSAWGECSASCGAGEQRREVFC---QIGDQRRVPDSECSH-LPRPPSTQTCSREECPARYRWSQTEWQTCSKTCGSGG-RHRTVVCLDHNEHEVHEMYCSDQGRPGDNEPCNTQPCEFIWITGDWTEC--SVTCGQGYRRRLVSCSEV 1605          

HSP 6 Score: 56.6102 bits (135), Expect = 8.581e-8
Identity = 51/200 (25.50%), Postives = 85/200 (42.50%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHC------------IGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMME--------CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            +W  G+WS+C ++C   G++ R  +C+   D    RL+D  C      KP S + C     C  W++      QC+  C            +G   A+M+ +  C    +PT  + C+I   P+            + G + +W+   WTQCS +CG+ G + RY+ C     G+     C   +L  P   + C+   C
Sbjct: 1015 QWKTGEWSECLVTC-GKGYKHRQTWCQFGED----RLDDRFCDS---SKPESVQACQQQE-CASWQVG--PWGQCTTSCGPGYQLRAVKCVVGSYGAVMD-DTECNAATRPTHTQDCEISQCPITHPVSPETKMVPHPGHKTQWRYGSWTQCSATCGK-GTRMRYVSCRDNQGGVAEDSSC--AHLPKPPAREVCSVGAC 1199          

HSP 7 Score: 51.2174 bits (121), Expect = 3.342e-6
Identity = 51/187 (27.27%), Postives = 78/187 (41.71%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCI-FRDQPTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKC 1776
            +W    W +CS SC   G Q R V+C+ + D    R+ D EC  HL  +P S + CS      ++  S  +   CS  C   GR   +  V C+   +       C  + +P     C    C   W    WT+CS +CG+ G + R + C     G+   +  +Q +   P      TPP+  + C
Sbjct: 1462 KWKTSAWGECSASC-GAGEQRREVFCQ-IGDQ--RRVPDSEC-SHLP-RPPSTQTCSREECPARYRWSQTEWQTCSKTCGSGGR---HRTVVCLDHNEHEVHEMYCSDQGRPGDNEPCNTQPCEFIWITGDWTECSVTCGQ-GYRRRLVSCSEVHAGVENYEYGHQASSNCPG-----TPPESYMAC 1633          

HSP 8 Score: 50.0618 bits (118), Expect = 7.896e-6
Identity = 45/170 (26.47%), Postives = 70/170 (41.18%), Query Frame = 1
Query: 1210 MKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCS----------------VPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
             ++ A W  G W +C+ SC   G+Q R+V C  +   +   ++D EC  +   +PT  + C                 VP    K +      +QCS  C G G  +   + R        D     +   P  E  ++G   +WK   W+QCS SCG+ G   R ++CV
Sbjct: 1064 QQECASWQVGPWGQCTTSC-GPGYQLRAVKC--VVGSYGAVMDDTEC--NAATRPTHTQDCEISQCPITHPVSPETKMVPHPGHKTQWRYGSWTQCSATC-GKGTRMRYVSCRDNQGGVAEDSSCAHLPKPPAREVCSVGACGQWKALEWSQCSVSCGQ-GKATRQVLCV 1226          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: si:ch211-267e7.3 (ADAMTS-like protein 2 [Source:NCBI gene;Acc:103033610])

HSP 1 Score: 77.411 bits (189), Expect = 2.318e-14
Identity = 52/151 (34.44%), Postives = 75/151 (49.67%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            RW   +WS+CS +C   G QFR+V C K+    F   + D+ C     +KP +++ C      P+WE+S  D S+CS  C G  R + +  VRC       D + C+   +P    EC    C  +W +S W  CS  CGE G   RY++C
Sbjct:  641 RWETSRWSECSRTC-GEGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSCGPQWEVS--DWSECSARCGG--RGVRSREVRCSM-----DTRLCNESTRPPSQRECEGPPCDRRWTVSDWGPCSGLCGE-GRMTRYVVC 780          

HSP 2 Score: 69.707 bits (169), Expect = 7.320e-12
Identity = 63/240 (26.25%), Postives = 92/240 (38.33%), Query Frame = 1
Query:  100 ECLLICERFIQKMRFLQWVV----FIHSIFTILLTKAQFEEKEIRKPFIH-------EINVWSSCSDTCGS-GYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            EC   C    Q      W +    F  S++  L   A+ ++   RK           E++ WS CS  CG  G + +   C   T             N+ T  P+ R+C    C     W    W  CS  CG  G  TR V C    G+ + D  C+   KP A   C   +CP  ++   WE C  ++ C  G++ R + C   L+ G   + P   C   G++ P    +C  R C
Sbjct:  649 ECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSCGPQWEVSDWSECSARCGGRGVRSREVRCSMDTRLC----------NESTRPPSQRECEGPPCDR--RWTVSDWGPCSGLCGE-GRMTRYVVCKSGNGKVISDGQCDPDLKPLAVHPCGDRDCPAHWVEQEWEQC--NATCGRGVKTRQVVCAG-LEAGVFKEYPEHTC--AGVLQPEQSTACFERPC 870          

HSP 3 Score: 67.3958 bits (163), Expect = 3.291e-11
Identity = 48/158 (30.38%), Postives = 71/158 (44.94%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFE-YCSNQLTVIPTIRK-CNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVV 705
            E + WS CS TCG G+Q +   C++      ++  ++  C       P  RK C    C  G  W    W+ CS  CG  G+++REV C      S+D + C +  +P + R C+   C  ++  S W PC     C  G   R + C S   NG V+
Sbjct:  643 ETSRWSECSRTCGEGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSC--GPQWEVSDWSECSARCGGRGVRSREVRC------SMDTRLCNESTRPPSQRECEGPPCDRRWTVSDWGPC--SGLCGEGRMTRYVVCKS--GNGKVI 788          

HSP 4 Score: 65.4698 bits (158), Expect = 1.288e-10
Identity = 40/157 (25.48%), Postives = 71/157 (45.22%), Query Frame = 1
Query:  319 LYLVENIPFEYC-SNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRN-CKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            L+ VE +   +  SN+  V+      +  D    + W    +  CS +C   GI T    C+  +G  VD+ +C+   +PE +   C    CPP++ +S W  C     C  G Q+R++ C  ++  G    +  + C+   L  P  +++C S+ C
Sbjct:  551 LHQVEPVQVPHSESNEFDVVSLDHDVSLADM---YRWKVSAYAPCSSTC-TTGISTSYALCVRYDGSEVDESYCDALTRPEPTHEFCTGKECPPRWETSRWSEC--SRTCGEGFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSC 701          

HSP 5 Score: 56.6102 bits (135), Expect = 8.044e-8
Identity = 44/153 (28.76%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC--LDSEG--ESVDDKFCE--KFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHC 675
            +++ ++ CS TC +G      +C +   Y    +   YC       PT   C   +C     W T  W+ CS +CG  G Q R V C  + + G   SV D  C   + +KP A + CK  +C P++  S W  C   ++C   G++ R + C
Sbjct:  585 KVSAYAPCSSTCTTGISTSYALCVR---YDGSEVDESYCDALTRPEPTHEFCTGKECPP--RWETSRWSECSRTCGE-GFQFRTVRCWKMMAPGFDSSVYDDLCHAAELQKPMARKACKSKSCGPQWEVSDWSEC--SARCGGRGVRSREVRC 729          

HSP 6 Score: 50.447 bits (119), Expect = 6.647e-6
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCP 591
            W  C+ TCG G + +  VC      + +  P   C+  L    +   C    C+    W T  W++CS +CG+ G++ REV+C   +GE +    C+   KP+A ++C+   CP
Sbjct:  819 WEQCNATCGRGVKTRQVVCAGLEAGVFKEYPEHTCAGVLQPEQST-ACFERPCSK---WFTTAWSQCSKTCGS-GVRVREVKCY--QGEEIGHS-CDSVLKPQARQSCEVQACP 924          

HSP 7 Score: 50.0618 bits (118), Expect = 7.622e-6
Identity = 59/231 (25.54%), Postives = 90/231 (38.96%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC------IFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEI-------FYYR--CCKTCRLFFQ 1872
            RW    W  CS  C   G   R V C+          + +  LK L   P   R C   +   +WE       QC+  C   GR +    V C      +F++ P       ++ +    C    C  KW  + W+QCS++CG +G++ R + C     G   G  C+ + LK PQ  +SC    C  +        +K    C + +       +YYR  CC +C+   Q
Sbjct:  756 RWTVSDWGPCSGLC-GEGRMTRYVVCKSGNGKVISDGQCDPDLKPLAVHPCGDRDCPAHWVEQEWE-------QCNATC---GRGVKTRQVVCAGLEAGVFKEYPEHTCAGVLQPEQSTACFERPCS-KWFTTAWSQCSKTCG-SGVRVREVKCY---QGEEIGHSCDSV-LK-PQARQSCEVQACPTEAPAEDACQDKATANCALVLRVKLCTHWYYRKACCLSCKTKGQ 968          
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Match: ENSAMXT00000052357.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:6127544:6132804:-1 gene:ENSAMXG00000033370.1 transcript:ENSAMXT00000052357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 6.023e-14
Identity = 57/185 (30.81%), Postives = 86/185 (46.49%), Query Frame = 1
Query:  250 WSS-CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL---DSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            WS  CS  CG G + +  VC    +    ++P + C ++      I  CN G CT+   W TG W +CS  CGN G QTR V C+   +S+ E   D  C +F +P  S+ C   +C  ++ ++ W  C     C+ G + R + C  L D+ T       A      +TP  +  C++  CL E
Sbjct:   13 WSDRCSADCGQGSRSRSVVCM---MGQTASLPLDGCEDE-DKPEEITPCNLGACTHRTEWYTGPWGQCSSECGN-GTQTRGVVCVLHSNSQLEVTSDANCSQFSRPPNSQPCLLKSCGAQWYTTDWSSC--SRSCEGGYRVREVQC--LGDDLTHSDGCDPA------LTPAGQEECNTHICLPE 182          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 94.3597 bits (233), Expect = 3.158e-20
Identity = 68/218 (31.19%), Postives = 96/218 (44.04%), Query Frame = 1
Query: 1228 WVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLK-RCDIKAKP--MMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSC--TPPKCLLKCIDVYKICE--KKKKYCHIEIFYYRCCKTCR 1860
            WV G WS CS +C   G + RSV C          L D  C     E+P     C    GCP+W +     ++C+  C+G+G    +  V C   +     +  C  KA+P  +  C+   C V+W+  PW  C+ SCG +G QAR + C    T  PA D       K P   + C  TP     +C D  + CE  +K   C +  +  RCC+ CR
Sbjct: 1570 WVTGPWSDCSEAC-GAGVRVRSVVCRSPAG--ATALPDYSCRG--AERPARAEPCKR-HGCPEWAVGA--WAECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTHGFQARRVECAHVRTARPAPDAHCAWQHK-PATWQRCNITPCATTSECRDSSRYCEMVQKLNLCQLPTYRLRCCQACR 1778          

HSP 2 Score: 70.4774 bits (171), Expect = 1.014e-12
Identity = 68/305 (22.30%), Postives = 119/305 (39.02%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVI--PTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVEC----LDSEGESVDDKFCEKFRKPEASRNC--KRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC-VSLLDNGTVVKLPFEACYEKGLITPTNKRSCH----SRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLK 1113
            E + W +CS +CG+G + +   C +T     +       +   T    P +  C   DC     W+   W  CS +CG+ G+Q+R + C     D     VD++ C   R P A + C   +  CP ++++S W     ++   +  Q+R + C  S     T V     A     L  P   R+C     +RK     +   +I    R  +       L   +G  +++   + + LKC + +F    + W    ++        DR  +++ G + I      D G + C AG       +K
Sbjct:  679 ETSEWGACSASCGAGLRARSVGCARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPP--AWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCPDSR-PLAQQACGGGQSECPAEWVASEWGQI--NTHQGNYTQHRDVSCQFSTAAEATSVA---NASQCSSLPKPLASRACTLPPCNRKGGSSANGGPQILGVRRIYIPSPWENLLAFPVGGTAYLFPKSMVVLKCPVARFQHSRVRW----EKDGRSLAESDRHSVTRWGCLKIRCLQPDDIGVYTCVAGQARESFTIK 971          

HSP 3 Score: 62.3882 bits (150), Expect = 3.186e-10
Identity = 57/209 (27.27%), Postives = 85/209 (40.67%), Query Frame = 1
Query:  139 RFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEI-NVWSS-----CSDTCGSGYQQKLRVCFQTTLYLVENIPF-EYCSNQLTVIPTIRKCNYGDC--TNGFV----------------WNTGHWTRCSHSCGNFGIQTREVECL--DSEG--ESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCV 678
            R L     I + FTI        E  +   F   I + W       CS +CG GYQ     C       + +  F  Y        P +R+C+   C  ++GF                 W    WT CS SCG  G+Q+R V C+  D +G  E V++  C    +P  ++ C  Y+C PK+++  W  C     C  G++YR + C+
Sbjct:  265 RVLHITGPIQADFTIKARHVSSAETVVLFLFYQPIPHQWRETDFFPCSSSCGGGYQLTSAECVDMRNARIASDHFCNYYPENKKPKPRLRECSMEPCPSSDGFKQIMSYDHYQPLPRPCRWEGSPWTACSSSCGG-GVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQPCNLYDC-PKWMAQEWSSCT--VTCGRGLKYRVVLCI 469          

HSP 4 Score: 55.8398 bits (133), Expect = 2.687e-8
Identity = 99/442 (22.40%), Postives = 154/442 (34.84%), Query Frame = 1
Query:  211 KEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCF----QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC--------KRYNCP-----------------------PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLD-NGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQML----PMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGR--MVITKFSKHDEGEWICKAGSVSGKLQLKS----RTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKD-IARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCS 1395
            + + +P   E + W++CS +CG G Q +   C     Q  L  VE     Y        P    CN  DC     W    W+ C+ +CG  G++ R V C+D  G+      C    KP     C         R   P                         F   AW PC     C  G++ R++ C  LL  + +VV+LP   C  +    P ++R C    C+ E +  L    + + L +           D + G  SH       S+ C+        I    ++ +   +       R  +  R    +   S+ +  EW   + S    L+ +S    RT+       E R        P           D    W A  W  CS +C S+G Q RS+ C +L      R  DE+     + +P +++ C 
Sbjct:  377 QPLPRPCRWEGSPWTACSSSCGGGVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQP----CNLYDCPK---WMAQEWSSCTVTCGR-GLKYRVVLCIDHRGQHTGG--CNTKIKPHVKEECLVTTPCYKPREKLPVEAKVPWFKQAQELIEGPAVSEEAAFAPDAWSPC--SRSCGPGVRTRAVRCRVLLPFSRSVVELPDGECEGE---RPASERPCALGPCV-EAADGLLTDEEAQALEERGQGGDEALAFDWEYGGFSHC------SVSCAGGNREAIVICVNKETGEAEDESLCDADARPPQIQRPCHTLPCPSRWETSEWGACSASCGAGLRARSVGCARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPPAWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCP--DSRPLAQQACG 794          

HSP 5 Score: 55.0694 bits (131), Expect = 4.597e-8
Identity = 53/195 (27.18%), Postives = 83/195 (42.56%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRV--CFQTTLYLVENIPFEYCSN-QLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS---GIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTN 804
            +N  +SC  +CG+   +      C +  + +V +    +CS      +PT   C    C     W TG W+ CS +CG  G++ R V C    G  ++ D  C    +P  +  CKR+ C P++   AW  C    +C     G Q+R + C   L NGT    P   C  K    P + ++C    C ++  T 
Sbjct: 1511 VNDTASCPASCGNASARGAPAPRCVRDNVTVVSDA---FCSLLPRPQLPTNSPCPAVGCQP--WWVTGPWSDCSEACG-AGVRVRSVVCRSPAGATALPDYSCRGAERPARAEPCKRHGC-PEWAVGAWAECT--GRCVGLGIGTQHRRVLC--FLHNGTAA--PEGDCASKA--RPGSVQNCSVEACAVQWRTG 1690          

HSP 6 Score: 51.9878 bits (123), Expect = 4.585e-7
Identity = 47/154 (30.52%), Postives = 64/154 (41.56%), Query Frame = 1
Query: 1228 WVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCP-KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-----CDIKAKPMME-CANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            W  G +S CS+SC + G++   V C    +      EDE         P  +R C     CP +WE S  +   CS  C    RA      R + R+     +R     C     P +E CA   C   W    W  CSR+CG +G+Q+R L C
Sbjct:  619 WEYGGFSHCSVSC-AGGNREAIVIC---VNKETGEAEDESLCDADARPPQIQRPCHT-LPCPSRWETS--EWGACSASCGAGLRARSVGCARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPPAWHARDWQPCSRTCGSSGVQSRSLRC 765          

HSP 7 Score: 48.1358 bits (113), Expect = 6.931e-6
Identity = 37/147 (25.17%), Postives = 55/147 (37.41%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQT--REVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSL 684
            WS CS+ CG+G + +  VC          +P +Y             C    C     W  G W  C+  C   GI T  R V C    G +  +  C    +P + +NC    C  ++ +  W  C + S    G Q R + C  +
Sbjct: 1575 WSDCSEACGAGVRVRSVVCRSPAGATA--LP-DYSCRGAERPARAEPCKRHGCPE---WAVGAWAECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTA-SCGTHGFQARRVECAHV 1714          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009057.1 (pep scaffold:Pmarinus_7.0:GL480935:1501:23785:-1 gene:ENSPMAG00000008191.1 transcript:ENSPMAT00000009057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.190e-19
Identity = 111/460 (24.13%), Postives = 177/460 (38.48%), Query Frame = 1
Query:  241 INVWSSCSDTCG-SGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYN---CPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLY----DHFYYRLEDEECLKHLEE---KPTSKRQCSVPFGCP-------KWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRD-QPTDLKRCDIKAKPMM 1563
              +W  CS TC   G Q++L VC        +  P + C +Q +  P +R C         +WN G W+ CS SCG  G++TR V C   EG+ + +  C+   +P A+  C        P  +  S+W PC   + C  G QYR + C++    G  + L         L  P  +R C + +C   ++++      N T  +++  +     LG   H            ++   +R       ++  +     F R+R+  +        ++H     +C  G   GK  ++        R             P    + S    D   WV G WS CS SC   G+Q R V+C + +    +HF Y  E      H      +P   R+CS P   P       +W       SQCS  C   G       VRC+  + +P+D   C  +++P  
Sbjct:  195 TGLWGPCSQTCDDGGVQRRLVVCQDP-----DGEPGDRC-DQNSRPPEMRPCQQQQLC--ALWNFGTWSACSRSCGGSGVRTRLVLCQSPEGQPLPETRCDAATRPPAADACPDEGPCVSPGVWHRSSWSPC--STTCGRGTQYREVRCLADGGRGDALLLLLPPADCGHLEKPRQQRRCRAGRCPRWRASSW--GQCNHTSSRLVWQQHGTCVLG---HHTSARHTREGPCLRPASERCCC---AARGTKLPIHVFRRVRLQCSRTCGEGVRARHV----VCAEG---GKAPVRDELCRADAR-------------PPAHERCSSAGCDFI-WVTGDWSACSASC-GPGYQQRLVFCSETHGSTGEHFPYGYEARPSCPHPRPPGTRPCDIRECSSPAPMPPQAALPVRWRTGA--WSQCSVSC---GDGWAERPVRCLTGEGRPSDA--CPQESRPTT 607          

HSP 2 Score: 65.4698 bits (158), Expect = 1.857e-11
Identity = 43/128 (33.59%), Postives = 59/128 (46.09%), Query Frame = 1
Query:  229 FIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEY---CSNQLTVIPTIRKCNYGDCTNGFV----------WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNC 573
            FI     WS+CS +CG GYQQ+L  C +T     E+ P+ Y    S      P  R C+  +C++             W TG W++CS SCG+ G   R V CL  EG   D   C +  +P   + C
Sbjct:  487 FIWVTGDWSACSASCGPGYQQRLVFCSETHGSTGEHFPYGYEARPSCPHPRPPGTRPCDIRECSSPAPMPPQAALPVRWRTGAWSQCSVSCGD-GWAERPVRCLTGEGRPSD--ACPQESRPTTRQQC 611          

HSP 3 Score: 60.4622 bits (145), Expect = 8.129e-10
Identity = 109/452 (24.12%), Postives = 166/452 (36.73%), Query Frame = 1
Query:  424 WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDD-KFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQ-------QFRYKF-QTFDRL---RISKNGRMVITKFSKHDE-------GEW-----ICKAGSVSGKLQL----KSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYC--EKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQP----TDLKRCDIKAKPMMECANLGCRVKWKI--SPWTQCSRSCGENGIQARYLICV 1671
            W  G WT CS SCG  G++ R V C D++G+  +    C    +P     C    C  ++ +S W PC   + C  G++ R + CV  LD+ T V         +    P ++R C    C  E  +     +    + +  P+       G  S  +     +   +      R  +W   SQ       Q R    Q  D     R  +N R    +  +  +       G W      C    V  +L L    + + L E   D   R     +  P+    +S  +     W    WS CS +C   G Q+R V C  +         L       HL EKP  +R+C     CP+W  S+    QC NH     R +   +  C+         T    C   A     CA  G ++   +      QCSR+CGE G++AR+++C 
Sbjct:   29 WRFGSWTDCSRSCGE-GVRERYVSCRDADGDVAEGAAACAHLPRPHEREACSSGPC-VRWQASTWGPC--SATCGRGVESRHVACVP-LDDPTGVHAVAAVTECQPEERPISERECSPEACPPETRSRSGGDVSGEGVARPRPV----APAGTPSSALPSPPAAADDTDDADRWRTGLWGPCSQTCDDGGVQRRLVVCQDPDGEPGDRCDQNSRPPEMRPCQQQQLCALWNFGTWSACSRSCGGSGVRTRLVLCQSPEGQPLPETRCDAATRPPAADA-CPDEGPCVSPGV-----WHRSSWSPCSTTC-GRGTQYREVRCLADGGRGDALLLLLPPADCGHL-EKPRQQRRCRA-GRCPRWRASS--WGQC-NH--TSSRLVWQQHGTCVLGHHTSARHTREGPCLRPASERCCCAARGTKLPIHVFRRVRLQCSRTCGE-GVRARHVVCA 456          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008623.1 (pep scaffold:Pmarinus_7.0:GL476601:130594:138220:-1 gene:ENSPMAG00000007813.1 transcript:ENSPMAT00000008623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 1.141e-18
Identity = 60/193 (31.09%), Postives = 92/193 (47.67%), Query Frame = 1
Query:  250 WSS-CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGES---VDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIK 816
            WS  CS  CG G Q +  VC    +  V ++P E CS+     P  + CNYG C     W TG W +CS  CGN G Q+R+V C+     S    D   C    +P + + C    C  ++ ++AW  C     C++G + R + C   LD+      P  +C  +  + P+N+  C+++ C+ EK+ N   K
Sbjct:   55 WSERCSADCGEGVQSRSVVCL---MNHVNSLPLEGCSSDQP--PERQACNYGSCETKAEWFTGPWGQCSVGCGN-GTQSRDVICVQRTNGSFSATDRDACAGLAEPASQQPCHLRACGARWYTTAWSAC--SKSCETGFRVREVRC---LDDSIA---PSSSCDAE--LKPSNREDCNTQACIPEKNQNENCK 231          

HSP 2 Score: 50.447 bits (119), Expect = 4.255e-7
Identity = 37/113 (32.74%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  448 CSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAW-EPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            CS  CG  G ++R+V+C+ + G++VDD  C    +P  S NC    C   +  + W E C +D  C  G+Q RS+ C  L+++  V  LP E C       P  +++C+   C
Sbjct:    1 CSVPCG-LGQRSRDVKCVSNLGDAVDDGECNMKLRPTDSENCDMGACAKSWFLTDWSERCSAD--CGEGVQSRSVVC--LMNH--VNSLPLEGCSSD---QPPERQACNYGSC 103          

HSP 3 Score: 46.9802 bits (110), Expect = 5.363e-6
Identity = 51/178 (28.65%), Postives = 77/178 (43.26%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWT-RCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPK--FISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            CS  CG G + +   C      L + +    C+ +L    +   C+ G C     W    W+ RCS  CG  G+Q+R V CL +   S+  + C   + PE  + C   +C  K  + +  W  C     C +G Q R + CV    NG+      +AC   GL  P +++ CH R C
Sbjct:    1 CSVPCGLGQRSRDVKCVSN---LGDAVDDGECNMKLRPTDS-ENCDMGACAKS--WFLTDWSERCSADCGE-GVQSRSVVCLMNHVNSLPLEGCSSDQPPE-RQACNYGSCETKAEWFTGPWGQC--SVGCGNGTQSRDVICVQRT-NGSFSATDRDAC--AGLAEPASQQPCHLRAC 165          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000756.1 (pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 3.251e-14
Identity = 39/121 (32.23%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPE--ASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHS 774
              W  G  + CS SCGN G+Q+  + C+  + E VD   C+   KP   A + C R +CPP +    W  C     C  G++ R + C  L  +G V  LP   C       PT + SC +
Sbjct:  332 LSWTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTC--SRSCGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAA 450          

HSP 2 Score: 68.5514 bits (166), Expect = 2.603e-12
Identity = 56/235 (23.83%), Postives = 88/235 (37.45%), Query Frame = 1
Query: 1228 WVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC------IFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYL--------------ICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCL-LKCIDVYKICE--KKKKYCHIEIFYYRCCKTCR 1860
            W   +W  CS SC   G + R V C+ L  D     L    C      +PT +  C+    CP W    +D  QC+  C+G      +  V C      +  D   D      +      C+   C  +W+   W++C+ +CG +G Q+R L               C W+P                P   + C    C   +C D  + C   K+ K C + ++  RCC++C+
Sbjct:  394 WSVEEWGTCSRSC-GGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHW--VALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLECAGAAADAAGGEHSCAWQPK---------------PITWQRCNIIPCEKGECKDTTRYCHLVKRLKLCQLMMYKLRCCESCK 610          

HSP 3 Score: 48.1358 bits (113), Expect = 5.741e-6
Identity = 40/154 (25.97%), Postives = 63/154 (40.91%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVC-FQTTLYLVENIPFEYCSNQLTVIPTIRK--CNYGDCTNGFVWNTGHWTRCSHSCGNF--GIQTREVECLDSEGESVDDKFCEK---FRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHC 675
            +  W +CS +CG G + +   C   ++   V  +P   C +     PT  +      DC +   W    W +C+  C  +  G + R V C  + G  V D  C+K     +P  S+NC    C  ++    W  C   + C S G Q R + C
Sbjct:  396 VEEWGTCSRSCGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPH---WVALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECT--ATCGSHGFQSRRLEC 544          
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000757.1 (pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 gene:ENSPMAG00000000690.1 transcript:ENSPMAT00000000757.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 4.974e-14
Identity = 39/121 (32.23%), Postives = 55/121 (45.45%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPE--ASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHS 774
              W  G  + CS SCGN G+Q+  + C+  + E VD   C+   KP   A + C R +CPP +    W  C     C  G++ R + C  L  +G V  LP   C       PT + SC +
Sbjct:  510 LSWTPGEPSPCSASCGNTGVQSWRLRCVRDDLEEVDASLCQGLPKPSLAAPQRCNRRDCPPSWSVEEWGTC--SRSCGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAA 628          

HSP 2 Score: 62.7734 bits (151), Expect = 1.677e-10
Identity = 41/154 (26.62%), Postives = 62/154 (40.26%), Query Frame = 1
Query: 1228 WVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRC------IFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLIC 1668
            W   +W  CS SC   G + R V C+ L  D     L    C      +PT +  C+    CP W    +D  QC+  C+G      +  V C      +  D   D      +      C+   C  +W+   W++C+ +CG +G Q+R L C
Sbjct:  572 WSVEEWGTCSRSC-GGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPHWVA--LDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECTATCGSHGFQSRRLEC 722          

HSP 3 Score: 51.6026 bits (122), Expect = 5.176e-7
Identity = 78/367 (21.25%), Postives = 128/367 (34.88%), Query Frame = 1
Query:  703 VKLPFEACYEKGLIT--PTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQS-DLPN-VLTKLSVIMKDIA--------RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVW-----KPTGLPAGDICNQINLKLPQVMKSCT 1752
            ++ P E+  + GL T   TN+    +   L+  + +  IK   R ++  L  + + + +G +  +  GT ++L C + +       W            +        NG +++   +  DEG + C   S  G + L+S TL      W    I  Q    P+ ++ +    M   A         W  G+ S CS SC +TG Q              +RL                        C + ++  VD S C     G+ +  +    RC  RD                      C   W +  W  CSRSCG  G++ R++ C       + T LP G +C       P   +SC 
Sbjct:  335 IEQPVES--DSGLYTCLATNRAGTDTLSSLVTITADSLIKT-TREVITDLSARLVQVNVGGMVRVRAGTNVTLGCHMDRPSTVETAWTKGGGDLERSLPSL------ANGSLILVNVTAADEGVYTCTTSSPFGSV-LESTTLIVLAGWWREGRILFQPVGHPDYIMHRNETRMLSAAYLGSLPELSWTPGEPSPCSASCGNTGVQ-------------SWRLR-----------------------CVRDDLEEVDASLCQ----GLPKPSLAAPQRCNRRD----------------------CPPSWSVEEWGTCSRSCG-GGMRLRHVTCQMLSSDGEVTPLPVG-LCEHDAGPRPTEEESCA 627          

HSP 4 Score: 47.7506 bits (112), Expect = 6.781e-6
Identity = 40/154 (25.97%), Postives = 63/154 (40.91%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVC-FQTTLYLVENIPFEYCSNQLTVIPTIRK--CNYGDCTNGFVWNTGHWTRCSHSCGNF--GIQTREVECLDSEGESVDDKFCEK---FRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHC 675
            +  W +CS +CG G + +   C   ++   V  +P   C +     PT  +      DC +   W    W +C+  C  +  G + R V C  + G  V D  C+K     +P  S+NC    C  ++    W  C   + C S G Q R + C
Sbjct:  574 VEEWGTCSRSCGGGMRLRHVTCQMLSSDGEVTPLPVGLCEHDAGPRPTEEESCAATHDCPH---WVALDWGQCTGRCVGWMTGTKHRRVSCRTTNGTLVPDSACDKSSSVARPALSQNCSAEACAGEWRPGRWSECT--ATCGSHGFQSRRLEC 722          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO44376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW19])

HSP 1 Score: 78.9518 bits (193), Expect = 4.176e-15
Identity = 124/537 (23.09%), Postives = 194/537 (36.13%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDC-TNGFV-----WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVK----LPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNR-TLVQMLPMKRLDIQLGQVSHIIFGTRLSLKC--SIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCI-GIGRAIMNTNV---RCIFRDQPTDLKRCDIKAKPM------MECA--------------------------------NLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPT 1683
            E   WS CS +CG G + +   C     Y   +I    C   L    T R C    C T  F+     W  G W++CS SCG+ G + R V C DS G +V ++ C+   +P     C    C   +   AW  C     C  G+Q R + C    +N  + K     PF             KR    R+C ++K   L + ++ + T++   P + L                S+ C   I++ P      +  ++  R         R +               G W   + +  G +Q +           + R   ++S   N     +        W  G WSKCS+SC   G + R+VYC     +   R      +K  E +P +K+       CP+W +     S+CS  C  G+ R ++  +    RC    +P  +K C++   P        EC+                                N+G    W+   W+QCS +CG+ G Q R + C  K T
Sbjct:  831 ETRNWSGCSVSCGVGEKTRSVTC----RYNGTSISPTRCDRALRPSLTER-CTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPC-TSWKHGAWGLC--SKSCGKGVQSRIVKCA--YENWKIAKDSQCDPF-------------KRPPEQRECELQKCEELALHVNKQATVLPTDPYRPLTPAHQPTWRTSAWGACSVTCGKGIRRRP------VTCTRNGRTSNACVQDSRPADTEVCTNAACPTWIMGSWSKCSLTCGGGVQTRRIDCSSSLTKCDHRKKPVESRRCNTEACPAT-------WREGPWSKCSVSC-GRGQRRRNVYCLPEGGNCDLR------VKPSEIQPCAKK------ACPEWTVGR--WSECSVTCGEGVVRRVVTCSAGGNRCQDDTKPEVVKLCELPDCPSWLSQEWGECSVTCGVGRRLRSVVCSIHGKCDKQRQPSSSTLCNMGPCATWQTGTWSQCSVTCGK-GTQVRTVTCSDKDT 1315          

HSP 2 Score: 71.633 bits (174), Expect = 6.906e-13
Identity = 123/551 (22.32%), Postives = 208/551 (37.75%), Query Frame = 1
Query:  259 CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSN---QLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPC--VSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPT---NKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNII----------WIHKSQQFRYKFQTFDRL-------------------RISKNGRMVITKFSKHDEGEW-ICKAGSVSGKLQLKSRTLFEGYRDWEI---------------RNIQLQ--SDLP-NVLTKLSVIMKDIAR---------WVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICN 1710
            CS  CG G Q++   C + T    + +  +YC +    L V+P   KC          W    W++CS +CG+ GI+TR   C+D +G+ + D  C    +    + C+   CP K+ ++ WE    +  + C SG+Q R + C      G+V+  P  AC      T T   N++ C + +       ++   +  +T           I   +    +  + L+ +C+    P +  I          W   SQ    + +   R+                   R +   R  +   +    G W +C      G   ++SR +   Y +W+I               R  +LQ   +L  +V  + +V+  D  R         W    W  CS++C   G + R V C +        ++D         +P     C+    CP W + +   S+CS  C   G  +    + C      + L +CD + KP+    C    C   W+  PW++CS SCG  G + R + C      LP G  C+
Sbjct:  664 CSAHCGPGKQKQKSDCMRVTGNKWQLVNVKYCKHLERPLAVVPCEGKCE------NTRWVYTRWSQCSRTCGS-GIKTRRANCVDHKGDFLPDTDCRPSDRLLLQQVCE-AECP-KWRAADWEQASNLCSASCGSGMQSRVVQC----SVGSVIH-PDSACPRAAKPTGTQRCNQQPCPAWETRNWSGCSVSCGVGEKTRSVTCRYNGTSISPTRCDRALRPS-LTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPCTSWKHGAWGLCSKSCGKG---VQSRIVKCAYENWKIAKDSQCDPFKRPPEQRECELQKCEELALHVNKQATVLPTDPYRPLTPAHQPTWRTSAWGACSVTC-GKGIRRRPVTCTRNGRTSNACVQDS--------RPADTEVCTN-AACPTWIMGS--WSKCSLTC---GGGVQTRRIDC-----SSSLTKCDHRKKPVESRRCNTEACPATWREGPWSKCSVSCGR-GQRRRNVYC------LPEGGNCD 1169          

HSP 3 Score: 56.9954 bits (136), Expect = 2.489e-8
Identity = 50/159 (31.45%), Postives = 70/159 (44.03%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEAC 726
            W  CS TCG G + +  VC   +++   +   +  S+ L        CN G C     W TG W++CS +CG  G Q R V C D      D   C+   KP++S  C      PK+I   W  C     C  GI  R + C+  L N +   LP+ +C
Sbjct: 1243 WGECSVTCGVGRRLRSVVC---SIHGKCDKQRQPSSSTL--------CNMGPCA---TWQTGTWSQCSVTCGK-GTQVRTVTCSDK-----DTSACDLRTKPQSSTVCGTSQECPKWIIGNWSQC--SRTCGIGITSREVQCI--LGNNS---LPYASC 1374          

HSP 4 Score: 52.7582 bits (125), Expect = 4.256e-7
Identity = 48/163 (29.45%), Postives = 72/163 (44.17%), Query Frame = 1
Query: 1210 MKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMME--CANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLP 1692
            + D   W++ +W +CS++C   G + RSV C              +C K  + +P+S   C++   C  W+      SQCS  C   G+      V C  +D       CD++ KP     C       KW I  W+QCSR+CG  GI +R + C+     LP
Sbjct: 1232 LPDCPSWLSQEWGECSVTC-GVGRRLRSVVCSI----------HGKCDK--QRQPSSSTLCNM-GPCATWQTGT--WSQCSVTC---GKGTQVRTVTCSDKD----TSACDLRTKPQSSTVCGTSQECPKWIIGNWSQCSRTCG-IGITSREVQCILGNNSLP 1370          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO37724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEZ8])

HSP 1 Score: 65.855 bits (159), Expect = 1.599e-12
Identity = 41/137 (29.93%), Postives = 69/137 (50.36%), Query Frame = 1
Query:  277 SGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSE----GESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            SG Q+++  C++    ++  + ++ C       P  RKCN   C   + W T  W++CS +C N GIQ R+V+C+ S+     ++  D +C +  KP  +RNC R  C   + +  W  C     C  G+Q R++ C
Sbjct:    4 SGMQKRIYDCYRKKDSMM--VKYKLCYGVTRQKPWKRKCNTKICKASYFWRTYQWSQCSVTCSN-GIQVRDVKCISSKYGEPNKTASDSYCGE-DKPLTTRNCIRDECLAMWKAGPWGEC--SKTCGRGLQTRTVEC 134          

HSP 2 Score: 46.9802 bits (110), Expect = 4.613e-6
Identity = 31/90 (34.44%), Postives = 42/90 (46.67%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFE-YCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE 516
            WS CS TC +G Q +   C  +          + YC     +  T R C   +C    +W  G W  CS +CG  G+QTR VEC D +G+
Sbjct:   56 WSQCSVTCSNGIQVRDVKCISSKYGEPNKTASDSYCGEDKPL--TTRNCIRDECL--AMWKAGPWGECSKTCGR-GLQTRTVECFDRDGK 140          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO36399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIR2])

HSP 1 Score: 67.0106 bits (162), Expect = 7.091e-12
Identity = 52/183 (28.42%), Postives = 93/183 (50.82%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP-TIRKCNYGDC-TNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            W  CS TCG+G + +   C    + + +NI  E  +      P T R+CN G C T+ F+ ++  +T CS +CG +G++ R V C    G+++ D  CE   +P +++ C+   C   +++S W  C ++  C  G Q R + C + + N    ++P   C  +    P ++R+C  ++C  E
Sbjct:  111 WRQCSVTCGTGIETRTVEC----MDVEQNITQEESACAEKPKPHTTRRCNPGGCKTHWFIGSS--FTSCSVTCG-YGVKERLVFCGRQGGDALPDSQCESRYRPRSTQRCREKRCQASWVTSEWSKCSAN--CGQGKQTRIVFCTNEVRN-VHQQVPIYNC--RHSPQPESERNCTIKECAPE 281          

HSP 2 Score: 56.225 bits (134), Expect = 1.797e-8
Identity = 49/155 (31.61%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  253 SSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKF----CEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVV 705
            +SCS TCG G +++L  C +      + +P   C ++     T R C    C     W T  W++CS +CG  G QTR V C + E  +V  +     C    +PE+ RNC    C P++  ++W+ C   + C  G Q+R + C  L D G  V
Sbjct:  171 TSCSVTCGYGVKERLVFCGRQGG---DALPDSQCESRYRPRSTQR-CREKRCQAS--WVTSEWSKCSANCGQ-GKQTRIVFCTN-EVRNVHQQVPIYNCRHSPQPESERNCTIKECAPEWFVTSWQKC--STTCGGGSQHRIVMC--LNDQGKRV 313          

HSP 3 Score: 51.6026 bits (122), Expect = 6.496e-7
Identity = 51/184 (27.72%), Postives = 76/184 (41.30%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTT----LYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE-SVDDKFCEKFRKPEASRNCKRYNCPPK-FISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            W  C  TCG+G Q +   C Q        +   +    C  Q +     R C    C     W TG W +CS +CG  GI+TR VEC+D E   + ++  C +  KP  +R C    C    FI S++  C     C  G++ R + C     +     LP   C  +    P + + C  ++C
Sbjct:   45 WKKCGKTCGTGIQLRNLYCRQKMDVDGRQVDRKVEINNCP-QWSRPKVTRPCQLPPCPPPNEWKTGPWRQCSVTCGT-GIETRTVECMDVEQNITQEESACAEKPKPHTTRRCNPGGCKTHWFIGSSFTSC--SVTCGYGVKERLVFCGRQGGDA----LPDSQCESR--YRPRSTQRCREKRC 218          

HSP 4 Score: 50.8322 bits (120), Expect = 8.908e-7
Identity = 36/114 (31.58%), Postives = 51/114 (44.74%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCP 591
            WS CS  CG G Q ++  C      + + +P   C +      + R C   +C     W    W +CS +CG  G Q R V CL+ +G+ V    CE  +KP   + C   NCP
Sbjct:  227 WSKCSANCGQGKQTRIVFCTNEVRNVHQQVPIYNCRHSPQP-ESERNCTIKEC--APEWFVTSWQKCSTTCGG-GSQHRIVMCLNDQGKRVGG--CEVSKKPLHWQRCNTQNCP 334          

HSP 5 Score: 49.6766 bits (117), Expect = 2.419e-6
Identity = 58/199 (29.15%), Postives = 82/199 (41.21%), Query Frame = 1
Query: 1150 IRNIQLQSDLPNVLT------KLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYD----HFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQ--PTDLKRCDIKAKP--MMECANLGCRVKWKI-SPWTQCSRSCGENGIQARYLICVWKPTGLPAGD 1701
            I N+++Q  L   +       K+  I    ARWV G+W KC  +C  TG Q R++YC +  D        ++E   C +    K T   Q        +W+       QCS  C   G  I    V C+  +Q    +   C  K KP     C   GC+  W I S +T CS +CG  G++ R + C     G   GD
Sbjct:    8 IDNVRVQDSLCTEIVAKPDRRKVCNIQPCPARWVPGEWKKCGKTC-GTGIQLRNLYCRQKMDVDGRQVDRKVEINNCPQWSRPKVTRPCQLPPCPPPNEWKTG--PWRQCSVTC---GTGIETRTVECMDVEQNITQEESACAEKPKPHTTRRCNPGGCKTHWFIGSSFTSCSVTCG-YGVKERLVFC-----GRQGGD 194          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO43067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZX8])

HSP 1 Score: 66.2402 bits (160), Expect = 1.856e-11
Identity = 59/215 (27.44%), Postives = 99/215 (46.05%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCF---QTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLD--SEGESVDDKFCEKFRKPEASRNC-KRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVK-LPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLD 864
            I+ WS+CS TCG G Q +  VC    +     +  I  +YC ++   +   R CN G CT    W T  W+ C   CG  GI TR V C+    E +   D  C    +P+  + C     CPP + +S W  C   + C +G++ R++ C    D G +++ +P + C     +    K  C +R      +  +E+  D+ ++ +   +KR++
Sbjct:  308 ISGWSACSSTCGQGKQVRRVVCRRVEKDNRETLSPIRDDYCDSRARPVDRQR-CNEGPCTT--KWLTSQWSECYPKCGR-GISTRMVYCVSVTDESQKYPDTLCNNSTRPQNQKQCVSDRVCPPMWHASQWSRCT--ATCGTGMKMRNVVCAQ--DEGKILRVVPRDLCDRNHSMPSIEK--CSTRPYQPSLAPTVEVCEDDESVAECSIVKRVN 512          

HSP 2 Score: 58.151 bits (139), Expect = 6.307e-9
Identity = 57/185 (30.81%), Postives = 85/185 (45.95%), Query Frame = 1
Query: 1165 LQSDLPN-------VLTKLSVIMKDIAR--WVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQ-----PTDLKRCDIKAKPM--MECANLGCRVKWKISPWTQCSRSCGENGIQARYLICV 1671
            L +D PN        L K  V++   A+  W    +S C+ SC + G+Q R V+C +  D     ++D  C    + KP ++RQC+     P+W IS    S CS+ C G G+ +     R + +D      P     CD +A+P+    C    C  KW  S W++C   CG  GI  R + CV
Sbjct:  218 LTADEPNPGIEYEFSLPKSVVVLPKKAKYSWKMDGFSACTASC-AGGYQVRRVFCARDRDGKV--VDDIFC--DYKSKPQTRRQCNDSPCPPRWFISG--WSACSSTC-GQGKQVRRVVCRRVEKDNRETLSPIRDDYCDSRARPVDRQRCNEGPCTTKWLTSQWSECYPKCGR-GISTRMVYCV 393          

HSP 3 Score: 54.6842 bits (130), Expect = 7.448e-8
Identity = 53/188 (28.19%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQT-TLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGES------VDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRK 780
            +++ +S+C+ +C  GYQ +   C +     +V++I  +Y S   T     R+CN   C     W    W+ CS +CG  G Q R V C   E ++      + D +C+   +P   + C    C  K+++S W  C    KC  GI  R ++CVS+ D     K P   C       P N++ C S +
Sbjct:  249 KMDGFSACTASCAGGYQVRRVFCARDRDGKVVDDIFCDYKSKPQTR----RQCNDSPCPP--RWFISGWSACSSTCGQ-GKQVRRVVCRRVEKDNRETLSPIRDDYCDSRARPVDRQRCNEGPCTTKWLTSQWSECY--PKCGRGISTRMVYCVSVTDESQ--KYPDTLC--NNSTRPQNQKQCVSDR 423          

HSP 4 Score: 54.299 bits (129), Expect = 9.573e-8
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  418 FVWNTGHWTRCSHSCGNFGIQTREVECL-DSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLME 792
            + W    ++ C+ SC   G Q R V C  D +G+ VDD FC+   KP+  R C    CPP++  S W  C   S C  G Q R + C  +  +      P    Y      P +++ C+   C  +
Sbjct:  246 YSWKMDGFSACTASCAG-GYQVRRVFCARDRDGKVVDDIFCDYKSKPQTRRQCNDSPCPPRWFISGWSAC--SSTCGQGKQVRRVVCRRVEKDNRETLSPIRDDYCDSRARPVDRQRCNEGPCTTK 368          
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Match: EDO32516 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUT8])

HSP 1 Score: 66.2402 bits (160), Expect = 2.983e-11
Identity = 51/171 (29.82%), Postives = 74/171 (43.27%), Query Frame = 1
Query:  175 FTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS----EGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            F   + K   EE      F      W  CS TCG G  +    C++ +      I  +YC+         + CN   C     W  G W  CS SC + G+  R V C+ S    E  +++DK C + R P + R C +  CPP ++S  W  C   ++C  GIQ R++ C
Sbjct:  645 FEYTIPKKTVEEFRGSLSFKWRYTDWMPCSATCGVGTTRSEVECYEESS--DSPIDEKYCNGTTRPDDRQKTCNENPCP--ATWYRGPWQTCSQSC-DRGVSVRSVLCVRSIKNDEQVALEDKECARPR-PLSVRACYKRPCPPPWVSGNWTKC--SARCGRGIQRRAVTC 807          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: adamts9 (ADAM metallopeptidase with thrombospondin type 1 motif 9 [Source:NCBI gene;Acc:101171570])

HSP 1 Score: 80.8777 bits (198), Expect = 2.761e-15
Identity = 109/458 (23.80%), Postives = 168/458 (36.68%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCP--PKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC-------LMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEW-ICKAGSVSGKLQ-------LKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLY-DHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDL-SQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMME 1566
            W +CS TC  G+Q+++ VC     Y     P   C +  +     R C  G C     W  G W  C+  CG  GI+TR V C    GE  +D  CE   KP     C    CP  P + +  W  C   + C  G + R + CV+    G+   +P E C       P+ +R C   +C         E S +    +  R +       R  ++ G        +  S  C +   P R          +R+K                        EGEW  C     +G+ Q       L  + + E Y   EIR   ++S   +    +         W+ G+W++CS +C   G++ R VYC +++ ++  Y    +         P S   C +   CP  +   V +  +CS  C   G  +M   V C+  D   +  RC   A P  +
Sbjct: 1339 WGACSSTCAGGFQRRVVVCQDENGY-----PANSCEDS-SRPNEQRSCESGPCPQ---WAYGSWGECTKPCGG-GIKTRLVVCQRPNGERFNDLSCEIHDKPPDQEQCNTQPCPSSPHWSTDPWSSC--SASCGRGFKSRKVSCVT----GSGRAVPEENCQHLS-PKPSKQRRCRGGRCPKWKTGSWGECSASCGDGVQQREVSCHDEGHRSPLETGCTQRSRPPS--SQSCRVADCPSR----------YRWK------------------------EGEWQTCSKSCGTGRRQRSLQCVDLNQQEVHEIYCVNEIRPPNMESCNTHACELI---------WITGEWTECSATC-GRGYRQRLVYCSEVHLENNNYEYSHQSLSNCPGSPPESYMPCKL-IPCPPTQEWRVGIWGECSVSC---GDGVMERMVHCVSADG-QESNRCSEDAMPETQ 1728          

HSP 2 Score: 78.5666 bits (192), Expect = 1.239e-14
Identity = 56/185 (30.27%), Postives = 84/185 (45.41%), Query Frame = 1
Query:  241 INVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKF--ISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLM 789
             + WSSCS +CG G++ +   C   +   V   P E C +        R+C  G C     W TG W  CS SCG+ G+Q REV C D    S  +  C +  +P +S++C+  +CP ++      W+ C     C +G + RS+ CV L       +      Y    I P N  SC++  C +
Sbjct: 1449 TDPWSSCSASCGRGFKSRKVSCVTGSGRAV---PEENCQHLSPKPSKQRRCRGGRCPK---WKTGSWGECSASCGD-GVQQREVSCHDEGHRSPLETGCTQRSRPPSSQSCRVADCPSRYRWKEGEWQTC--SKSCGTGRRQRSLQCVDL------NQQEVHEIYCVNEIRPPNMESCNTHACEL 1618          

HSP 3 Score: 60.8474 bits (146), Expect = 4.181e-9
Identity = 49/173 (28.32%), Postives = 74/173 (42.77%), Query Frame = 1
Query:  130 QKMRFLQWVVF----IHSIFTILLTKAQFEEKEIRKPFIHEINV-----------WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIP-----TIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNC 588
            ++ R LQ V      +H I+ +          EIR P +   N            W+ CS TCG GY+Q+L  C +  L   EN  +EY    L+  P     +   C    C     W  G W  CS SCG+ G+  R V C+ ++G+  +   C +   PE  + C++ +C
Sbjct: 1579 RRQRSLQCVDLNQQEVHEIYCV---------NEIRPPNMESCNTHACELIWITGEWTECSATCGRGYRQRLVYCSEVHL---ENNNYEYSHQSLSNCPGSPPESYMPCKLIPCPPTQEWRVGIWGECSVSCGD-GVMERMVHCVSADGQ--ESNRCSEDAMPETQKLCRKPSC 1736          

HSP 4 Score: 60.4622 bits (145), Expect = 4.792e-9
Identity = 129/584 (22.09%), Postives = 202/584 (34.59%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISS------------------------AWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLM-------EKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPK----RNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKH-------------------DEGEWI-CKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCI--------FRDQPTDLKRC-DIKAKPMMECANLGC--RVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINL-KLPQVMKSCTPPKCLL--KCIDVYKI 1794
            W+ CS +CG G   +   C      L ++    +    L   P    C+   C     W    WT CS +CG  G+ TR+V C+D   + V+   C+   +P   ++C    CP +   S                         W  C   S C  G Q R + C    +NG     P  +C +     P  +RSC S  C         E +      I  R +V   P       L    H     +   +C+ +  P         W   S      F++     ++ +GR V  +  +H                     G W  C A    G  Q +     EG+R         +S  P+  +          RW  G+W  CS SC  TG + RS+ C  L     + +    C+  +  +P +   C+    C    I+  + ++CS  C   GR      V C         +      L  C     +  M C  + C    +W++  W +CS SCG+ G+  R + CV        G   N+ +   +P+  K C  P C L   C+D+ ++
Sbjct: 1202 WAPCSASCGKGTWMRFVSCRDDQGGLADDSACAH----LPKPPASGVCSVVACGQ---WKVLEWTLCSVTCGQ-GLTTRQVLCVDFNEQEVNASECDPDDRPTTQQDCAMSQCPSRSSESRPLPSSPNARSSLPHSQSHQWRTGPWGAC--SSTCAGGFQRRVVVCQD--ENG----YPANSCEDSS--RPNEQRSCESGPCPQWAYGSWGECTKPCGGGIKTRLVVCQRPNGERFNDLSCEIHDKPPDQ--EQCNTQPCPSSPHWSTDPWSSCSASCGRGFKSRKVSCVTGSGRAVPEENCQHLSPKPSKQRRCRGGRCPKWKTGSWGECSASCGDGVQQREVSCHDEGHRSPLETGCTQRSRPPSSQSCRVADCPSRYRWKEGEWQTCSKSC-GTGRRQRSLQCVDLNQQEVHEI---YCVNEI--RPPNMESCNT-HACELIWITG-EWTECSATC---GRGYRQRLVYCSEVHLENNNYEYSHQSLSNCPGSPPESYMPCKLIPCPPTQEWRVGIWGECSVSCGD-GVMERMVHCV-----SADGQESNRCSEDAMPETQKLCRKPSCHLPSSCLDIQRL 1748          

HSP 5 Score: 55.4546 bits (132), Expect = 2.056e-7
Identity = 52/186 (27.96%), Postives = 82/186 (44.09%), Query Frame = 1
Query:  226 PFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKC 783
            P   E + WS CS +CG G + +  +C +      ++     CS +  +  TI+ CN   C     W TG W+ C  +CG  G + R+  C   E + +DD+FC    KPE+ + C++  C   +    W  C   + C  G Q R++ CV  + +   V    E         PTN + C   +C
Sbjct: 1009 PGGWEYSPWSECSKSCGGGTRHRGAICRKAAESGGDD---SKCSQRDKL--TIQPCNEFLCPQ---WKTGEWSECLVTCGK-GYKHRQAWCQFGE-DRLDDRFCGS-PKPESVQMCQQQEC-ASWQVGPWGQCT--TSCGPGYQMRAVKCV--VGSYAAVMDDTEC---NAATRPTNTQDCEVAQC 1175          

HSP 6 Score: 53.5286 bits (127), Expect = 7.251e-7
Identity = 44/165 (26.67%), Postives = 58/165 (35.15%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFV----------------WNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSL 684
            ++  W  C+ +CG GYQ +   C   +   V +   +   N  T     + C    C N                   W  G W  CS SCG  G   R V C D +G   DD  C    KP AS  C    C  ++    W  C     C  G+  R + CV  
Sbjct: 1122 QVGPWGQCTTSCGPGYQMRAVKCVVGSYAAVMD---DTECNAATRPTNTQDCEVAQCPNSHPVPPGTKVPSHQGHKTQWRFGSWAPCSASCGK-GTWMRFVSCRDDQGGLADDSACAHLPKPPASGVCSVVAC-GQWKVLEWTLC--SVTCGQGLTTRQVLCVDF 1279          

HSP 7 Score: 51.6026 bits (122), Expect = 3.272e-6
Identity = 50/200 (25.00%), Postives = 81/200 (40.50%), Query Frame = 1
Query: 1225 RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHC------------IGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRV--------KWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKC 1764
            +W  G+WS+C ++C   G++ R  +C+   D    RL+D  C      KP S + C     C  W++      QC+  C            +G   A+M+ +  C    +PT+ + C++   P       G +V        +W+   W  CS SCG+ G   R++ C     GL     C   +L  P     C+   C
Sbjct: 1066 QWKTGEWSECLVTC-GKGYKHRQAWCQFGED----RLDDRFCGS---PKPESVQMCQQQE-CASWQVG--PWGQCTTSCGPGYQMRAVKCVVGSYAAVMD-DTECNAATRPTNTQDCEVAQCPNSHPVPPGTKVPSHQGHKTQWRFGSWAPCSASCGK-GTWMRFVSCRDDQGGLADDSAC--AHLPKPPASGVCSVVAC 1250          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000006651.2 (pep primary_assembly:ASM223467v1:1:12683703:12687070:-1 gene:ENSORLG00000005274.2 transcript:ENSORLT00000006651.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.095e-14
Identity = 57/201 (28.36%), Postives = 92/201 (45.77%), Query Frame = 1
Query:  244 NVWSS-CSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEG---ESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTL 834
            ++WS  CS  CG G + +  VC         ++P + C       P +  C+ G C N   W TG W++CS  CGN G QTR   C+ +     E VD   C    KP  S+ C+   C  ++  + W  C     C+SG + R + C  L D+     +P + C+   +  P ++  C+ + CL E S +++    + +L
Sbjct:   11 SLWSQRCSAECGRGNKTRSVVCLSNRGG--SDLPLDGCEGDRP--PAVTSCDAGPCQNQLEWYTGPWSQCSAECGN-GTQTRSALCIFTNNGLQEVVDQFKCSGLSKPITSQPCRLKPCGVQWYVTEWSAC--SRSCNSGYRVREVRC--LTDD----IVPSDDCHPISI--PESREECNKQPCLTETSRSIQQYSTDSSL 196          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000006304.2 (pep primary_assembly:ASM223467v1:18:11544264:11547761:-1 gene:ENSORLG00000005000.2 transcript:ENSORLT00000006304.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 6.456e-14
Identity = 71/274 (25.91%), Postives = 114/274 (41.61%), Query Frame = 1
Query:  907 LSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPN-VLTKLS--------VIMKDIA----RWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKR-CDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTG 1686
            L L+C     P  ++ W    ++ +      D + +  +  + I   SK DEG + C A +  G   L S       R   +R  +L   +     + LS        ++  D A    RW    WS CS SC   G Q R + C K        +E  +CL     +PT+ R C+V   C +W  ++     C   C+G   A  + +V C    Q T++   C  +   +  C+   C ++W +  WTQC+ +CG +G Q+R + C    TG
Sbjct:  279 LELRCEALGDPHPSVTWTKNGKEVK---SIMDSVELLPSSSLRIQSPSKGDEGLYTCTARNHLGSASLSSYLQMTSRR--AVRRTRLPPQVYRCYYSTLSFACACHNPIVFADSAWGRIRWHLDAWSSCSASC-GGGSQTRRLRCLKGRSR---EVEIRQCLL-AGRRPTNTRLCNV-GPCARWVTAS--WGPCHGQCVGPSLATQHRHVYC----QDTNVSLVCVRRPSSVKNCSTEACALRWHVGAWTQCTATCGRHGFQSRQVTCKHHRTG 535          

HSP 2 Score: 49.6766 bits (117), Expect = 8.330e-6
Identity = 42/148 (28.38%), Postives = 56/148 (37.84%), Query Frame = 1
Query:  238 EINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSC--GNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
             ++ WSSCS +CG G Q +   C +     VE      C          R CN G C     W T  W  C   C   +   Q R V C D+    V    C   R+P + +NC    C  ++   AW  C +      G Q R + C
Sbjct:  395 HLDAWSSCSASCGGGSQTRRLRCLKGRSREVE---IRQCLLAGRRPTNTRLCNVGPCAR---WVTASWGPCHGQCVGPSLATQHRHVYCQDTNVSLV----C--VRRPSSVKNCSTEACALRWHVGAWTQCTATCG-RHGFQSRQVTC 529          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: adamts3 (A disintegrin and metalloproteinase with thrombospondin motifs 3 [Source:NCBI gene;Acc:101167013])

HSP 1 Score: 74.7146 bits (182), Expect = 2.061e-13
Identity = 48/146 (32.88%), Postives = 64/146 (43.84%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL----DSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            WS CS  C  G+QQ    C +      + I   +C       P  R CN  DCT    W +  W  C+ +CG+ G Q R V CL    D    S+  K+C    KPE+ R C R  CP ++ + AW  C     C  G + R + C
Sbjct:  832 WSPCSKPCSGGFQQTKYGCRKKGD--TKMIHRGFCDANKKPKPIRRMCNLQDCTQP-QWVSDEWEHCTKTCGSLGFQIRTVRCLQLFHDGTNRSIHSKYCSN-EKPESRRPCNRTPCPSQWRTGAWSEC--SVTCGEGTERRLVTC 971          
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Match: adamts3 (A disintegrin and metalloproteinase with thrombospondin motifs 3 [Source:NCBI gene;Acc:101167013])

HSP 1 Score: 74.7146 bits (182), Expect = 2.111e-13
Identity = 48/146 (32.88%), Postives = 64/146 (43.84%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECL----DSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHC 675
            WS CS  C  G+QQ    C +      + I   +C       P  R CN  DCT    W +  W  C+ +CG+ G Q R V CL    D    S+  K+C    KPE+ R C R  CP ++ + AW  C     C  G + R + C
Sbjct:  855 WSPCSKPCSGGFQQTKYGCRKKGD--TKMIHRGFCDANKKPKPIRRMCNLQDCTQP-QWVSDEWEHCTKTCGSLGFQIRTVRCLQLFHDGTNRSIHSKYCSN-EKPESRRPCNRTPCPSQWRTGAWSEC--SVTCGEGTERRLVTC 994          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000073115.1 (SMESG000073115.1)

HSP 1 Score: 1206.43 bits (3120), Expect = 0.000e+0
Identity = 585/585 (100.00%), Postives = 585/585 (100.00%), Query Frame = 1
Query:  136 MRFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLNHKV 1890
            MRFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLNHKV
Sbjct:    1 MRFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLNHKV 585          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000073134.1 (SMESG000073134.1)

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 269/584 (46.06%), Postives = 394/584 (67.47%), Query Frame = 1
Query:  136 MRFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEP-CVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHS----RKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQ 1872
            + F   ++ I +    L        + I K F+ EI++WS CS TCG G Q+K + CF+ T+YL+ENIP + C +   +  T R CNYGDC NG+VW    W++CSH+CG  GIQ REVEC  S G+ VD + C++ +KP++ R C RYNCPP F++  W+  CV  S C  G Q R + C+SLL+ G VV LP  ACY KGL+ P + R C      +KC  +     EI  + RTLVQM  +++L++Q+GQ+S++  GTRL+L C +K F   N+IW HK  ++ YK ++ +R+R+++ G+++I  F   D+GEW C AG++S  + +KS++  +GY+DW IRN     D+PN L +L ++ ++  RWV G WS+CS+SCE+TG Q R V CE L   FYY+L D+EC++ +  KP +KR+C   F CP+W   NV+L+QC++HCIG  +A    +++CIF++Q   L++CD   KP+ EC N  CRV+WKIS WT+CSR+CG++GIQARYLICVW+ + LPAG++C  INL++PQV+KSC PPKC LKC+D++  C++KK+YC + I+ + CCKTC+ +F+
Sbjct:    2 ISFGGILIIILNFAICLFDGQSIGNRPIGKVFLEEIDIWSKCSTTCGEGVQEKFQACFKKTVYLIENIPMDKCEHIPKIKVTTRVCNYGDCENGYVWKFTDWSKCSHTCGYEGIQLREVECYHSSGQVVDQEMCDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVVDLPRAACYAKGLVPPASWRQCFDHIDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWAHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCENTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKSGIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEYCRMGIYSFSCCKTCQEYFK 585          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000079770.1 (SMESG000079770.1)

HSP 1 Score: 419.083 bits (1076), Expect = 8.112e-138
Identity = 210/581 (36.14%), Postives = 326/581 (56.11%), Query Frame = 1
Query:  154 VVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGE----SVDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCH----SRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQ 1872
            +VF+  I       A+ +E + +  F  E++ W+SCS TCG G +QK  +C + + Y  E +  E C     + PTI++CN G+C + +VW  G W+ CS +CG+ G +TR+VEC+  EG     + D K+CE   +PEAS +C   +CP   +   W  C  + KC +G Q R + C+S+L NG    +P  AC    +  P + R C+    +++CL +      I+I   TLVQM   K L+I +GQ++++   TR+ + C +  F  R+I+W H +  + Y  ++ D +R+ K GR+ I KF   D+G W C AG  +    +K R    G++DW++R      ++ N   ++ +   ++ +W+   WS+CS++C   G Q R V+CE+     Y  L+D  C K  ++KP ++R C +   CPKW+++ ++   C+N CI IG   +  N+ CI + Q  +   CD K K  MEC N  C+V WK S W++CS+SCG  GI ARYLIC+WK T  PAG +C    + LP+V+KSC  PKC LKC+D+Y  C+   K C   I+ Y CCK+C    +
Sbjct:   10 IVFLVLISETFKVNAKIKESQTQT-FWLEVDEWNSCSTTCGPGTRQKKVICIKKSFYTEEMVSDELCKTVPVISPTIKECNLGNCYDNYVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLKDLRIPPIIEIKKNTLVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVEGFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSKSCGGIGIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAKKCIQSIYRYTCCKSCSRLAE 588          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000042318.1 (SMESG000042318.1)

HSP 1 Score: 368.622 bits (945), Expect = 1.209e-119
Identity = 187/555 (33.69%), Postives = 292/555 (52.61%), Query Frame = 1
Query:  250 WSSCSDTCGSGYQQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTGHWTRCSHSCGNFGIQTREVECLDSEGES----VDDKFCEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSCHS----RKCLME-KSTNLEIKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTCRLFFQDLNHK 1887
            WS CS TCG G Q K + C       V       CS        IR C   +C   + W T  W++CSHSCGN G + R+VEC  +  E+    V + FC KF KP     C R +CPP+F++  W  CV    C  G Q R ++C  +L +G + ++P   CY K    P   R C+      KCL       +E  + N    QM   K + +Q+GQ+++++  +R+ + C ++ FP+ NIIW HK+  F+Y  +   R+R+ + G++ I K    D+GEW C A        +K R    G+RDW +RN   ++ + +  +   +  +++ +W+   WS CS++C   G Q+R V+CEK+   FY  L+D +C K +   P   R C     CP W++  +D S+C+N C+ I  + +   ++CI+ +Q   L  C+ K KP + C N  C + W+++ W++CS+SC   G QAR + CVWK T   AG +C +    LP+V++ C    C +KCID+   C  + K CH  ++ Y CC TC+ ++Q LN +
Sbjct:   35 WSPCSVTCGEGKQTKEKFCAIKVNSTVIKTSKHRCSRLKASHTLIRFCYQTECPEKYRWKTSSWSQCSHSCGNLGFRFRDVECSHNISETNSIGVAEFFCAKFIKPMQRSLCNRVDCPPEFVTGKWGKCVKGQGCHPGNQKRKLNCSQILQSGEIKQMPLFRCYTKKRPPPAQWRKCYDFINIPKCLKGIPPRKVEFTMSNNNFYQMRRAKIVQLQIGQIAYLLPYSRIIITCPVENFPQHNIIWTHKNDTFKYNGRVSKRIRVDRIGQIRIRKLLFQDQGEWNCIADRSQKSAIIKIRNPSSGFRDWAVRNNLWKTGMLSEDSNKPINRQELVQWITSDWSVCSVTCSGDGLQYREVHCEKVEPRFYLVLDDNDCEK-VTPAPNKMRNCYTAIECPLWKVERIDKSKCTNECVDIRLSSVLVELKCIYMNQDVPLHLCEQKKKPEITCQNEACHLDWRLNSWSKCSKSCDGVGFQARSIACVWKSTRKSAGSLCYENKFPLPKVVRECETKPCNMKCIDLSTKCSSEPKRCHQNLYKYLCCYTCQTYYQKLNEQ 588          
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Match: SMESG000002617.1 (SMESG000002617.1)

HSP 1 Score: 304.294 bits (778), Expect = 8.058e-95
Identity = 178/597 (29.82%), Postives = 307/597 (51.42%), Query Frame = 1
Query:  136 MRFLQWVVFIHSIFTIL-LTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGYQQKLRVCFQTTLY-LVENIPFEYCSN-QLTVIPTIRKCNYGDC----TNGFVWNTGHWTRCSHSCGNFGIQTREVECLDS--EGESVDDKF--CEKFRKPEASRNCKRYNCPPKFISSAWEPCVSDSKCDS-GIQYRSIHCVSLLDNGTVVKLPFEACYEKGLITPTNKRSC-----HSRKCLMEKSTNLE----IKIDNRTLVQMLPMKRLDIQLGQVSHIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMVITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPNVLTKLSV--IMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRLEDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIMNTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCGENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDVYKICEKKKKYCHIEIFYYRCCKTC 1857
            + F+++ + + S+      T+ +FE +  +        +WSSCS  CG G Q+ L  C Q TL    E + ++ C   +     T++ C  G C    T+ F+W  G WT CS SCG  G++TR+V+C+ S   G  ++ K   C+   +P  +  C  ++CPP+F +++W  C     C S GI+ R I+C+    NGT   +P   CY +    P    SC     +  KC  +          I I    +  M   K+L + +GQ + ++  TR+ +KC +  FP  N+ W+  +  + +  +  +R+ +S+ G ++I KFS  DEG+WICKAG+++ ++++ ++   +G+  +  R I  + D+       ++  I     +WV G WS CS SC   G+Q R V CE +   ++  ++  +CLK    KP + R+C +   CP W I      +C+  C+ +G++  +  ++C + ++      CD+  +P+  C N  C + WK   W+ CS SCG  GI+AR + C W+     AG +C++  +++P ++K C+ P C L C+D+ K C   KK C ++ + + CCKTC
Sbjct:    5 IMFVRYALILGSLLGFCGPTRGKFEWQNSQ--------LWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCYIRSK-PPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSCGIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCGNPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHC-GLKKLCSVDHYQHFCCKTC 591          
The following BLAST results are available for this feature:
BLAST of ADAMTS-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL31.769e-2027.96ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL31.818e-2027.72ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL12.119e-2025.68ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTSL12.465e-1925.47ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTS91.711e-1624.22ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-49.870e-4825.28pep chromosome:WBcel235:I:8931035:8937718:-1 gene:... [more]
madd-48.052e-4725.00pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
madd-41.011e-4625.00pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
gon-19.585e-1723.09A disintegrin and metalloproteinase with thrombosp... [more]
gon-11.073e-1623.09A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nolo5.072e-2230.38gene:FBgn0051619 transcript:FBtr0307497[more]
nolo5.072e-2230.38gene:FBgn0051619 transcript:FBtr0110959[more]
nolo5.107e-2230.38gene:FBgn0051619 transcript:FBtr0301000[more]
nolo5.658e-2230.38gene:FBgn0051619 transcript:FBtr0085901[more]
nolo6.000e-2230.38gene:FBgn0051619 transcript:FBtr0339132[more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl31.516e-1727.21ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
adamtsl37.460e-1633.87ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
si:ch211-267e7.34.464e-1535.29si:ch211-267e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
si:ch211-267e7.36.420e-1535.29si:ch211-267e7.3 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
adamts103.107e-1333.88ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vash11.863e-2528.28vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
vash11.318e-2427.76vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
ADAMTSL12.535e-1923.76ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL13.256e-1923.76ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL13.618e-1923.76ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adamtsl12.563e-1826.45ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl33.624e-1826.07ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499][more]
Adamtsl13.862e-1725.21ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Thsd42.529e-1431.03thrombospondin, type I, domain containing 4 [Sourc... [more]
Adamts95.407e-1422.09a disintegrin-like and metallopeptidase (reprolysi... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90884|MADD4_CAEEL1.024e-4525.00Protein madd-4 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|P82987|ATL3_HUMAN8.732e-2027.72ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8N6G6|ATL1_HUMAN1.184e-1825.47ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8BLI0|ATL1_MOUSE2.701e-1625.21ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9P2N4|ATS9_HUMAN1.194e-1524.03A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YRS14.801e-12434.96AdamTS protein 3 OS=Fasciola gigantica OX=46835 GN... [more]
A0A4E0R7Q31.704e-12334.79AdamTS protein 3 OS=Fasciola hepatica OX=6192 GN=D... [more]
A0A564ZBH02.660e-12135.88Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3S9E24.763e-12135.88Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A183JCE17.747e-12136.03Ig-like domain-containing protein OS=Schistosoma c... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl35.039e-2028.20ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000039281.12.555e-1925.38pep primary_assembly:Astyanax_mexicanus-2.0:16:258... [more]
adamts91.150e-1422.88ADAM metallopeptidase with thrombospondin type 1 m... [more]
si:ch211-267e7.32.318e-1434.44ADAMTS-like protein 2 [Source:NCBI gene;Acc:103033... [more]
ENSAMXT00000052357.16.023e-1430.81pep primary_assembly:Astyanax_mexicanus-2.0:21:612... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl33.158e-2031.19ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ENSPMAT00000009057.13.190e-1924.13pep scaffold:Pmarinus_7.0:GL480935:1501:23785:-1 g... [more]
ENSPMAT00000008623.11.141e-1831.09pep scaffold:Pmarinus_7.0:GL476601:130594:138220:-... [more]
ENSPMAT00000000756.13.251e-1432.23pep scaffold:Pmarinus_7.0:GL477404:44246:61450:-1 ... [more]
ENSPMAT00000000757.14.974e-1432.23pep scaffold:Pmarinus_7.0:GL477404:45077:62293:-1 ... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443764.176e-1523.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377241.599e-1229.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363997.091e-1228.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430671.856e-1127.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325162.983e-1129.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts92.761e-1523.80ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSORLT00000006651.21.095e-1428.36pep primary_assembly:ASM223467v1:1:12683703:126870... [more]
ENSORLT00000006304.26.456e-1425.91pep primary_assembly:ASM223467v1:18:11544264:11547... [more]
adamts32.061e-1332.88A disintegrin and metalloproteinase with thrombosp... [more]
adamts32.111e-1332.88A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of ADAMTS-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073115.10.000e+0100.00SMESG000073115.1[more]
SMESG000073134.10.000e+046.06SMESG000073134.1[more]
SMESG000079770.18.112e-13836.14SMESG000079770.1[more]
SMESG000042318.11.209e-11933.69SMESG000042318.1[more]
SMESG000002617.18.058e-9529.82SMESG000002617.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018067 ID=SMED30018067|Name=ADAMTS-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1915bp
CTATAATCTTTGACGTTTTGTATAATAATATGACAGTATTATAGCAACAA
TAAAATCTAGTTAATCTGCTAAAATTCAATAATATGAAGCGTTCTATTTG
AATGCTTGCTAATATGTGAGCGCTTCATTCAAAAGATGCGGTTTCTGCAA
TGGGTTGTTTTCATTCATTCAATCTTTACGATCCTGTTAACCAAAGCTCA
ATTTGAGGAAAAAGAAATTAGAAAACCATTTATCCATGAAATAAATGTCT
GGAGCTCTTGCTCGGATACATGTGGAAGTGGTTACCAACAAAAGCTGCGA
GTATGTTTTCAGACAACATTATATTTAGTGGAGAATATTCCCTTTGAATA
CTGCTCAAATCAACTCACAGTTATTCCTACGATAAGAAAATGTAATTATG
GCGACTGTACAAATGGTTTTGTTTGGAATACGGGTCACTGGACAAGATGT
TCTCATAGTTGTGGGAATTTTGGAATTCAAACTAGAGAAGTAGAATGTCT
GGACTCTGAAGGTGAATCTGTTGATGACAAATTTTGTGAGAAATTTAGAA
AGCCTGAAGCTTCAAGAAATTGTAAAAGATATAATTGTCCTCCAAAATTT
ATATCTAGTGCTTGGGAACCATGCGTCAGTGATAGCAAATGTGACTCAGG
AATTCAATATCGCTCTATTCACTGTGTTAGTTTATTGGATAATGGTACCG
TTGTGAAGTTACCCTTTGAAGCTTGTTATGAAAAAGGACTAATTACTCCA
ACTAATAAAAGATCATGTCATTCTAGGAAATGTTTAATGGAAAAGAGTAC
AAATTTAGAAATCAAAATTGACAATCGGACTTTAGTTCAAATGCTTCCAA
TGAAAAGATTAGATATTCAATTAGGTCAAGTTTCTCATATCATATTCGGT
ACCCGCCTTTCTCTCAAGTGTTCGATAAAAAAATTTCCTAAACGAAACAT
AATTTGGATTCATAAAAGTCAACAATTTCGTTACAAATTTCAAACTTTTG
ACAGACTCAGGATATCGAAAAATGGAAGAATGGTGATTACAAAGTTTTCC
AAGCACGATGAAGGAGAATGGATTTGTAAAGCAGGCAGTGTCAGTGGTAA
ATTACAACTAAAATCCAGGACATTGTTTGAAGGTTATAGAGATTGGGAAA
TTCGAAACATTCAGCTTCAATCTGATCTTCCAAATGTTCTGACAAAATTG
AGTGTGATTATGAAAGACATAGCAAGATGGGTAGCTGGAAAATGGAGCAA
ATGCTCAATATCGTGTGAAAGTACGGGTCATCAATTTAGATCAGTTTATT
GCGAAAAGCTCTATGACCATTTTTACTATCGATTAGAGGATGAAGAATGT
CTAAAACATTTGGAAGAGAAACCCACCAGTAAAAGACAGTGTTCAGTGCC
TTTTGGTTGTCCAAAATGGGAAATCTCTAATGTTGATTTATCACAATGTT
CCAATCATTGTATTGGGATCGGAAGAGCTATAATGAATACTAATGTCAGA
TGCATATTTCGGGACCAACCGACAGATTTGAAAAGATGTGATATTAAAGC
AAAACCAATGATGGAATGCGCCAATTTAGGATGTCGTGTGAAATGGAAAA
TAAGTCCCTGGACGCAATGTTCAAGAAGTTGTGGTGAAAACGGAATACAG
GCTCGGTACCTAATTTGCGTTTGGAAACCCACTGGATTACCAGCCGGGGA
TATTTGTAATCAAATAAATCTTAAACTACCTCAAGTTATGAAGTCCTGCA
CTCCGCCGAAATGTTTGTTAAAGTGCATCGATGTTTATAAGATTTGCGAA
AAAAAGAAGAAATACTGTCACATAGAAATATTTTATTATCGCTGCTGCAA
AACGTGTCGATTGTTTTTTCAGGATTTAAATCATAAAGTATGAAATATTA
AATTTGTGGTTTTCA
back to top

protein sequence of SMED30018067-orf-1

>SMED30018067-orf-1 ID=SMED30018067-orf-1|Name=SMED30018067-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=586bp
MRFLQWVVFIHSIFTILLTKAQFEEKEIRKPFIHEINVWSSCSDTCGSGY
QQKLRVCFQTTLYLVENIPFEYCSNQLTVIPTIRKCNYGDCTNGFVWNTG
HWTRCSHSCGNFGIQTREVECLDSEGESVDDKFCEKFRKPEASRNCKRYN
CPPKFISSAWEPCVSDSKCDSGIQYRSIHCVSLLDNGTVVKLPFEACYEK
GLITPTNKRSCHSRKCLMEKSTNLEIKIDNRTLVQMLPMKRLDIQLGQVS
HIIFGTRLSLKCSIKKFPKRNIIWIHKSQQFRYKFQTFDRLRISKNGRMV
ITKFSKHDEGEWICKAGSVSGKLQLKSRTLFEGYRDWEIRNIQLQSDLPN
VLTKLSVIMKDIARWVAGKWSKCSISCESTGHQFRSVYCEKLYDHFYYRL
EDEECLKHLEEKPTSKRQCSVPFGCPKWEISNVDLSQCSNHCIGIGRAIM
NTNVRCIFRDQPTDLKRCDIKAKPMMECANLGCRVKWKISPWTQCSRSCG
ENGIQARYLICVWKPTGLPAGDICNQINLKLPQVMKSCTPPKCLLKCIDV
YKICEKKKKYCHIEIFYYRCCKTCRLFFQDLNHKV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR000884TSP1_rpt
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 96..152
e-value: 0.0073
score: 25.5
coord: 486..544
e-value: 0.039
score: 21.8
coord: 364..426
e-value: 0.9
score: 9.7
coord: 33..92
e-value: 0.45
score: 12.4
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 99..137
e-value: 0.061
score: 13.5
coord: 490..514
e-value: 9.8E-4
score: 19.3
coord: 39..60
e-value: 2.9E-4
score: 21.0
coord: 368..392
e-value: 0.0048
score: 17.1
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 361..426
score: 8.732
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 93..152
score: 9.327
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 483..544
score: 8.851
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 30..92
score: 8.057
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 253..321
e-value: 2.5E-4
score: 30.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 33..91
e-value: 2.8E-6
score: 29.7
coord: 482..543
e-value: 5.6E-6
score: 28.7
coord: 362..426
e-value: 2.4E-5
score: 26.7
coord: 95..152
e-value: 1.6E-10
score: 43.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 93..151
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 361..422
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 33..91
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 485..543
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 248..329
e-value: 7.7E-9
score: 37.4
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 35..219
coord: 309..575
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.735
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 238..331
score: 8.194
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 251..325