Cytochrome P450 2K1-like protein

Overview
NameCytochrome P450 2K1-like protein
Smed IDSMED30018042
Length (bp)1216
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018042

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30018042SMESG000072594.1 SMESG000072586.1 SMESG000072585.1 SmedASXL_006896SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30018042SMESG000072594.1 SMESG000072586.1 SMESG000072585.1 dd_Smed_v6_10682_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30018042SMESG000072594.1 SMESG000072586.1 SMESG000072585.1 dd_Smed_v4_10682_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C18 (cytochrome P450 family 2 subfamily C member 18 [Source:HGNC Symbol;Acc:HGNC:2620])

HSP 1 Score: 162.54 bits (410), Expect = 1.622e-44
Identity = 109/347 (31.41%), Postives = 173/347 (49.86%), Query Frame = 2
Query:  197 KDRLPNGQREVPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIP-----VQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            + RLP+G    PT   LP+IG I ++    +   L    K  GP+F++  G++ + VL+ Y+++K+AL+D G  FSGR             G+LF++GK W+  R F L  LR+FG GK    + VQEE    +EEL    +   + + ++     N+I   I + R+  +D   + L+E         K      +L  P  +    F   +       + I      ++ Y  E I+EH+E+LD NS   D ID FLI   Q  +++     F    +I   +++F AG+ET+STTL +  L + +YP++  KV  EI  ++GR R P M D+  + YT AV+ E
Sbjct:   26 RGRLPSG----PTP--LPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLME---------KFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNS-ARDFIDCFLIKMEQ--EKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2B6 (cytochrome P450 family 2 subfamily B member 6 [Source:HGNC Symbol;Acc:HGNC:2615])

HSP 1 Score: 160.229 bits (404), Expect = 1.086e-43
Identity = 101/324 (31.17%), Postives = 160/324 (49.38%), Query Frame = 2
Query:  296 LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQ-----STLFAKFMQLTSS------------WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
             LR  ++ G +F++ LG R V +L   ++I++ALVD    FSGR K      F    GV+F +G  W+  R F +  +RDFG GK    E +QEE    IEEL       ++ + L    + NII   +  +R+   D                    Q  L M  +F Q     S++F +  +L S             +K+L  +  Y    +E+HRE LD  S  +DLID +L+  H  ++++     F++  +  N   LF AG+ET+STTL +  L M +YP + ++V+ EI ++IG  R P ++D+  + YT+AV+ E
Sbjct:   55 FLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQD--------------------QEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLD-PSAPKDLIDTYLL--HMEKEKSNAHSEFSHQNLNLNTLSLFFAGTETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYE 355          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C8 (cytochrome P450 family 2 subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:2622])

HSP 1 Score: 155.606 bits (392), Expect = 8.439e-43
Identity = 101/349 (28.94%), Postives = 170/349 (48.71%), Query Frame = 2
Query:  188 TFKKDRLPNGQREVPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQL-----TSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            + ++ +LP G    PT   LP+IG + +I    +        K  GP+F++  GM  + V + Y+++K+AL+D+G  FSGR  +          G++ ++GK W+  R F L  LR+FG GK    + VQEE    +EEL    +   + + ++     N+I   +  +R+   D             L  +    F +L  P  +    F   +           K++   + Y  E ++EH+ +LD N+   D ID FLI     Q+++     FN   ++   ++LF+AG+ET+STTL +  L + ++P++  KV  EI  +IGR R P M D+  + YT AV+ E
Sbjct:   23 SCRRRKLPPG----PTP--LPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKD--------QNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNP-RDFIDCFLIKME--QEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2C8 (cytochrome P450 family 2 subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:2622])

HSP 1 Score: 155.221 bits (391), Expect = 7.878e-42
Identity = 101/349 (28.94%), Postives = 170/349 (48.71%), Query Frame = 2
Query:  188 TFKKDRLPNGQREVPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQL-----TSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            + ++ +LP G    PT   LP+IG + +I    +        K  GP+F++  GM  + V + Y+++K+AL+D+G  FSGR  +          G++ ++GK W+  R F L  LR+FG GK    + VQEE    +EEL    +   + + ++     N+I   +  +R+   D             L  +    F +L  P  +    F   +           K++   + Y  E ++EH+ +LD N+   D ID FLI     Q+++     FN   ++   ++LF+AG+ET+STTL +  L + ++P++  KV  EI  +IGR R P M D+  + YT AV+ E
Sbjct:   23 SCRRRKLPPG----PTP--LPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKD--------QNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNP-RDFIDCFLIKME--QEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Match: CYP2E1 (cytochrome P450 family 2 subfamily E member 1 [Source:HGNC Symbol;Acc:HGNC:2631])

HSP 1 Score: 155.221 bits (391), Expect = 8.959e-42
Identity = 99/336 (29.46%), Postives = 176/336 (52.38%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQ-LTSSWKSLIP----VQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  + LP+IG + +++   +P    RL +  GP+F++ +G +++ V++ Y ++K+AL+D    FSGR     F     D G++F +G  W+  R F L  LR++G GK  +   +Q E    +E L     Q  + + LI     N+I+  +  + +   D+  ++L+       L N++   F LL  P  +    F  F+  L  S + +I     V+EY +E ++EH ++LD N    DL D  L+   + +     + T +   +    ++LF AG+ET+STTL +  L + +YP+I++K+H EI  +IG  R+P + D++ + Y  AV+ E
Sbjct:   34 PGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAH-RDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLM------YLFNEN---FHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCP-RDLTDCLLVEMEKEKHSAERLYTMDGITV--TVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHE 356          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C12 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q9N4Q4])

HSP 1 Score: 133.65 bits (335), Expect = 9.430e-35
Identity = 93/313 (29.71%), Postives = 154/313 (49.20%), Query Frame = 2
Query:  311 KELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDS-GVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRD-----DPMIQLIEESGRKVLTNKDKAQF----ILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGE-DLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K+ G +++   G +   V++SY  +K+A + DG  F+ + +  F   F   + GV+ T+G +W T R F L+  RDFG GK+   E +  E  +   + D  + +  N   ++   + N+I++ I   R+ ++       +  L+E       T K   QF    I    P      L A+F          +   ++F   IEEHR  +DF+SE   D  + +L  Q + Q+  G  E F+  Q+     +L+ AG  T+  TLTW    +  YPD+Q+K+H E+ E+IG +RL T +DK +L Y  AV++E
Sbjct:   56 KDFGDVYTFWFGTKPYIVVSSYKRLKEAFILDGDTFADKIRQPFQDQFRGGNYGVVDTNGHVWSTHRRFALSSFRDFGLGKNLLQEKMLIEVQDMFAKFDANLGKEQNLPVVLYNAAANVINQLIFGYRFDKEREGELKKLKALMEFQETAFTTFKVYVQFFAPAIGKHLPGKSVEDLLAEFT---------VDFYKFFNHQIEEHRSKIDFDSEESLDYAEAYLKEQRK-QEAQGEFELFSTKQLSNTCFDLWFAGLSTTHITLTWIVGHVLNYPDVQRKLHKELDEVIGSDRLITNDDKNNLPYLNAVINE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16671])

HSP 1 Score: 128.642 bits (322), Expect = 1.370e-32
Identity = 94/351 (26.78%), Postives = 168/351 (47.86%), Query Frame = 2
Query:  191 FKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYY--LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDS-GVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP-----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNS-EGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +K+  LP G    PT   LP +G    +    P Y    R  K+ G +++  +G     ++ SYD +K+  V DG  +  ++   F         G++ ++G +W T R F L+ LRDFG GK    E +  E  +   + D  + +  +   ++     N+I++ I   R+   +      M  L+E   ++  T K    ++    P   +        QL   W++      +F   IE HR+ +DF+S E +D  + +L  Q + Q+  G  E F+N Q      +L++AG  T++TT+ W+  ++  +PD+ +K++ E  +++G +RL TM DK +L Y  AV++E
Sbjct:   20 WKRRSLPPG----PTP--LPFMGNTLAMLLEKPGYECFRRWTKQFGGVYTFWMGNIPYVIIGSYDLLKETFVRDGDTYKDKYPQPFNEKLRGGMYGIVESNGHMWSTHRRFALSTLRDFGLGKDLMQEKILIEVEDIFRKYDAQLGKEQDIQVVLNNAIANVINQTIFGYRFDETNQEEFERMRHLVEYQEKQFATVK---VYVEAFVPTIGKFLPGKSLDQLLDDWRN--SFYTFFDTQIENHRKKIDFDSEESQDYAEAYLKEQKK-QEALGEFELFSNTQFSNTCLDLWLAGVSTTNTTVNWTICYVLNHPDVLQKMNEEFDQVVGSDRLVTMGDKNNLPYFNAVLNE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-33C9 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:O16482])

HSP 1 Score: 127.872 bits (320), Expect = 2.359e-32
Identity = 90/334 (26.95%), Postives = 160/334 (47.90%), Query Frame = 2
Query:  245 LPLIGVIHKIKPTLPYY--LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDS-GVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRY--TRDD---PMIQLIEESGRKVLTNKDKAQFIL-LMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFN-SEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            LPLIG +  ++   P Y    R   + G I++  LG R   +++SY+++K+  + DG  ++ +    F   F   S GV+ T+G  W   R F ++  RDFG GK R  + +  E  +     D  + + ++ + +      N+I++ +   R+  TR D    +      +  +  +   + QF L  M  I    T+  +F +    +       E+F   IE H++ +DF   E  D ++ FL  Q + ++ +G+ E+F+  Q+     +L+ A   T+S T+TW   +   Y D Q+K+H E+  +IG ER     DK +L YT A ++E
Sbjct:   32 LPLIGNLLSLRNPAPGYKAFARWTAKYGDIYTFWLGTRPYILVSSYEALKETFIKDGETYADKKPMAFQESFRGGSYGVVETNGPFWREHRRFAIHQFRDFGLGKDRMEQRIMLEVEDIFNNCDKTIGEGVDLTDIFDRAVGNVINQMLFGYRFDETRADEFRTIRAFFNFNSGEFASFSMRVQFFLPWMGYIMPGPTILDRFKKYQKGF------TEFFGTQIENHKKEIDFELEENSDYVEAFLKEQRK-REASGDFESFSTKQLSNMCLDLWFAALMTTSNTMTWCFAYTLNYLDAQQKLHEELDRVIGSERHINTADKPNLPYTNAYINE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A5 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27531])

HSP 1 Score: 126.331 bits (316), Expect = 7.965e-32
Identity = 92/317 (29.02%), Postives = 154/317 (48.58%), Query Frame = 2
Query:  293 YLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDG---YNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDP--MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAK--FMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +L +L K  GP F++   +  V VL  Y+ IK+A V  G    N + R     F     ++GV+F+ G  W+ QR   L +LRDFG G++   E V       + +L+  +S   N     PI     N+I+  +    Y  +D     + ++   R +   +  A  ++  FP      +     +  + ++ KS    Q++  E +    +  D  SE E+ +  ++  Q   Q  N N++  N   +  +  + ++AG ET+S +L W   FM +YP++Q KV NEI E IG  RLP+M+DK+++ YTQAV+ E
Sbjct:   50 HLDKLSKTYGPCFTVWTPLPAV-VLTDYEHIKEAFVTQGDAFVNRAQRLPEILFQPH-PNTGVVFSSGDNWKIQRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLEH-ISDKKNVDMYWPIQLCVGNVINESLFGYHYKYEDAGRFEKFVKVVDRHLKIAQGNASLLVSAFPWLRHLPVIGNLGYHSIKNNIKSY---QQFIEEEVTSQLKNYDGESEPENFVHAYM--QQMKQTGNPNLDMTN---LCASVLDFWLAGMETASNSLRWHLAFMMKYPEVQDKVRNEIFENIGTARLPSMSDKQNMPYTQAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Match: cyp-14A2 (CYtochrome P450 family [Source:UniProtKB/TrEMBL;Acc:Q27505])

HSP 1 Score: 126.331 bits (316), Expect = 9.322e-32
Identity = 99/350 (28.29%), Postives = 168/350 (48.00%), Query Frame = 2
Query:  191 FKKDRLPNGQREVPTAYGLPLIGVIHKIKP-TLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNF---SGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NII--SRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +K  + P G       + LP IG I +I    +  YL  L K  GP F++   +  + VL  Y+ +K+A V  G  F   + R   T     + ++GVLF++G  W  QR   L +LRDFG G++   E V       + +L+ +  +  N     PI     N+I  S F  + +Y         ++   + + T + K  F++  FP  +   +  + +      K++   QE+  + +    +  D  SE E+ +  ++  Q   Q  N N++  N   +  +  + ++AG ET+S +L W   FM +YP+IQ KV  EI++ +G  RLP+M+DK ++ YTQAV+ E
Sbjct:   21 WKVSKYPKG------PFPLPFIGNILQIPSENIQEYLDDLSKTYGPCFTLWTPLPAI-VLTDYEHVKEAFVTQGDAFIYRADRPPETLLQPHL-NTGVLFSNGDNWRFQRRTALKILRDFGLGRNLMEEQVMRSVHEMLAQLERIADKK-NVDMFWPIQLCVGNVINESLFSYHYKYEDSKKFETFVKVLDKHLKTVQGKTIFLMSAFPWLKHFPVIGE-LGYHRIKKNIQSYQEFINDEVTSQIKHYDGESEPENFVHAYM--QQMKQSGNPNLDMNN---LCASVIDFWLAGMETTSNSLRWHLAFMMKYPEIQDKVRKEILDNVGTARLPSMSDKPNMPYTQAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074610)

HSP 1 Score: 135.961 bits (341), Expect = 5.662e-35
Identity = 97/342 (28.36%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGF-----GKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQ----LIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNW----QMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  +GLP+IG +  +        + L K+ G +FS +LG +   V++ Y  I++    +   F+GR  T F    ++  G++ + GKLW+ QR F+ + LR FG      GK +  + +  E   FI  L     Q ++ S +I +   N+I   + + R++ DDP  +    LIEE G ++        +I  M      ST   K  Q  +       +Q ++ ++I++H+ + D N+   DL+D +L    + +    + E F+      Q+++   +LF AG ET  TTL W  +FM R P   ++V +E+ +++GR RLPT+ D + L  T++ + E
Sbjct:   55 PGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQT-LNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEE-GMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAE------MQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILE 385          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp18a1 (gene:FBgn0010383 transcript:FBtr0074609)

HSP 1 Score: 135.961 bits (341), Expect = 5.662e-35
Identity = 97/342 (28.36%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGF-----GKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQ----LIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNW----QMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  +GLP+IG +  +        + L K+ G +FS +LG +   V++ Y  I++    +   F+GR  T F    ++  G++ + GKLW+ QR F+ + LR FG      GK +  + +  E   FI  L     Q ++ S +I +   N+I   + + R++ DDP  +    LIEE G ++        +I  M      ST   K  Q  +       +Q ++ ++I++H+ + D N+   DL+D +L    + +    + E F+      Q+++   +LF AG ET  TTL W  +FM R P   ++V +E+ +++GR RLPT+ D + L  T++ + E
Sbjct:   55 PGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQT-LNGYGIINSTGKLWKDQRRFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRRFNFLIEE-GMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAE------MQRFYQDVIDDHKRSFDPNNI-RDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILE 385          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0343812)

HSP 1 Score: 117.472 bits (293), Expect = 1.667e-28
Identity = 82/306 (26.80%), Postives = 153/306 (50.00%), Query Frame = 2
Query:  329 FSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFS--DFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQT------LNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFE-QSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMN-DKRSLNYTQAVMDE 1216
            + +K+G  KV +  + D+I + + ++  +  GR    F+    F    GVL TDG++W  QR FIL  L++FGF +S  +++V  E +  +++L   V ++      +    L  +Y +N +   ++ RRY    P I  + E+  ++  N D    +   FP+    +  F+ +     S +SL     + ++ IE HR       E  DL+D +L  Q +     G    F++  ++    ++F+AGSET++ +L +  + +   P+IQ++   EI E++G ER+P  + D+  L Y +A+  E
Sbjct:   71 YGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLY---TFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKG---MFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLE 368          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp303a1 (gene:FBgn0001992 transcript:FBtr0080828)

HSP 1 Score: 117.472 bits (293), Expect = 1.667e-28
Identity = 82/306 (26.80%), Postives = 153/306 (50.00%), Query Frame = 2
Query:  329 FSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFS--DFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQT------LNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFE-QSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMN-DKRSLNYTQAVMDE 1216
            + +K+G  KV +  + D+I + + ++  +  GR    F+    F    GVL TDG++W  QR FIL  L++FGF +S  +++V  E +  +++L   V ++      +    L  +Y +N +   ++ RRY    P I  + E+  ++  N D    +   FP+    +  F+ +     S +SL     + ++ IE HR       E  DL+D +L  Q +     G    F++  ++    ++F+AGSET++ +L +  + +   P+IQ++   EI E++G ER+P  + D+  L Y +A+  E
Sbjct:   71 YGLKIGKDKVVIAYTNDAISEMMTNE--DIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLKNFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRRYEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGYNGFVESHRSLY---TFMSKEIELHRLTYKNYDEPRDLMDSYLRAQDEGNDEKG---MFSDQSLLAICLDMFLAGSETTNKSLGFCFMHLVLQPEIQERAFQEIKEVVGLERIPEWSRDRTKLPYCEAITLE 368          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Match: Cyp304a1 (gene:FBgn0038095 transcript:FBtr0082691)

HSP 1 Score: 89.7373 bits (221), Expect = 4.362e-19
Identity = 77/314 (24.52%), Postives = 152/314 (48.41%), Query Frame = 2
Query:  326 IFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHD-SGVLFTDGKLWETQRSFILNVLRDFGFGKS-RSVEMVQEECSNFIEEL---------DTLVSQTLNFSTLIPI----YSMNIISRFITNRRYTRDDPMIQLIE--ESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            I  + +G   V V++S D +++ L +  ++   +       D   D  G+ F DG LW+ QR FIL  LRDFGFG+    +E+V +E  N + +L         +  + ++  +  L+P+    +S N     + N   +R++ M +L++  + G +   N D    +L + P      ++ ++       +S + V+++FA+ ++++   LD   EG   ++R  ++ +  + R G    FN  Q+I    +            L+    ++  YP + ++V NEI E++G  RLP + D+++L +T+A + E
Sbjct:   68 IIGLHVGPFPVAVVHSADGVREILNNQVFDGRPQLFVAAMRDPGQDVRGIFFQDGPLWKEQRRFILRYLRDFGFGRRFDQLELVIQEQLNDMLDLIRNGPKYPHEHEMVKSGGYRVLLPLLFNPFSANAHFYIVYNECLSREE-MGKLVKLCQMGIQFQRNADDYGKMLSIIPWIRH--IWPEWSGYNKLNESNLFVRQFFADFVDKY---LDSYEEG---VERNFMDVYIAEMRRGPGYGFNRDQLIMGLVDFSFPAFTAIGVQLSLLVQYLMLYPAVLRRVQNEIDEVVGCGRLPNLEDRKNLPFTEATIRE 372          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k22 (cytochrome P450, family 2, subfamily K, polypeptide 22 [Source:ZFIN;Acc:ZDB-GENE-040426-822])

HSP 1 Score: 155.992 bits (393), Expect = 3.537e-42
Identity = 96/311 (30.87%), Postives = 166/311 (53.38%), Query Frame = 2
Query:  296 LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIP-VQEYF---AEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            L +L K+ GP++++ +G R V VL+ Y ++K+ALV+    F  R  +  F DF    G++F++G+ W+  R F L+ LRDFG GK RS E++ EE     EE++    +       + +   N+I+  + + R+  + P         R ++   + A+  L+  P  +   +F       ++ K ++  VQE F    EI+   ++ L+  S    + D+FLI Q + ++       +N+   +   + LF AG +T+ TTL W  L +++YP+IQ KVH+EI  +IG ER P  +D+++L YT AV+ E
Sbjct:   65 LWKLSKQYGPVYTVHMGPRTVVVLSGYKAVKEALVNLSEEFGERDISPIFQDFNEGYGIVFSNGENWKEMRRFALSNLRDFGMGKKRSEELITEEIKYLKEEIERFGGKPFETKLPLAMAISNVIALIVYSIRFEYNSPKFH------RAIVRANENAK--LVGSPSVQLYNMFPWLRLFVANQKRVVDNVQESFKQIGEIVNGLKKTLNPQSP-RGIADKFLIQQQKDKESGKTDSLYNSNNFLTTINNLFGAGIDTTVTTLRWGLLLIAKYPEIQAKVHDEIDSVIG-ERQPVPDDRKNLPYTDAVIHE 365          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2n13 (cytochrome P450, family 2, subfamily N, polypeptide 13 [Source:ZFIN;Acc:ZDB-GENE-041001-158])

HSP 1 Score: 151.754 bits (382), Expect = 9.612e-41
Identity = 103/341 (30.21%), Postives = 175/341 (51.32%), Query Frame = 2
Query:  212 NGQREVPTAYGLPLIGVIHKIKPTLPY-YLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSD-FIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDD----PMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            N  +  P+ + +PL+G I  +    P+ YL +LG     IFS++LG  K   +  Y  +K+ALV    NF  R  +   +  +  ++G+ F++G++W+ QR F L+ LR+FG GK      + EE    +EE+D       + + L+     NII + +  +R+   D     M++ I +S +  L      Q I   FP   +  L      + S++  L   + +  E+I +H+  LD  SE  D ID FLI   +  + +  +  F    ++    +LF+AG+E++S TL W  +++  YPD+Q+KV  EI  +IG  R P++ DK ++ YT+AV+ E
Sbjct:   33 NPPKYPPSPFSVPLLGNIFNVDSKEPHLYLTKLGHAYNNIFSLRLGSDKTVFITGYKMVKEALVTQAENFVDRPNSPVLARVYSGNAGLFFSNGEMWKKQRRFALSTLRNFGLGKKTMELAICEESRFLLEEIDEQKGAAFDPTILLYNAVSNIICQMVFGQRFDYADHQFKTMLKYISKSIQ--LEGSVWGQ-IYEAFPAIMKH-LPGPHNDIFSNYDLL---KSFVHEVIVKHKAKLD-PSEPRDYIDTFLIEMKE--KPHERVNGFEEPNLVACVLDLFLAGTESTSNTLCWGLIYLIMYPDVQEKVQEEIDRVIGNSREPSIADKPNMPYTEAVIHE 363          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2k16 (cytochrome P450, family 2, subfamily K, polypeptide16 [Source:ZFIN;Acc:ZDB-GENE-041010-37])

HSP 1 Score: 151.369 bits (381), Expect = 1.666e-40
Identity = 98/318 (30.82%), Postives = 155/318 (48.74%), Query Frame = 2
Query:  275 KPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQ-LIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDL---IDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            KP L   L  + K+ GP+F +  G +KV VL  Y ++K+ALV+    F  R     F DF    G++F +G+ W   R F L  LRDFG GK +  E + EE  +  EE +    +    + L+   + ++IS  +  RR+   DP ++ +++ +   V  +   +  +  MFP             L  +W+ L+       E I E    L      +DL   +D FL+ +   +        F+   +I     LF+AG++T+STTL WS L M++YP IQ +V  EI ++IG  R P   D+++L YT AV+ E
Sbjct:   59 KPHLS--LCEMAKQFGPVFKVYFGPKKVVVLAGYKAVKQALVNYAEAFGDREIMPLFHDFTKGHGIIFANGESWREMRRFALTNLRDFGMGKKKIEEKIIEETCHLREEFEKFEGKPFETAQLMNYAASSVISSIVYGRRFEYTDPQLRTMVDRANESVRLSGSASVQLYNMFPFLG---------PLLKNWRQLMKNLHLDIEEISELVNGLHQTLNHQDLRGFVDSFLVRKQYAEDSGEKDSHFHEQNLIYTVGNLFVAGTDTTSTTLRWSLLLMAKYPHIQDRVQEEIDQVIG-GRQPVSEDRKNLPYTDAVIHE 364          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2aa11 (cytochrome P450, family 2, subfamily AA, polypeptide 11 [Source:ZFIN;Acc:ZDB-GENE-110114-3])

HSP 1 Score: 148.673 bits (374), Expect = 2.511e-40
Identity = 106/346 (30.64%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  197 KDRLPNGQREVPTAYGLPLIGVI-HKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFT-DGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K R P G    PT   LP +G I H +K   P   +R   + G + ++ LG +   +LN+   +K+A V +G +FSGR      +      G++   DG  W  QR F L+ LR+FG GK    E V EE    I EL  +  +  N    I   + NII   +   R+  D+     ++++I+E+    L      Q + L+  I        K  Q    +KS I       E ++ HRE LD +S   D ID +L+   +  Q++    TF+   M+ +  +LF AG++T++TT+ W  L++++ PD+Q++ H+EIV+++G +  P+M+D+  L YT A + E
Sbjct:   36 KGRYPPG----PTP--LPFVGTIPHFLKN--PMGFIRSLSQYGEMTTVYLGRKPAIILNALQLMKEAFVQNGSSFSGRPPVPVLTWVNQGYGIIMAMDGHSWRQQRRFALHTLRNFGLGKKSVEERVTEESGYLISELLRVEGKPFNPQHAIHNAAANIICSIVFGDRFDYDNKSFTYLLEIIKENLD--LAGSFAGQMVNLVPIIKNLPGPHQKIYQNGEEFKSFI------RESVKAHRETLDPDSP-RDFIDAYLLEMEK--QKSTQDSTFHEDNMVMSVGDLFFAGTDTTATTIRWGLLYLTQNPDVQERCHDEIVQVLGFDCFPSMDDRDQLPYTLATVHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Match: cyp2aa11 (cytochrome P450, family 2, subfamily AA, polypeptide 11 [Source:ZFIN;Acc:ZDB-GENE-110114-3])

HSP 1 Score: 149.058 bits (375), Expect = 1.157e-39
Identity = 106/346 (30.64%), Postives = 173/346 (50.00%), Query Frame = 2
Query:  197 KDRLPNGQREVPTAYGLPLIGVI-HKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFT-DGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K R P G    PT   LP +G I H +K   P   +R   + G + ++ LG +   +LN+   +K+A V +G +FSGR      +      G++   DG  W  QR F L+ LR+FG GK    E V EE    I EL  +  +  N    I   + NII   +   R+  D+     ++++I+E+    L      Q + L+  I        K  Q    +KS I       E ++ HRE LD +S   D ID +L+   +  Q++    TF+   M+ +  +LF AG++T++TT+ W  L++++ PD+Q++ H+EIV+++G +  P+M+D+  L YT A + E
Sbjct:   36 KGRYPPG----PTP--LPFVGTIPHFLKN--PMGFIRSLSQYGEMTTVYLGRKPAIILNALQLMKEAFVQNGSSFSGRPPVPVLTWVNQGYGIIMAMDGHSWRQQRRFALHTLRNFGLGKKSVEERVTEESGYLISELLRVEGKPFNPQHAIHNAAANIICSIVFGDRFDYDNKSFTYLLEIIKEN--LDLAGSFAGQMVNLVPIIKNLPGPHQKIYQNGEEFKSFI------RESVKAHRETLDPDSP-RDFIDAYLLEMEK--QKSTQDSTFHEDNMVMSVGDLFFAGTDTTATTIRWGLLYLTQNPDVQERCHDEIVQVLGFDCFPSMDDRDQLPYTLATVHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 182.185 bits (461), Expect = 7.707e-52
Identity = 112/334 (33.53%), Postives = 179/334 (53.59%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP+IG IH I    PY   L L K+ GPIFS+++G +K+ VL  Y+++K ALV+    FS R     F D + + GV+F+ G+ W+  R F L+ LRDFG G+    + + EEC   +E+  +   +  + + ++     NII   +   R+   DP    ++ LI E+ R  LT   KA    +++ +F     +      T   K+      +  E   ++R+ LD N +  +L+D FL+ Q   Q++NGN   F++  +    S LF+AG ET+ST++ W  L M ++P+IQK V NEI ++IG+ R P    ++S+ YT AV+ E
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYLELWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFLDAVKEYGVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVR--LTGSPKA----MLYNVFPSVMRWLPGNHQTVG-KNAAEYHRFIRETFTKYRDKLDINDQ-RNLVDAFLVKQ---QEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 182.185 bits (461), Expect = 7.707e-52
Identity = 112/334 (33.53%), Postives = 179/334 (53.59%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP+IG IH I    PY   L L K+ GPIFS+++G +K+ VL  Y+++K ALV+    FS R     F D + + GV+F+ G+ W+  R F L+ LRDFG G+    + + EEC   +E+  +   +  + + ++     NII   +   R+   DP    ++ LI E+ R  LT   KA    +++ +F     +      T   K+      +  E   ++R+ LD N +  +L+D FL+ Q   Q++NGN   F++  +    S LF+AG ET+ST++ W  L M ++P+IQK V NEI ++IG+ R P    ++S+ YT AV+ E
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYLELWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFLDAVKEYGVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVR--LTGSPKA----MLYNVFPSVMRWLPGNHQTVG-KNAAEYHRFIRETFTKYRDKLDINDQ-RNLVDAFLVKQ---QEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 181.03 bits (458), Expect = 2.006e-51
Identity = 111/334 (33.23%), Postives = 178/334 (53.29%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP+IG IH I    PY   L L K+ GPIF +++G +K+ VL  Y+++K ALV+    FS R     F D + + GV+F+ G+ W+  R F L+ LRDFG G+    + + EEC   +E+  +   +  + + ++     NII   +   R+   DP    ++ LI E+ R  LT   KA    +++ +F     +      T   K+      +  E   ++R+ LD N +  +L+D FL+ Q   Q++NGN   F++  +    S LF+AG ET+ST++ W  L M ++P+IQK V NEI ++IG+ R P    ++S+ YT AV+ E
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVR--LTGSPKA----MLYNVFPSVMRWLPGNHQTVG-KNAAEYHRFIRETFTKYRDKLDINDQ-RNLVDAFLVKQ---QEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: slc35b2 (solute carrier family 35 member B2 [Source:Xenbase;Acc:XB-GENE-1009913])

HSP 1 Score: 180.259 bits (456), Expect = 4.065e-51
Identity = 110/334 (32.93%), Postives = 178/334 (53.29%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP+IG IH I    PY   L L K+ GPIF +++G +K+ VL  Y+++K ALV+    FS R     F D + + G++F+ G+ W+  R F L+ LRDFG G+    + + EEC   +E+  +   +  + + ++     NII   +   R+   DP    ++ LI E+ R  LT   KA    +++ +F     +      T   K+      +  E   ++R+ LD N +  +L+D FL+ Q   Q++NGN   F++  +    S LF+AG ET+ST++ W  L M ++P+IQK V NEI ++IG+ R P    ++S+ YT AV+ E
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYLELWKKYGPIFRVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVVPIFLDVVKEYGIIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVR--LTGSPKA----MLYNVFPSVMRWLPGNHQTVG-KNAAEYHRFIRETFTKYRDKLDINDQ-RNLVDAFLVKQ---QEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Match: cyp2f1 (cytochrome P450 2K1 [Source:NCBI gene;Acc:100490476])

HSP 1 Score: 178.333 bits (451), Expect = 7.141e-51
Identity = 108/331 (32.63%), Postives = 177/331 (53.47%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LPLIG +H +    P+   + L ++ GP+FS++LG +KV VL   D++K ALV+    FSGR K   F       GV+F DG+ W+  R F L+ LRDFG GK    + + EE    +E   +   +  + + ++     NII   + N R+   DP +++LI      +      A+ I+L++  +     +       S  ++++ +  +  E   +HR+ LD N +  DLID FL+ Q   +++  + + FN+  +    ++LF AG ET+STTL W  LF+ +YPDIQKKV +EI ++IG  + P +  ++ + YT AV+ E
Sbjct:   32 PGPKPLPLIGNLHIMNMKKPFLTFMELAEKYGPVFSVQLGTKKVVVLCGTDAVKDALVNHADEFSGRPKIPMFDQTSKGHGVIFADGENWKVMRRFTLSTLRDFGMGKKTLEDRIGEESGCLVETFKSHEGKPFDNTMIMNAAVANIIVHILLNHRFDYQDPTLLKLINIVSENISI---AAKPIVLLYNAYPSIMEWVPGTH-KSVAENMLKLYNFLRETFTQHRDQLDVNDQ-RDLIDVFLVKQQ--EEKPSSTKFFNDQNLTVLLADLFGAGMETTSTTLRWGLLFIMKYPDIQKKVQDEIDKVIGSAQ-PRLEHRKKMPYTDAVIHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2c66 (cytochrome P450, family 2, subfamily c, polypeptide 66 [Source:MGI Symbol;Acc:MGI:1917138])

HSP 1 Score: 160.614 bits (405), Expect = 6.102e-44
Identity = 111/344 (32.27%), Postives = 169/344 (49.13%), Query Frame = 2
Query:  212 NGQRE--VPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQ-LTSSWKSLIP----VQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            N QR    P    LP+IG I ++    +   L    K  GP+F++ LG +   VL+ Y ++K+AL+D G  F+GR        FI   GV+F+ G+ W+  R F L  LR+FG GK    + VQEE    ++EL        + + ++     N+I   +   R+  +D   +  I+     V          +L  P  +    F   +  L    + L+      + YF   + +H+E+LD N+   D ID FLI   Q ++ N   E F    +I  AS+LF AG+ET+STTL +S L + +YP++  KV  EI  +IGR R P M D+ S+ YT AV+ E
Sbjct:   23 NSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRNFSKVYGPVFTLYLGKKPAVVLHGYKAVKEALIDHGEEFAGRGTFPVADKFIRRCGVVFSSGRTWKEMRRFSLMTLRNFGMGKRSIEDRVQEEARCLVDELRKTKGVPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFIDILNENVE---------ILSSPWIQVCNNFPAIIDYLPGRHRKLLKNFDFAKHYFLAKVIQHKESLDINNP-RDFIDCFLIKMEQ-EKHNPKTE-FTCENLIFTASDLFAAGTETTSTTLRYSLLLLLKYPEVTAKVQAEIDCVIGRHRSPCMQDRHSMPYTDAVLHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2e1 (cytochrome P450, family 2, subfamily e, polypeptide 1 [Source:MGI Symbol;Acc:MGI:88607])

HSP 1 Score: 159.844 bits (403), Expect = 1.027e-43
Identity = 96/317 (30.28%), Postives = 168/317 (53.00%), Query Frame = 2
Query:  284 LPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSS-----WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +P  L +L K  GP+F++ LG R++ VL+ Y ++K+ L++    FSGR     F ++  + G++F +G  W+  R F L++LRD+G GK  +   +Q E    +EEL     Q  + + LI     N+I+  + N+R+  DD   ++L+       L N++   F LL  P  +    F+ ++Q          K++  +++Y     +EH ++LD N    D+ D  LI   + +     + T  N  +    ++LF AG+ET+STTL +  L + +YP+I++K+H EI  +IG  R P + D+ ++ Y  AV+ E
Sbjct:   53 IPKSLTKLAKRFGPVFTLHLGQRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVFQEY-KNKGIIFNNGPTWKDVRRFSLSILRDWGMGKQGNEARIQREAHFLVEELKKTKGQPFDPTFLIGCAPCNVIADILFNKRFDYDDKKCLELMS------LFNEN---FYLLSTPWIQAYNYFSDYLQYLPGSHRKVMKNVSEIRQYTLGKAKEHLKSLDINCP-RDVTDCLLIEMEKEKHSQEPMYTMENISV--TLADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRAPAVRDRMNMPYMDAVVHE 356          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2c65 (cytochrome P450, family 2, subfamily c, polypeptide 65 [Source:MGI Symbol;Acc:MGI:1919553])

HSP 1 Score: 158.303 bits (399), Expect = 3.967e-43
Identity = 107/339 (31.56%), Postives = 169/339 (49.85%), Query Frame = 2
Query:  212 NGQRE--VPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            N QR    P    LP+IG I ++    +   L    K  GP+F++ LG     VL+ Y+++K+A  D G  F+GR     F  F  + GV+F+ G+ W+  R F L  LR+FG G+    + +QEE    ++EL     +  + + ++     N+I   +   R+  +D   +  ++     V         I   FP      L  +  +L    K+    + YF   +++H+E+LD N+   D ID FLI   Q ++ N   E F    ++  AS+LF AG+ET+STTL +S L + +YP++  KV  EI  +IGR R P M D+ S+ YT AV+ E
Sbjct:   23 NSQRRNLPPGPTPLPIIGNILQLDLKDISKSLRNFSKVYGPVFTLYLGRNPAVVLHGYEAVKEAFTDHGEEFAGRGVFPVFDKFKKNCGVVFSSGRTWKEMRRFSLMTLRNFGMGRRSIEDRIQEEARCLVDELRKTKGEPCDPTFILGCAPCNVICSIVFQNRFDYKDQEFLTFLDILNENVEILSSPWIQICNNFPAV-IDYLPGRHRKL---HKNFAFAEHYFLSKVKQHQESLDINNP-RDFIDCFLIKMEQ-EKHNPKTE-FTCENLVFTASDLFAAGTETTSTTLRYSLLLLLKYPEVTAKVQEEIDCVIGRHRSPCMQDRHSMPYTDAVLHE 354          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2f2 (cytochrome P450, family 2, subfamily f, polypeptide 2 [Source:MGI Symbol;Acc:MGI:88608])

HSP 1 Score: 157.918 bits (398), Expect = 5.478e-43
Identity = 105/350 (30.00%), Postives = 174/350 (49.71%), Query Frame = 2
Query:  197 KDRLPNGQREVPTAYGLPLIGVIHKIKPT-LPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDD----PMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSS-----WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K +LP G +       LP++G + +++   L   L +L KE G +F++ LG R V VL+ Y ++K+ALVD G  FSGR     F +F   +G+ F+DG+ W+  R F + +LR+FG GK    E + EE S  +E L  +  +  +   ++     NII   +   R+  DD     +I  I ++            F ++  P  E   +F   +          +++   +++  A  + EH+++LD NS   D ID FL      Q++   +  FN   ++     L   G+ET  TTL  + L + +YP +Q +V  EI  ++GR R+PT+ D+ S+ YT AV+ E
Sbjct:   27 KGQLPPGPKP------LPILGNLLQLRSQDLLTSLTKLSKEYGSVFTVYLGSRPVIVLSGYQTVKEALVDKGEEFSGRGAYPVFFNFTRGNGIAFSDGERWKILRRFSVQILRNFGMGKRSIEERILEEGSFLLEVLRKMEGKPFDPVFILSRSVSNIICSVVFGSRFDYDDERLLTIIHFINDN------------FKIMSSPWGEMYNIFPSVLDWIPGPHKRLFRNFGGMKDLIARSVREHQDSLDPNSP-RDFIDCFLTK--MAQEKQDPLSHFNMDTLLMTTHNLLFGGTETVGTTLRHAFLILMKYPKVQARVQEEIDRVVGRSRMPTLEDRTSMPYTDAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Match: Cyp2b19 (cytochrome P450, family 2, subfamily b, polypeptide 19 [Source:MGI Symbol;Acc:MGI:107303])

HSP 1 Score: 156.762 bits (395), Expect = 1.514e-42
Identity = 105/346 (30.35%), Postives = 171/346 (49.42%), Query Frame = 2
Query:  230 PTAYGLPLIG-VIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFE----QSTLFAKFMQLTSSW------------KSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP +G ++   +  L    ++L ++ G +F++ LG R V +L   D+I++ALV+    FSGR         +   GV+F+ G+ W+T R F L  +RDFG GK    E ++EE    +EEL       LN +        NII   +   R+   D                    QF+ L+  I++     S+L ++  +L S+             K+L  + +Y    +E+HR  LD  S   D ID +L+   + ++ N + E F++  ++ +   LF AG+ET+STTL +S L M +YP + +KV  EI ++IG  RLPT++D+  + YT AV+ E
Sbjct:   33 PGPRPLPFLGNLLQMDRRGLLSSFIQLQEKYGDVFTVHLGPRPVVMLCGTDTIREALVNQAEAFSGRGTVAVLDPIVQGYGVIFSSGERWKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLNPTFYFQCIVANIICSIVFGERFDYKD-------------------HQFLHLLNLIYQTFSLMSSLSSQVFELFSAILKYFPGAHRQISKNLQEILDYIGHSVEKHRATLD-PSAPRDFIDTYLLRMEK-EKSNHHTE-FHHQNLVISVLSLFFAGTETTSTTLRYSFLIMLKYPHVAEKVQKEIDQVIGSHRLPTLDDRTKMPYTDAVIHE 356          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P24460|CP2BB_CANLF (Cytochrome P450 2B11 OS=Canis lupus familiaris OX=9615 GN=CYP2B11 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 8.704e-46
Identity = 112/347 (32.28%), Postives = 178/347 (51.30%), Query Frame = 2
Query:  221 REVPTAYG--------LPLIG-VIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEEL----DTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSS--WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            R  P AYG        LP++G  +   +  L    LRL ++ G +F++ LG R+  +L   D+I++ALVD+   FSGR K           GV+F +G+ W+T R F L  +RDFG GK    E +QEE    +EEL      L   T  F ++    + NII   +  +R+   DP  + +       ++    + F   MF +F     F K+   T    + +L  ++ + A ++E+HRE LD  S   D ID +LI   + +    +   F++  +I  A  LF AG+ET+STTL +  L M +YP I ++++ EI ++IG  RLP+++D+  + YT AV+ E
Sbjct:   21 RGHPKAYGHLPPGPRPLPILGNFLQMDRKGLLKSFLRLQEKYGDVFTVYLGPRRTVMLCGIDAIREALVDNAEAFSGRGKIAVVEPVFQGYGVVFANGERWKTLRRFSLATMRDFGMGKRSVEERIQEEAQCLVEELRKTEGVLQDPTFFFHSM----TANIICSIVFGKRFGYKDP--EFLRLMNLFYVSFALISSFSSQMFELFHS---FLKYFPGTHRQVYNNLQEIKAFIARMVEKHRETLD-PSAPRDFIDAYLIRMDKEKAEPSS--EFHHRNLIDTALSLFFAGTETTSTTLRYGFLLMLKYPHIAERIYKEIDQVIGPHRLPSLDDRAKMPYTDAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|Q29510|CP2CU_RABIT (Cytochrome P450 2C30 OS=Oryctolagus cuniculus OX=9986 GN=CYP2C30 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 7.139e-45
Identity = 106/348 (30.46%), Postives = 172/348 (49.43%), Query Frame = 2
Query:  188 TFKKDRLPNGQREVPTAYGLPLIG-VIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPV----QEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            ++ + +LP G    PTA+  PL+G V+   +  +   +  L KE GP+F++  G +   VL+ Y+++K+ALVD G  FSGR     F  +   +G+  + G+LW+  R F L VLR+ G GK    + +QEE S  ++ L    +   + S+L+     N+I   I   R+  +D   Q         L         L   P  +    F     L  S   L  V     ++F+E I EH+E+LD N+   D ID  LI     ++++     F    ++    ++F AGS+T+S+T+ +  L + ++P+I  KV  EI  +IGR+R P M D+  + YT AV+ E
Sbjct:   23 SYARRKLPPG----PTAF--PLVGNVLQLDRKNISKSISMLAKEYGPVFTVYFGTKPSVVLHGYEAVKEALVDHGEEFSGRVTVPVFDRYAQGAGLFASQGELWKETRRFTLTVLRNMGMGKKTIEDRIQEEASCLVKALKETNASPCDPSSLLFCVPCNVICSIIFQNRFEYNDQTFQ--------TLVKHFLDSIRLFNTPWMQLYNTFPILHYLPGSHHELFKVFNDQMKFFSEKIREHQESLDHNNP-RDFIDYLLIKME--KEKHNKQSQFTMHHLLVTIWDVFDAGSQTTSSTMQFGLLLLMKHPEIAAKVQEEIERVIGRDRSPCMQDRSCMPYTDAVIHE 353          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P20678|CP2H2_CHICK (Cytochrome P450 2H2 OS=Gallus gallus OX=9031 GN=CYP2H2 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.261e-44
Identity = 105/312 (33.65%), Postives = 162/312 (51.92%), Query Frame = 2
Query:  305 LGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIP----VQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            L K+ GPIF+I LG +KV VL  YD +K+AL+D+G  FSGR     F      +G++ ++G+ W   R F L  LRDFG GK    E +QEE    +E +     +  N +  +     NII   +   R+  +D     +I++++E+ R    N+ + Q       I +          L    K+LI     V ++  EII  H+E+ D  S   D ID F IN+ Q ++ N     F    + R   +LF+AG+ T+STTL +  L + ++P+I++K+H EI  ++GR+R P M D+  L YT AV+ E
Sbjct:   60 LSKKYGPIFTIHLGPKKVVVLYGYDVVKEALIDNGEAFSGRGNLPLFEKVFKGTGIVTSNGESWRQMRRFALTTLRDFGMGKKSIEERIQEEARFLVERIRNTHEKPFNPTVFLMHAVSNIICSTVFGDRFDYEDKKFLDLIEMLDENER--YQNRIQTQLYNFFPTILD---------YLPGPHKTLIKSIETVDDFITEIIRAHQESFD-ASCPRDFIDAF-INKMQQEKENS---YFTVESLTRTTLDLFLAGTGTTSTTLRYGLLILLKHPEIEEKMHKEIDRVVGRDRSPCMADRSQLPYTDAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|O62671|CP241_CANLF (Cytochrome P450 2C41 OS=Canis lupus familiaris OX=9615 GN=CYP2C41 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.575e-44
Identity = 114/348 (32.76%), Postives = 173/348 (49.71%), Query Frame = 2
Query:  194 KKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSS-----WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIE-TFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +K +LP G    PT   LP IG I ++   +   L  L K  GP+F++  GM+   VL+ YD++K+ L+D G  FS R +           G++FT G  W+  R F L  LR+ G GKS     VQEE    +EEL    +   + + ++   S N+I   I   R+   D  +I  +E         K    F +L  P  +    F   +          +K+   ++ Y  E I+EH+E+ D N+   D ID FLI   Q ++ N  +E TF N + I  A++LF AG+ET+STTL +  L + ++P++  KV  EI  +IGR + P M D+  + YT AV+ E
Sbjct:   25 RKGKLPPG----PTP--LPFIGNILQLDKDINKSLSNLSKAYGPVFTLYFGMKPTVVLHGYDAVKETLIDLGEEFSARGRFPIAEKVSGGHGIIFTSGNRWKEMRRFALTTLRNLGMGKSDLESRVQEEACYLVEELRKTNALPCDPTFVLGCASCNVICSIIFQNRFDYTDQTLIGFLE---------KLNENFRILSSPWIQAYNSFPALLHYLPGSHNTIFKNFAFIKSYILEKIKEHQESFDVNNP-RDFIDYFLIKMEQ-EKHNQPLEFTFENLKTI--ATDLFGAGTETTSTTLRYGLLLLLKHPEVTVKVQEEIDRVIGRHQSPHMQDRSRMPYTNAVLHE 353          
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Match: sp|P05182|CP2E1_RAT (Cytochrome P450 2E1 OS=Rattus norvegicus OX=10116 GN=Cyp2e1 PE=1 SV=4)

HSP 1 Score: 163.31 bits (412), Expect = 3.874e-44
Identity = 99/339 (29.20%), Postives = 175/339 (51.62%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSS-----WKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  + LP++G I ++    +P    +L K  GP+F++ LG R++ VL+ Y ++K+ L++    FSGR     F ++  + G++F +G  W+  R F L++LRD+G GK  +   +Q E    +EEL     Q  + + LI     N+I+  + N+R+  +D     ++ L  E+            F LL  P  +    FA +++          K++  +++Y  E  +EH ++LD N    D+ D  LI   + +     + T  N  +    ++LF AG+ET+STTL +  L + +YP+I++K+H EI  +IG  R+P + D+  + Y  AV+ E
Sbjct:   34 PGPFPLPILGNIFQLDLKDIPKSFTKLAKRFGPVFTLHLGSRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVFQEY-KNKGIIFNNGPTWKDVRRFSLSILRDWGMGKQGNEARIQREAQFLVEELKKTKGQPFDPTFLIGCAPCNVIADILFNKRFDYNDKKCLRLMSLFNEN------------FYLLSTPWIQLYNNFADYLRYLPGSHRKIMKNVSEIKQYTLEKAKEHLQSLDINC-ARDVTDCLLIEMEKEKHSQEPMYTMENVSV--TLADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRVPAVRDRLDMPYMDAVVHE 356          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A4P8NYX5 (P450 2B-like protein OS=Dugesia japonica OX=6161 GN=p4502B PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 7.882e-136
Identity = 197/342 (57.60%), Postives = 263/342 (76.90%), Query Frame = 2
Query:  194 KKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKF-MQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K++ +P G +E P  YGLP++G+IHKIK  +  YLL+L K+ GPIF IKLGMR V +L++YD IKKALVDDG NFSGRW+    S   HDSG++F DG+ W TQRSF+L VLRDFG GKS+SV++VQ ECS  +EEL++L  + ++FS +IPIY+ NIIS+FI N+R+ R++P I  IE+   + +  KD  Q + +MFP  + S LF +  +  TS WK  + +Q YF E I+EH + +DFNSEGEDL+DRFLI Q+QL+Q+N ++ +FN+WQ+IR++ ELF AG ET+STTL WS LFMS++ DIQ+KVHNEI+EIIG+ERLPTMNDK+S+NYTQAVMDE
Sbjct:   22 KRNSIPKGLKETPIEYGLPILGIIHKIKEPMHNYLLKLSKKHGPIFRIKLGMRDVLILSNYDIIKKALVDDGQNFSGRWRMKLISLITHDSGIIFKDGQDWSTQRSFVLKVLRDFGLGKSKSVDLVQNECSFLLEELESLEGKIIDFSKIIPIYTANIISKFIMNKRFERENPKIARIEKMLSEEIKKKDIIQLLHIMFPKCDTSGLFCELIINFTSKWKEFLEIQNYFKEEIDEHLKTIDFNSEGEDLMDRFLIKQNQLKQQNIDVGSFNDWQLIRSSLELFYAGYETTSTTLCWSFLFMSKHQDIQQKVHNEIIEIIGKERLPTMNDKKSMNYTQAVMDE 363          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A2U8U473 (Cytochrome P450 2K1-like protein OS=Dugesia japonica OX=6161 GN=P450 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.535e-122
Identity = 186/344 (54.07%), Postives = 245/344 (71.22%), Query Frame = 2
Query:  188 TFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKF-MQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
             FK+  +PNG +E P  YG P++G+I KIK  +  YLL L ++ GPIF I+LGMR V +L +Y +I+KALVDD   FSGRWK    S   HDSG++F DG +W TQRSFIL VLRDFG GKS S ++VQ EC   + ELD+L  + ++FS +IPIY+ NIIS+FI N+R+ R DP I+ IE +  +     D  Q + LMFPIF++ST+ +KF + +TS  +    V+  F + IEEH+  LD+NSEG+DLIDRFL+ Q++L Q  G +E+F + Q+I    E+F AG ET+STTL WS LFMSRY DIQKKV+ EI+ +IG ER+PTMNDK+SLNYTQAVMDE
Sbjct:   20 VFKRRSIPNGLKETPIEYGWPILGIIPKIKGPMQNYLLELSRKHGPIFRIRLGMRDVVILGNYQTIRKALVDDAQIFSGRWKMKLVSVVTHDSGIVFKDGPVWSTQRSFILKVLRDFGMGKSISQDIVQGECLFLLNELDSLQGEIIDFSKIIPIYTANIISKFIMNKRFDRSDPRIKFIEYAIFQTSKQSDIVQRLHLMFPIFDKSTIISKFNLWITSKLQLFSKVERVFHDEIEEHKTNLDYNSEGDDLIDRFLLEQNRLSQSTGIVESFTDKQLIFMTFEMFGAGYETTSTTLGWSMLFMSRYKDIQKKVYEEILNVIGEERMPTMNDKKSLNYTQAVMDE 363          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A5G3HWX3 (Solute carrier family 35 member B2 OS=Xenopus tropicalis OX=8364 GN=slc35b2 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.210e-48
Identity = 112/334 (33.53%), Postives = 179/334 (53.59%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYY-LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP+IG IH I    PY   L L K+ GPIFS+++G +K+ VL  Y+++K ALV+    FS R     F D + + GV+F+ G+ W+  R F L+ LRDFG G+    + + EEC   +E+  +   +  + + ++     NII   +   R+   DP    ++ LI E+ R  LT   KA    +++ +F     +      T   K+      +  E   ++R+ LD N +  +L+D FL+ Q   Q++NGN   F++  +    S LF+AG ET+ST++ W  L M ++P+IQK V NEI ++IG+ R P    ++S+ YT AV+ E
Sbjct:   36 PGPKPLPIIGNIHNINLKRPYLTYLELWKKYGPIFSVQIGSQKMVVLCGYETVKDALVNYAEEFSERPVIPIFLDAVKEYGVIFSHGENWKVMRRFTLSTLRDFGMGRRTIEDRINEECDFLVEQFKSFKGKPFDNTMIMNAAVANIIVSIVLGHRFDYQDPIFLRLMSLINENVR--LTGSPKA----MLYNVFPSVMRWLPGNHQTVG-KNAAEYHRFIRETFTKYRDKLDINDQ-RNLVDAFLVKQ---QEKNGNAVYFHDDNLTVLVSNLFVAGMETTSTSVRWGLLLMMKFPEIQKNVQNEIEKVIGQSR-PQTEHRKSMPYTDAVIHE 357          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: A0A267DEG0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002316g1 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.215e-48
Identity = 115/344 (33.43%), Postives = 187/344 (54.36%), Query Frame = 2
Query:  212 NGQREVPTAYGLPLIGVIHKIKP-TLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELD---TLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYF-----AEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
             G+   P   GLPLIG +    P  L   + ++ ++ G I S  LG R + VLNSY  +K+ L  D YNF+GR +   F     D G++FT+G +W   R   L  LRDFGF ++++VEMV ++  +  + LD   T V+      T I + S +II+      R+ R+DP  Q + +  +K+L  +   Q    +FP  E      +F+ L     S++   EY       EI +  +  +D ++E E L D + I++ +  ++ G+ ETF  +Q+IR   E F+AG++T++ ++ W  L+M+ YP++Q +V NE+  +IG+ R P M D+  L+YT AV+DE
Sbjct:   48 QGRDLPPGPVGLPLIGRLPWTDPKNLHLTMQKVAEKYGDITSFYLGSRLLIVLNSYPMMKEML--DDYNFAGRPRLRLFLKLTRDCGIIFTEGDMWSQHRRLSLRTLRDFGFARAQTVEMVDDQLDSIFQTLDEAATSVTPMEVLGTFI-LASNSIITEMTLGHRFERNDPEFQKVNKLIKKLL-EEGIVQTASALFPAVE------RFIVLFPLSSSVVHDVEYLHSFIRKEIQQREKVMVDESTEPECLCDVY-IHEKRKAEKAGDFETFKEFQLIRVILEFFLAGTDTTARSIEWLLLYMAFYPEVQDRVQNELDSVIGQSRRPRMQDRTELHYTSAVIDE 380          
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Match: S7NQY2 (Cytochrome P450 2C23 OS=Myotis brandtii OX=109478 GN=D623_10025667 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.470e-48
Identity = 115/358 (32.12%), Postives = 192/358 (53.63%), Query Frame = 2
Query:  185 WTFKKD----RLPNGQREVPTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFM-----QLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            W +K+     RLP G    PT   LP+IG + ++    +P  L +L KE GP++++ +G     VL+ Y+++K+AL+D G  F GR      SDF    G+LF++G+ W+  R F L  LR+FG GK    E VQEE    +EEL    +Q  + + ++ +   N+I   + N R+  DD     ++ L+ E+ RK+ +            P  +   L+ K +     +  S  K L  V+ +  E ++EH+E+LD N+   D ID FL      Q+++  +  F+   +    S LF+AG+ET+S+TL +  L + ++P+++ KVH EI  +IG  + P++ DK  + YT+AV++E
Sbjct:   22 WVWKEGCKWGRLPPG----PTP--LPIIGNLMQLNLKDIPASLSKLAKEYGPVYTLYVGSTPTVVLHGYEAVKEALIDQGDEFLGRGPIPIISDFQKGHGILFSNGETWKQMRRFSLMTLRNFGMGKRSIEERVQEEAQYLVEELRKTEAQPFDPTFILSLAPCNVICSTLFNERFQYDDEKLLYLMSLLNENSRKISS------------PWNQMYNLWPKLIKHLPGEHRSFSKRLTNVKNFILEKVKEHQESLDQNNP-RDYIDCFLSKME--QEKHNPMSEFDLENLAICGSNLFVAGTETTSSTLRYGLLLLMKHPEVEAKVHEEIDSVIGHNQRPSLKDKMKMPYTEAVLNE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000003264.2 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 155.221 bits (391), Expect = 4.619e-42
Identity = 108/336 (32.14%), Postives = 170/336 (50.60%), Query Frame = 2
Query:  221 REVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            R  P    LP +G + ++    P  L+R   + G I S+ LG   V VLN+  +IK+A + +G  ++GR          +  G+L  + G  W  QR F L+ LR+FG GK    E V EE    I+EL  L  +   F  + PI +   NII   +   RY  DD    QL++     +         I  M P  +    F    Q    W++   ++ +  E +EEHR+ LD N+   D ID +++   + QQ N +  TF+   MI + S+LF+AG++T++ TL W  ++M  +PD+Q++ H EIV+++G +R P+M D+  L YT A + E
Sbjct:   38 RNPPGPKPLPFVGNMPQMI-NDPKGLIRSMPKYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKEL--LKHEGKPFYPIHPIMNAVSNIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKH---FPGPHQ--KVWQNANSLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSK-QQSNED-STFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000041981.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 155.221 bits (391), Expect = 5.661e-42
Identity = 108/336 (32.14%), Postives = 170/336 (50.60%), Query Frame = 2
Query:  221 REVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            R  P    LP +G + ++    P  L+R   + G I S+ LG   V VLN+  +IK+A + +G  ++GR          +  G+L  + G  W  QR F L+ LR+FG GK    E V EE    I+EL  L  +   F  + PI +   NII   +   RY  DD    QL++     +         I  M P  +    F    Q    W++   ++ +  E +EEHR+ LD N+   D ID +++   + QQ N +  TF+   MI + S+LF+AG++T++ TL W  ++M  +PD+Q++ H EIV+++G +R P+M D+  L YT A + E
Sbjct:   38 RNPPGPKPLPFVGNMPQMI-NDPKGLIRSMPKYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKEL--LKHEGKPFYPIHPIMNAVSNIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKH---FPGPHQ--KVWQNANSLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSK-QQSNED-STFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000007200.2 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 155.221 bits (391), Expect = 7.664e-42
Identity = 108/336 (32.14%), Postives = 170/336 (50.60%), Query Frame = 2
Query:  221 REVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            R  P    LP +G + ++    P  L+R   + G I S+ LG   V VLN+  +IK+A + +G  ++GR          +  G+L  + G  W  QR F L+ LR+FG GK    E V EE    I+EL  L  +   F  + PI +   NII   +   RY  DD    QL++     +         I  M P  +    F    Q    W++   ++ +  E +EEHR+ LD N+   D ID +++   + QQ N +  TF+   MI + S+LF+AG++T++ TL W  ++M  +PD+Q++ H EIV+++G +R P+M D+  L YT A + E
Sbjct:   38 RNPPGPKPLPFVGNMPQMI-NDPKGLIRSMPKYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKEL--LKHEGKPFYPIHPIMNAVSNIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKH---FPGPHQ--KVWQNANSLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSK-QQSNED-STFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: cyp2n13 (cytochrome P450 2J6-like [Source:NCBI gene;Acc:103035066])

HSP 1 Score: 151.754 bits (382), Expect = 8.704e-41
Identity = 100/328 (30.49%), Postives = 173/328 (52.74%), Query Frame = 2
Query:  242 GLPLIGVIHKIKPTLPY-YLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFT-DGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDD-PMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
             LP +G I  I    P+ YL +LGK    IFS+++G +K+ +L  Y  +K+ALV+   NF  R  +         +G LFT +G LW+ QR F L+ LR+FG GK      + EE    ++E+D    Q  + S L      NII + +  +RY   D    Q+++ +   +         +   FP   +  L  +   + S+++    + E+  + +++H+  LD  S   D +D FLI +   +  +   + F++  ++R   +LF+AG+ET++T+L W+ +++++ P+IQ KV  EI  +IG+ R P M DK ++ YT+AV+ E
Sbjct:   43 ALPFLGNILDIASPQPHIYLTKLGKAYNNIFSMRIGQQKMILLTGYKMVKEALVNQTDNFVDRPYSPLAERIYSGNGGLFTSNGNLWKKQRRFALSTLRNFGLGKKTMELAICEESHFLLDEMDRHKGQAFDPSGLFNNAVSNIICQLVFGQRYDYADYDFQQMLKYTSEAIHLEGSIWGRLYESFPNIMKH-LPGRHNVIFSNYEH---ISEFIKKNLDKHKANLD-PSNPRDYMDSFLIEK---ENSHDPADGFSDKNLVRCTLDLFLAGTETTTTSLGWALIYLAKNPEIQDKVQEEIDRVIGQSRQPGMADKPNMPYTEAVIHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000048857.1 (cytochrome P450 2B4-like [Source:NCBI gene;Acc:103033589])

HSP 1 Score: 155.221 bits (391), Expect = 8.747e-41
Identity = 108/336 (32.14%), Postives = 170/336 (50.60%), Query Frame = 2
Query:  221 REVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            R  P    LP +G + ++    P  L+R   + G I S+ LG   V VLN+  +IK+A + +G  ++GR          +  G+L  + G  W  QR F L+ LR+FG GK    E V EE    I+EL  L  +   F  + PI +   NII   +   RY  DD    QL++     +         I  M P  +    F    Q    W++   ++ +  E +EEHR+ LD N+   D ID +++   + QQ N +  TF+   MI + S+LF+AG++T++ TL W  ++M  +PD+Q++ H EIV+++G +R P+M D+  L YT A + E
Sbjct:   38 RNPPGPKPLPFVGNMPQMI-NDPKGLIRSMPKYGEISSVYLGRDIVLVLNNLPTIKEAFIQNGNVYAGRSSFAILEWVTNGYGILMAEYGNSWRQQRRFALHTLRNFGLGKKTLEERVAEEARFLIKEL--LKHEGKPFYPIHPIMNAVSNIICSIVFGDRYEYDDKRFAQLLKLINENIQLAGSTVGRIFNMVPFIKH---FPGPHQ--KVWQNANSLKNFIHEAVEEHRKTLDPNNL-RDFIDAYIVEMSK-QQSNED-STFHEDNMIMSTSDLFLAGTDTTAATLRWGLIYMMDHPDVQERCHKEIVQVLGFDRSPSMEDRAKLPYTHATIHE 362          

HSP 2 Score: 129.413 bits (324), Expect = 4.947e-32
Identity = 83/296 (28.04%), Postives = 146/296 (49.32%), Query Frame = 2
Query:  335 IKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP-MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
             ++G   V V+NS  ++K+A + +   ++GR             G+L    G  W+ QR F L+ LR+FG GK    E V EE    I+E+     +++    L+     NII   +   RY  DD    +L+E     +         I  + P  +         ++  ++ SL   +++  EI+EEHR+ LD  +   D ID +L+     +Q++    TF+   M+ + ++LF+AG++T++ TL W  ++M  +P +Q + H EI+ ++G +R P+M D+  L YT A + E
Sbjct:  515 CQIGRNLVIVVNSLSALKEAFIQNSAVYAGRSPIPILDWVTKGYGILMAPFGISWKQQRRFALHTLRNFGLGKKNVEEDVAEEARYLIKEMLKQEGKSVCPMHLLMNSVSNIICSIVFGERYEYDDKRFAKLLEIINENIQLAGAPMARIFGLAPFIKH--FPGPHHKIRHNFDSL---KQFIREIVEEHRKILDPENP-RDFIDAYLVEM--TKQQSNEDSTFHEENMLLSTADLFLAGTDTTAATLRWGLIYMMDHPAVQDRCHEEIIRVLGFDRSPSMEDRAQLPYTHATIHE 802          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011254.1 (pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 gene:ENSPMAG00000010227.1 transcript:ENSPMAT00000011254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 3.267e-39
Identity = 98/311 (31.51%), Postives = 152/311 (48.87%), Query Frame = 2
Query:  305 LGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPV----QEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            L K+ G + +I LG   V +++ Y+++K+ LV+ G+ F+ R  T  F+    + G+     G  W+ QR F L+ LR+FGFGK+   + +  E    IE   T   +T  F   + + +   NII   +   RY  D+   Q +      ++  + +   IL          +F   ++L   W+ +  +    Q    +I+ EHR   D      DLID +L  Q   ++ N N  +F +  +I+   ELFI G ET+S TL W  LFM   PDIQ + H EI  ++G ER P M D+RSL Y  AV+ E
Sbjct:   66 LAKKYGEVCTIMLGSTPVVLVSGYEAVKEVLVNRGHEFADRPITPIFTKLTQNIGIALAPYGDPWKQQRRFALSTLRNFGFGKATIADKISIEAKYLIE---TFKQETSAFDPHLNLNNALGNIICCLLNRNRYDYDNEQFQKLTHLLEYLVQLQAEPLVIL--------CNVFPFLLKLPGPWQKVFHIHSKLQCLLNDIVSEHRATKD-QHNPRDLIDSYLA-QIDKEKDNPN-SSFTHQSLIQILIELFIGGLETTSNTLRWGLLFMMMNPDIQARCHGEIDRVVGSERPPCMTDRRSLPYLDAVIHE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011204.1 (pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 gene:ENSPMAG00000010177.1 transcript:ENSPMAT00000011204.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 3.877e-38
Identity = 103/337 (30.56%), Postives = 162/337 (48.07%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYYLLR-LGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSM--NIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPV----QEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LPL+G I       P+  ++ L K+ G + +I LG   V +++ Y ++K+ LV+ G+ F+ R  T  F+   H+ G+     G  W+ QR F L+ LR+FGFGK+   + +  E    IE   T   +T  F     + S   NII   +   RY  ++   Q +      ++  + +   IL          +F   ++L   W+ +  +    Q    +I+ EHR   D      DLID +L   H  ++++    +F +  +I    ELFI G ET+S TL W  LFM   PDIQ + H EI +++G +R P M D+RSL Y  AV+ E
Sbjct:   36 PGPKPLPLLGNITAFSCKNPHIGMQELAKKYGEVCTIMLGSTPVVLVSGYQAVKEVLVNRGHEFADRPITPLFTKLTHNIGIALAPYGDTWKQQRGFALSTLRNFGFGKATITDKISIEARYLIE---TFKQETSEFDPKFILNSAVGNIICSLLNGIRYDYNNEQFQKLTHLLEHLVQLQAEPLVIL--------CNVFPFLIKLPGPWQKVFHIHTKLQCLLKDIVSEHRATKD-QHNPRDLIDSYL--AHIDKEKDNPNRSFTDQTLILLLIELFIGGMETTSNTLCWGLLFMMMNPDIQARCHEEIDKVVGSQRPPCMKDRRSLPYLDAVIHE 358          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011205.1 (pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1 gene:ENSPMAG00000010178.1 transcript:ENSPMAT00000011205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 3.658e-35
Identity = 99/310 (31.94%), Postives = 151/310 (48.71%), Query Frame = 2
Query:  311 KELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMN-----IISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILL--MFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            K+ G + S+ +G   +  ++ Y ++K+ LV  G+ F+ R  T F        G++F   GK W   R F L+ LR+FG GKS   + +Q E    IE            S   P Y +N     II   +  +RY   D   Q        ++ N  + Q  LL  +  IF     F    Q+   +KS+   +++  +II E R A     +   LID +L    QL++ +    +F+   +I  A +LFIAG+ET+STTL W  L+M  +P+IQ + H EI +I+G +RLP M D+ SL Y  AV+ E
Sbjct:   81 KQYGEVCSVMVGKISMVFVSGYQAVKEVLVHQGHEFADRPNTPFNKKVNGGLGIIFAPYGKYWMQHRRFTLSTLRNFGLGKSSIEQTIQAEVGFLIEAFKQ------KGSAFDPHYDLNSAVGNIICSMVKGKRYEYSDKQFQ----DFLHLVENNLQLQSGLLGTLCNIFPFLMDFPGPQQII--FKSMAKSKQFIRDIISE-RHATRDPIKPMCLIDAYL---SQLEKEDNPNSSFSEQSLIMLALDLFIAGAETTSTTLRWGLLYMMMHPEIQAQCHEEIDKIVGSDRLPCMEDRHSLPYLDAVIHE 374          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001876.1 (pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 gene:ENSPMAG00000001674.1 transcript:ENSPMAT00000001876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.360e-30
Identity = 96/333 (28.83%), Postives = 157/333 (47.15%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIK-PTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHD-SGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYT-RDDPMIQLIEESGRKV-LTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P   GLPL+G + ++    LP  L +L +  GPI+S+ LG  +V VL   + IK+ALV     F  R +   F   + +  G+L + G  W  +R F L +LR+FG G     E + EE    +  ++    +  +  + I   + N+I       RY   +   ++L++     V L+  D +Q I   FP+ +    F    Q  +  K+ + +  +    IEEH  A     E  D +D F+    +++        F++  +I   + LF+AGSET+S TL W  L M  YP +Q++V  EI  ++G  R P   D+  + YT A + E
Sbjct:   42 PGPRGLPLVGNLFQLDLKALPASLDKLSETYGPIYSVSLGQTRVVVLVGNEIIKEALVTQAEMFIDRPEIPVFKKSLGNYEGLLLSHGWQWRARRRFTLMMLRNFGMGTKSIEEKIAEEAEFLVRAIENKQEKPFDAHSEINKSAANVICSITFGDRYDWNNKTFVKLMDIITENVELSGNDWSQ-IFNSFPVLK---YFPGPHQRIN--KNKVVLNAFIQARIEEHDMA-RIQGEPRDYLDAFI--DKRIEDSMNPDTAFSDIALINTTANLFVAGSETTSATLKWGILLMLTYPKVQEQVQEEIDRVVGSNRRPACADRACMPYTNATVHE 365          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010591.1 (pep scaffold:Pmarinus_7.0:GL479221:22742:24427:1 gene:ENSPMAG00000009591.1 transcript:ENSPMAT00000010591.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 9.473e-29
Identity = 98/309 (31.72%), Postives = 142/309 (45.95%), Query Frame = 2
Query:  335 IKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGV-LFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITN--RRYTRDD------PMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFA-----EIIEEHREALD-FNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            I LG   V +++ Y ++K+ LV+  + FS    T  F+   H  G+ L   G  W+ QR F L+ L +FGFGK+   + +  E    IE   T   +T  F       S N +   I +   R   DD      P+I L+  +G   LTN+     I+   PI  +             W  +I +Q   A     +I+ EHR   + +NS G  LID +L       + N N        +I   SELF  G  T+STT  W  LFM  +PDIQ + + EI  ++G E+LP M D+RSL Y  A++ E
Sbjct:   71 IMLGSTPVVLVSGYQAVKEVLVNRSHQFSDLPITPLFTKVTHKVGISLAPYGDSWKQQRRFALSTLCNFGFGKATIADKILTEARYQIE---TFRPETSAFD------SQNAVGDVICSLLNRIRCDDSDECFRPLIHLLVHAGH-ALTNRTTGN-IVRCVPISAKP------------WHQVIHIQAKGAKHLIEDIVSEHRATREQYNSRG--LIDSYL--AQIATEDNPNSRFLEKLTLI--VSELFTDGIGTTSTTSCWGLLFMVMHPDIQTRCY-EIERVVGSEQLPRMGDRRSLPYVDAMIHE 349          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK60])

HSP 1 Score: 112.464 bits (280), Expect = 2.445e-27
Identity = 84/326 (25.77%), Postives = 154/326 (47.24%), Query Frame = 2
Query:  269 KIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSG--VLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTS-SWKSLIPVQEYFAE----IIEEHREALDFNSEG--EDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            ++ PT    L  L K  G +F +K+G  ++ V+NS ++ ++ALV    +F+GR    + +  I  +G  + F D G LW+ QR    + LR FG G     E +  E    I+ L  +  +  N    + +  +NII  F+   RY  DDP    + +   + +               F  ++L   F  L     K L  ++E        + ++++E L     G   DL D  L      Q+ +  +    +  +I   +++F AG ET++T++ WS +++ R P +Q+++H +I E++GR+R P ++D+ +L   +A + E
Sbjct:    3 QMGPTPHLGLTELAKSYGEVFRLKVGSHRIVVVNSIEAAREALVRRANDFAGR-PMLYTASLISRNGTDIAFGDFGPLWKQQRKIAHSALRMFGSGLKPLEEKITVEADELIKRLSLVEGRAHNPKDDVNLAVLNIICSFVFGSRYDMDDPEFHTVVDYTEQFVQG-------------FRAASLVDYFPWLRHLPNKGLRQIKEACQNRDVVLQKKYQEHLVTYEHGVIRDLTDALLSANKASQEESAYLPMTED-HIIMTMNDIFSAGLETTATSILWSLVYLIRNPKVQEQLHQQIDEVVGRDRAPELSDRENLPLIEATIAE 313          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO40930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T4])

HSP 1 Score: 97.8265 bits (242), Expect = 3.433e-22
Identity = 85/352 (24.15%), Postives = 164/352 (46.59%), Query Frame = 2
Query:  206 LPNGQREVPTAYGLPL-IGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKS---RSVEMVQEECSNFIEE----LDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNA-SELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRER--LPTMNDKRSLNYTQAVMDE 1216
            LP G R  P     PL IG       +L   L  L K  G ++++ L  ++  ++ S  + ++ LV+     +GR   +F  D++       T+G    T   F    L      +S   R    V+++ +N +EE    +  L     +   L+ + ++N+++       YT DDP    ++Q+I++S R + +      F  LM      S L     +          V EYF + ++ H ++ D  S   DL D ++    + ++ + ++   N+ + I    +++ + GSETSSTT+ W   +++ YP++Q ++H ++ ++IGR++  + T+ D+  L Y +AV+ E
Sbjct:   28 LPPGPRPYPLIGNTPLLIGSFS----SLHVKLTELAKIYGSVYTLYLNGQRSVIVCSAKAAREGLVERKDAIAGR-PYSFTLDYV-------TNGSKNITFSDFCPTFLLKKRIAQSSMRRYYPQVEDKVNNQLEEVLARIKALDGTAFDPHHLLSLVTLNLVTSMTFGTNYTLDDPEFLLLVQMIDDSTRSIGSMSTLDMFPFLMHLPIRTSKLLKSITKT---------VNEYFMKQVQRHIDSNDGKSI-RDLTDGYIKGLTEAEKEDASVHEVNSIEHIAMVMADMIVPGSETSSTTMGWMIAYLAVYPEVQARLHQQLDDVIGRDKNTVITLKDRDRLPYVEAVIAE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO46605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN7])

HSP 1 Score: 97.4413 bits (241), Expect = 3.815e-22
Identity = 85/334 (25.45%), Postives = 155/334 (46.41%), Query Frame = 2
Query:  248 PLIGVIHKIKPTLPYYLLRLGKELG-PIFSIKLGMRKVFVLNSYDSIKKALVD-DGYNFSGRWKTTFFSDFIHDSGVLFTDGKL---WETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIY--SMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAE-IIEEHREALDFNSEGE--DLIDRFLINQHQLQQRNGN-IETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P +G   +I P L   L  LGK+ G  +F ++L  ++  ++++    ++ L+  +G + + R  + +  D I  +G     GK    W+ QR  + + LR +G G      ++ +E  N  +      SQ     T +P+    MN+I   +  +RY  DD       E    V T +  A+      P+     L    +Q+    K  +  ++   +  I EHRE      EGE  DL D  L +    +Q + N +       ++   +++F+AG ET++T L W  L+++ YP++Q ++H E+ ++I   R P + D++SL Y +A + E
Sbjct:   36 PFVGNFPQIGPVLHKSLTSLGKQYGRGVFQVQLLGKRFVIIDNIKLARQVLLKKNGRDVADR-TSAYVIDAISRNGCSVIFGKYSPTWKLQRRVVHSALRMYGSGVRILEALILQEVDNLCDIFAN--SQGAPVDTKLPLTLSVMNVICALVFGKRYGLDD------AEFTDIVATTESMAKLASPENPLIYMPWLRFFPLQVVKKMKETVTARDRLIQRKITEHRETY---KEGEIRDLTDALLKSLEDAKQEDNNAMSLLTEDHLLIAINDVFMAGFETTTTALRWIFLYVAAYPEVQARIHQELDDVISFGRDPLIADRKSLPYLEATILE 357          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO48207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK94])

HSP 1 Score: 95.9005 bits (237), Expect = 1.337e-21
Identity = 81/313 (25.88%), Postives = 143/313 (45.69%), Query Frame = 2
Query:  305 LGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGR--WKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIE----EHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNA--SELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            L K  G ++ + LG +   VL S D+IK+ALV    NF+GR        S      G+   D G+ W+  R    + ++ +G  ++R  +++++E       L++   +  + +    I   N+I   +   RY  DDP    + E   K+         +  +FP        A  +  +   + LI + +   EI+E    EH +  D      D  D  L  +   +Q + + +       I  A  + LFIAGSET+STTL W+ +++   PD+Q+++H EI ++IGR+  P ++ ++ L   +A   E
Sbjct:   54 LEKTYGKVYRLYLGHKLAIVL-SGDAIKEALVRQPRNFAGRPVLNPQLKSALNRGPGLTVMDYGETWKLFRKLGHSTIKVYG--ENRLQDVIKDEVLELCNRLESSAGKPFDITQQSGIAVTNVICTKLFGTRYQIDDPEFLRVYEIHDKLSRIGFGGNLVTNIFPSL------ASILPFSEKQRDLIQIGQERYEILERKYQEHVKTFD-PENIRDYTDALLKAKQDAEQEDKSSKEHLQESTIIMAGLATLFIAGSETTSTTLGWAVIYLLHNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLEAFTAE 356          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Match: EDO29403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3R2])

HSP 1 Score: 93.5893 bits (231), Expect = 7.562e-21
Identity = 91/350 (26.00%), Postives = 162/350 (46.29%), Query Frame = 2
Query:  194 KKDRLPNGQREVPTAYGLPLIGVIHKI--KPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTD-GKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEG--EDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +K+RLP G    P  +  P+IG +  +  K  L      L  + G +F + LG + V VLN   +I  +L      F+GR       DF  D      D G LW+  +    + +R    G  R  E ++ E       LD+L  Q ++ S    I + N+I   +   RY   DP    + ++  +  R V++++  +     +  I  +S    +  +L         +QE +  I  +++E     + G   D  D  L+   +L ++N +  T N       AS+ F+AGSET+++TL+WS +++    D+Q+++HNE+ ++IG+ +LP ++ K+ L   +A   E
Sbjct:   22 RKERLPPG----PAPW--PIIGNLDLLIRKEALYKTFTNLSHKYGGVFRLYLGSKPVVVLNG-KAIYDSLARQPSVFAGRPTLPPSLDFGMDPDYGVLDYGPLWKFYKKLGHSAVR--VHGTDRLNEAIRVEVDEVCRRLDSLDGQPVDISKEFGIATTNVICARLFGSRYDVHDPEFLRIYEIHNKISRVVMSSRSLSDVFPFLVNILPESKERRELREL---------LQERYTIIWRKYKEHEQTFTPGVIRDYTD--LLIDAKLSEKNSHKLTENGIISTGLASQ-FLAGSETTASTLSWSVVYLLNDSDVQERIHNELDDVIGKGQLPQLSHKKKLPVLEAFTAE 350          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018818.2 (cytochrome P450 2J2 [Source:NCBI gene;Acc:101157767])

HSP 1 Score: 171.4 bits (433), Expect = 5.413e-48
Identity = 112/331 (33.84%), Postives = 171/331 (51.66%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPTLPYYLLR-LGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEI-IEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P    LP IG +H+I+PT+ +   +    + G +FS+ +   K  VLN    +K+AL+  G +F  R +   FSD I + G++ T+G  W+ QR F L+ LR+FG GK    + +QEEC    +       +  +   L+     NII   +   R+   D   Q I +   +V+  K +  F  L + +F    L  +F        +L+     F +I IEEH+E LD  +  +D ID FLI   ++++  G    F+   +     +LF AGSET++TTL W  LFM  YPDIQ++VH EI  +IG  R P+M DK ++ YT AV+ E
Sbjct:   42 PGPRSLPFIGDLHRIRPTILHLQFKEFAAKYGNVFSLNIFGGKTVVLNGTKLLKEALIQKGDDFVDRPQIPLFSDLIENKGIVMTNGIQWKHQRRFALHTLRNFGLGKKTMEKYIQEECHYITQAFAEHQGKPFDAQPLLNSAVSNIICCLVFGERFEYSDKEYQQILQDLTEVV--KLQGSFSALAYNVF--PWLMKRFPGPLQKLFTLVDKIMDFVKIKIEEHKENLD-PACPKDYIDSFLI---EMEKNQGEDFGFDIKNLCACTLDLFGAGSETTTTTLYWGLLFMIHYPDIQEEVHAEIDAVIGSSRQPSMADKENMPYTDAVIHE 364          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000018724.2 (cytochrome P450 2J1 [Source:NCBI gene;Acc:105353996])

HSP 1 Score: 155.992 bits (393), Expect = 2.368e-42
Identity = 109/331 (32.93%), Postives = 163/331 (49.24%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPT-LPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILL-MFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  + LP IG +H+I+P  L        ++ G +FS+ L   +  +LN Y  +K+ALV  G +F  R     F D I + G++ ++G  W+ QR F L+ LR+FG GK      +Q EC    +       +  +   LI     NII   +   R+   D   Q I  +   +L  +     +L  MFP   +  L     ++ S  + +I   ++    I EH+   D  S  ED ID FLI   + Q ++   +  N   M     +LF+AG+ET++TTL W  L+M  YPDIQ+KVH EI  +IG  R P+M DK S+ YT AV+ E
Sbjct:   42 PGPHSLPFIGDLHRIQPARLHVQFTEFAEKYGNVFSLHLLGERTVILNGYKQVKEALVQQGDDFVDRPTIPLFVDTIDNKGIVMSNGNSWKQQRRFALHTLRNFGLGKKTMETYIQNECHYITQTFADKQGKPFDAQFLINNAVSNIICCLVFGERFEYSDQEYQKILRNLNDLLILEGSVSAMLYNMFPWLMKR-LPGPHQKIFSLTRKII---DFVKIKINEHKGNFD-PSAPEDYIDSFLIEMEKSQDKDSGFDIDN---MCICTMDLFLAGTETTTTTLYWGLLYMIYYPDIQEKVHAEIDAVIGSSRQPSMADKESMPYTDAVIHE 364          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: cyp2p3 (cytochrome P450 2P3 [Source:NCBI gene;Acc:100302452])

HSP 1 Score: 155.606 bits (392), Expect = 3.783e-42
Identity = 110/333 (33.03%), Postives = 165/333 (49.55%), Query Frame = 2
Query:  230 PTAYGLPLIGVIHKIKPT-LPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFE--QSTLFAKFMQLTSSWKSLIPVQEYFAEI-IEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            P  + LP IG +H+I P+ L   L    ++ G +FS+ L   +  +LN +  +K+ALV  G +F  R     F  F  + G++ ++G  W+ QR F L+ LR+FG GK    + +QEEC    E       +  N   LI     NII   +   RY   D   Q I +   +++    +  F   +F  F      L     ++ +    LI     FA++ I EH+E LD  S  +D ID FLI   ++ Q      +F+   +     +LFIAG+ET++TTL W  L+M  Y DIQ+KV  EI  +IG  R P+M DK ++ YT AV+ E
Sbjct:   42 PGPHSLPFIGDLHRINPSRLHLQLTEFAEKYGNVFSLHLFGERAVILNGHKHVKEALVQRGDDFVDRPSIPLFEQFYSNKGIVVSNGYPWKQQRRFALHTLRNFGLGKKTMEKYMQEECRYLTEAFGEYKVKPFNAQALINNAVSNIICCLVFGERYEYSDKQYQQILQDINEIMIL--QGGFAAQLFNSFPWLMKKLPGPHQKILTLLAKLID----FAKVKISEHKENLD-PSSPKDYIDSFLI---EMAQNENQESSFDISNLCMCTLDLFIAGTETTTTTLHWGLLYMIYYADIQEKVQAEIDAVIGSSRQPSMADKENMPYTDAVIHE 364          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000020799.2 (cytochrome P450 2J6 [Source:NCBI gene;Acc:101155419])

HSP 1 Score: 153.295 bits (386), Expect = 4.102e-41
Identity = 102/315 (32.38%), Postives = 158/315 (50.16%), Query Frame = 2
Query:  302 RLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQ----------LIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            +L  E G ++S++ G R   VLN + ++K+ALV  G +   R       +     GV+F++G  W  QR F L+ LR FGFGK     ++  E ++  EEL     + L+   +I     NII   +   R+   D   +           IE S    L N     F L+M        L      L   W+    VQ++  E ++EH+++ D  S+  D ID +L    + + + G+  TF+   +I    +LF+AGSET+STTL W+ L+M++YP+IQ+KV  EI ++IG+ R P M D+  L YT AV+ E
Sbjct:   91 KLAAEYGDLYSLRFGQRWTVVLNGHKALKEALVTKGDSVVDRPHLPLQDEIAKGLGVIFSNGANWTEQRRFALSTLRYFGFGKKSLEPVILNEFAHCAEELKRFKGEPLDPHLIINNTVSNIICHLVFGHRFNYGDKKFKKLMLLFDRALQIEASIWAQLYN----SFTLIM------RCLPGPHKTLQHIWRE---VQDFIGEELKEHKKSWD-PSDARDYIDFYLTEIQKTKGQEGS--TFDEENLIMCVLDLFVAGSETTSTTLRWAFLYMAKYPEIQEKVQAEIHKVIGKSRPPCMEDRAELPYTDAVIHE 389          
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Match: ENSORLT00000029062.1 (cytochrome P450 2F3 [Source:NCBI gene;Acc:101157144])

HSP 1 Score: 151.369 bits (381), Expect = 1.024e-40
Identity = 94/315 (29.84%), Postives = 164/315 (52.06%), Query Frame = 2
Query:  296 LLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDP----MIQLIEE----SGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            ++ L K  GP+ +I +G ++   L  YD++K+ALVD   +F GR    FF       G+  ++G+ W   R F L  LRDFG G+    + +QEE  +    + +   +  +    +     N+I  F+   R+  DD     ++++I E    +G  +    +   ++L   P   Q T+F  ++++T         + Y  + I+EH++ LD  S   D IDRFLI  H  Q+++     F+   ++     LF+AG+ET+S+T+ ++   + ++P IQ+K+  EI  +IGRER P+M D++SL +T AV+ E
Sbjct:   55 IVELSKTYGPVMTIYMGWQRAMALVGYDAVKEALVDQADDFVGRAPLPFFYRASRGYGIGISNGERWRQLRRFTLTTLRDFGMGRKGMEQWIQEESRHLRAHIMSFKGKPFDPMFKLSCAVSNVICCFVYGERFNYDDKQFLELLKMISEILDFNGGPIGAMYNLCPWLLEHLP-GHQHTVFG-YIEVT---------RNYAKKKIQEHKDTLD-PSFPRDFIDRFLI--HMDQEKDNPTSEFHYENLLAMVQNLFLAGTETTSSTIRYALSVLIKHPKIQEKMQEEIDSVIGRERCPSMEDRKSLPFTDAVIHE 355          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000072594.1 (SMESG000072594.1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 340/344 (98.84%), Postives = 340/344 (98.84%), Query Frame = 2
Query:  185 WTFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            WTFKKDRLPNGQREVP AYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKT FFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLV QTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKR LNYTQAVMDE
Sbjct:   19 WTFKKDRLPNGQREVPAAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTKFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVGQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRLLNYTQAVMDE 362          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078091.1 (SMESG000078091.1)

HSP 1 Score: 475.707 bits (1223), Expect = 4.897e-166
Identity = 221/345 (64.06%), Postives = 271/345 (78.55%), Query Frame = 2
Query:  185 WTFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQ-LTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            W  +K  +P G +E+P   GLP+IG IHKI+P + +YLL+LG++LGPIF IKLGMRK+ VLN+Y+ IKKAL+DD  NFSGRW   F  +  HDSG++F DGK+W TQRSFIL VLRDFG GKS+S+E+VQ EC NF++ELDTL  Q ++FS LIPIY+ NIISRFI N+R+TRDDP IQLIEE+      NKD  Q ILLMFP F+ S+L  + +  LTS WKS + +Q YF E IEEHR  LD  SEGEDL+DRFLI QH+L+Q  GN+E+F +WQ+IR + ELFIAG ET+STTL W CLFMS+YPDIQ+KVH EI EIIG+ERLPTMNDK++LNYTQAVMDE
Sbjct:   19 WVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSQRFIKEITHDSGIIFKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNIQLIEETINNSTKNKDIIQLILLMFPCFDNSSLICQLIYLLTSKWKSFVKIQNYFGEEIEEHRTNLDLTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRTSVELFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDE 363          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078092.1 (SMESG000078092.1)

HSP 1 Score: 466.077 bits (1198), Expect = 2.843e-162
Identity = 216/345 (62.61%), Postives = 273/345 (79.13%), Query Frame = 2
Query:  185 WTFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQ-LTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            W  +K  +P G +E+P   GLP+IG IHKI+P + +YLL+LG++LGPIF IKLGMRK+ VLN+Y+ IKKAL+DD  NFSGRW     ++  HDSG+++ DGK+W TQRSFIL VLRDFG GKS+S+E+VQ EC NF++ELDTL  Q ++FS LIPIY+ NIISRFI N+R+TRDDP +  +E++  K   NKD  Q ILLMFP F+ S+L  + +  LTS WKS I  Q++FA+ I+EHR ALDF SEGEDL+DRFLI Q+QL+Q  GN+E+F +WQ+IR + ELFIAG ET+STTL W CLFMS+YPDIQ+KVH EI EIIG+ERLPTMNDK++LNYTQAVMDE
Sbjct:   19 WVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKVDAEVTHDSGIIYKDGKIWATQRSFILKVLRDFGLGKSKSIEIVQNECFNFLDELDTLSGQIVDFSELIPIYTTNIISRFIMNKRFTRDDPNVHFMEKAITKFTKNKDIFQLILLMFPCFDNSSLICQLIYLLTSEWKSFIRTQDFFADEIKEHRNALDFTSEGEDLMDRFLIKQYQLKQSTGNVESFVDWQLIRTSVELFIAGFETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDE 363          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078100.1 (SMESG000078100.1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.882e-156
Identity = 210/345 (60.87%), Postives = 266/345 (77.10%), Query Frame = 2
Query:  185 WTFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQL-TSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            W  +K  +P G +E+P   GLP+IG IHKI+P + +YLL+LG++LGPIF IKLGMRK+ VLN+Y+ IKKAL+DD  NFSGRW     ++  HDSG++F DG+   TQRSFIL VLRDFG GKS+S+E++Q EC N ++ELDTL  Q ++FS   PIY+ NIISRFI N+R+TRDDP IQ I ++   +  NKD    ILLMFP  +QS + A+ + L  S WK  + +Q+YFAE I+EHR ALDF SEGEDL+DRFLI QH+L+Q  GN+E+F +WQ+IRN+ EL IAG ET+STTL W CLFMS+YPDIQ+KVH EI EIIG+ERLPTMNDK++LNYTQAVMDE
Sbjct:   19 WVCRKPPIPKGLKEIPMESGLPIIGAIHKIEPPMHHYLLKLGRKLGPIFRIKLGMRKIVVLNNYEMIKKALIDDANNFSGRWSPKIITEVSHDSGIMFKDGQGLATQRSFILKVLRDFGLGKSKSLEIIQNECLNLLDELDTLSDQIVDFSEFFPIYTTNIISRFIMNKRFTRDDPNIQFIWKTMDNLAKNKDIFHLILLMFPCLDQSFIVARLLFLFVSDWKRFVKIQDYFAEEIKEHRNALDFTSEGEDLMDRFLIKQHELKQSTGNVESFVDWQLIRNSLELIIAGYETTSTTLNWCCLFMSKYPDIQEKVHEEISEIIGKERLPTMNDKKALNYTQAVMDE 363          
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Match: SMESG000078098.1 (SMESG000078098.1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.266e-155
Identity = 207/345 (60.00%), Postives = 265/345 (76.81%), Query Frame = 2
Query:  185 WTFKKDRLPNGQREVPTAYGLPLIGVIHKIKPTLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRWKTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEECSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIEESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFM-QLTSSWKSLIPVQEYFAEIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNASELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDKRSLNYTQAVMDE 1216
            WTFKK ++P G +E+P   GLP+IG IHKI+  +  Y  +L ++LGPIF IKLGMRK+ VLN+Y+ IKK L+DD  NFSGRW    F+D  HDSG++F DG +W  QRSF+L VLRDFG GK++S+E++Q EC NF++ELDTL  Q + FS LIPIY+ NIISRFI N+R+TRDDP +Q I ++   +  +KD  Q IL+MFP F+ S+LF+K +  L + WK  + ++ YF E IEEHR  LD  SEGEDL+DRFLI Q QL+Q  GN+E+F +WQ+IRN+ E+FIAG ET+STTL W CLFMS+YPDIQ+KVH EI EIIG+ERLPTMNDK++LNYTQAVMDE
Sbjct:   19 WTFKKTQIPKGLKEIPVESGLPIIGAIHKIEMPISRYFQKLSRKLGPIFRIKLGMRKIVVLNNYEMIKKTLIDDANNFSGRWLPKVFTDAAHDSGIMFKDGHIWAIQRSFLLKVLRDFGLGKAKSLEIIQNECLNFLDELDTLSGQIVEFSELIPIYTTNIISRFIMNKRFTRDDPKVQFIGKTITNLTKSKDILQLILIMFPCFDTSSLFSKLVFLLNTKWKRFVTIENYFWEEIEEHRTNLDLTSEGEDLMDRFLIKQRQLKQSTGNVESFVDWQLIRNSVEIFIAGYETTSTTLNWCCLFMSKYPDIQEKVHKEISEIIGKERLPTMNDKKALNYTQAVMDE 363          
The following BLAST results are available for this feature:
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYP2C181.622e-4431.41cytochrome P450 family 2 subfamily C member 18 [So... [more]
CYP2B61.086e-4331.17cytochrome P450 family 2 subfamily B member 6 [Sou... [more]
CYP2C88.439e-4328.94cytochrome P450 family 2 subfamily C member 8 [Sou... [more]
CYP2C87.878e-4228.94cytochrome P450 family 2 subfamily C member 8 [Sou... [more]
CYP2E18.959e-4229.46cytochrome P450 family 2 subfamily E member 1 [Sou... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp-33C129.430e-3529.71CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C51.370e-3226.78CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-33C92.359e-3226.95CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A57.965e-3229.02CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
cyp-14A29.322e-3228.29CYtochrome P450 family [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18a15.662e-3528.36gene:FBgn0010383 transcript:FBtr0074610[more]
Cyp18a15.662e-3528.36gene:FBgn0010383 transcript:FBtr0074609[more]
Cyp303a11.667e-2826.80gene:FBgn0001992 transcript:FBtr0343812[more]
Cyp303a11.667e-2826.80gene:FBgn0001992 transcript:FBtr0080828[more]
Cyp304a14.362e-1924.52gene:FBgn0038095 transcript:FBtr0082691[more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2k223.537e-4230.87cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2n139.612e-4130.21cytochrome P450, family 2, subfamily N, polypeptid... [more]
cyp2k161.666e-4030.82cytochrome P450, family 2, subfamily K, polypeptid... [more]
cyp2aa112.511e-4030.64cytochrome P450, family 2, subfamily AA, polypepti... [more]
cyp2aa111.157e-3930.64cytochrome P450, family 2, subfamily AA, polypepti... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35b27.707e-5233.53solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b27.707e-5233.53solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b22.006e-5133.23solute carrier family 35 member B2 [Source:Xenbase... [more]
slc35b24.065e-5132.93solute carrier family 35 member B2 [Source:Xenbase... [more]
cyp2f17.141e-5132.63cytochrome P450 2K1 [Source:NCBI gene;Acc:10049047... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp2c666.102e-4432.27cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2e11.027e-4330.28cytochrome P450, family 2, subfamily e, polypeptid... [more]
Cyp2c653.967e-4331.56cytochrome P450, family 2, subfamily c, polypeptid... [more]
Cyp2f25.478e-4330.00cytochrome P450, family 2, subfamily f, polypeptid... [more]
Cyp2b191.514e-4230.35cytochrome P450, family 2, subfamily b, polypeptid... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24460|CP2BB_CANLF8.704e-4632.28Cytochrome P450 2B11 OS=Canis lupus familiaris OX=... [more]
sp|Q29510|CP2CU_RABIT7.139e-4530.46Cytochrome P450 2C30 OS=Oryctolagus cuniculus OX=9... [more]
sp|P20678|CP2H2_CHICK1.261e-4433.65Cytochrome P450 2H2 OS=Gallus gallus OX=9031 GN=CY... [more]
sp|O62671|CP241_CANLF1.575e-4432.76Cytochrome P450 2C41 OS=Canis lupus familiaris OX=... [more]
sp|P05182|CP2E1_RAT3.874e-4429.20Cytochrome P450 2E1 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4P8NYX57.882e-13657.60P450 2B-like protein OS=Dugesia japonica OX=6161 G... [more]
A0A2U8U4731.535e-12254.07Cytochrome P450 2K1-like protein OS=Dugesia japoni... [more]
A0A5G3HWX31.210e-4833.53Solute carrier family 35 member B2 OS=Xenopus trop... [more]
A0A267DEG01.215e-4833.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
S7NQY21.470e-4832.12Cytochrome P450 2C23 OS=Myotis brandtii OX=109478 ... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000003264.24.619e-4232.14cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000041981.15.661e-4232.14cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000007200.27.664e-4232.14cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
cyp2n138.704e-4130.49cytochrome P450 2J6-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000048857.18.747e-4132.14cytochrome P450 2B4-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011254.13.267e-3931.51pep scaffold:Pmarinus_7.0:GL479221:5463:6953:-1 ge... [more]
ENSPMAT00000011204.13.877e-3830.56pep scaffold:Pmarinus_7.0:GL477378:78074:79555:1 g... [more]
ENSPMAT00000011205.13.658e-3531.94pep scaffold:Pmarinus_7.0:GL477378:108537:110066:1... [more]
ENSPMAT00000001876.11.360e-3028.83pep scaffold:Pmarinus_7.0:GL477372:10316:22460:-1 ... [more]
ENSPMAT00000010591.19.473e-2931.72pep scaffold:Pmarinus_7.0:GL479221:22742:24427:1 g... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481912.445e-2725.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409303.433e-2224.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466053.815e-2225.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482071.337e-2125.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294037.562e-2126.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000018818.25.413e-4833.84cytochrome P450 2J2 [Source:NCBI gene;Acc:10115776... [more]
ENSORLT00000018724.22.368e-4232.93cytochrome P450 2J1 [Source:NCBI gene;Acc:10535399... [more]
cyp2p33.783e-4233.03cytochrome P450 2P3 [Source:NCBI gene;Acc:10030245... [more]
ENSORLT00000020799.24.102e-4132.38cytochrome P450 2J6 [Source:NCBI gene;Acc:10115541... [more]
ENSORLT00000029062.11.024e-4029.84cytochrome P450 2F3 [Source:NCBI gene;Acc:10115714... [more]
back to top
BLAST of Cytochrome P450 2K1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072594.10.000e+098.84SMESG000072594.1[more]
SMESG000078091.14.897e-16664.06SMESG000078091.1[more]
SMESG000078092.12.843e-16262.61SMESG000078092.1[more]
SMESG000078100.11.882e-15660.87SMESG000078100.1[more]
SMESG000078098.11.266e-15560.00SMESG000078098.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018042 ID=SMED30018042|Name=Cytochrome P450 2K1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1216bp
GTAAATATATCAGAATTTCTATATTTAGCATCTAATTGTTCTCTGAATGC
GCAATTTAAGTGCCGATGCCATAGGACCATTTGCAATATAAATTGCTACC
ATTTACATCAGGCTCACTTCAACTGCAAAAATGGACCTAATTTACTATGT
TGTTTTTCTTTTAATTTTTGTATTTGTCTACTTCTGGACGTTCAAGAAAG
ATCGGTTACCGAACGGACAGAGAGAAGTTCCAACTGCATACGGCTTGCCT
CTCATTGGGGTGATCCATAAAATTAAACCGACATTGCCTTATTATTTACT
GAGACTCGGGAAAGAACTTGGGCCGATATTCAGCATAAAATTAGGAATGA
GAAAGGTTTTTGTGCTCAACAGTTATGACTCAATCAAAAAGGCCCTCGTG
GATGATGGATATAATTTTTCAGGTCGATGGAAAACGACATTTTTTTCTGA
TTTCATACATGATTCAGGAGTCCTTTTCACAGATGGAAAATTATGGGAAA
CTCAGAGATCTTTCATTTTGAATGTTCTCCGAGATTTTGGTTTCGGGAAA
TCTAGATCTGTTGAAATGGTTCAAGAAGAATGTTCAAATTTTATTGAAGA
ATTAGATACCCTAGTGAGCCAGACTCTTAATTTCTCAACTTTGATTCCCA
TCTATTCTATGAACATAATATCAAGATTCATCACAAATAGACGGTACACA
AGAGACGATCCAATGATTCAGTTAATTGAAGAATCAGGAAGAAAAGTATT
AACAAACAAAGATAAAGCCCAATTTATTTTGCTAATGTTTCCAATCTTTG
AGCAGTCCACCTTGTTTGCTAAGTTTATGCAACTTACTTCTTCATGGAAA
TCCCTTATCCCAGTACAAGAGTACTTTGCGGAAATTATTGAGGAGCATCG
AGAAGCTCTTGACTTCAATTCTGAAGGAGAAGATCTAATCGACCGATTTC
TAATAAACCAACATCAACTGCAACAACGAAATGGGAATATAGAAACTTTC
AACAATTGGCAAATGATTCGAAATGCCTCTGAACTCTTTATCGCAGGATC
TGAAACAAGTTCAACAACGCTTACTTGGAGTTGCTTATTCATGTCTAGAT
ACCCTGACATTCAGAAAAAGGTTCATAATGAAATTGTAGAAATAATCGGG
AGAGAACGCCTACCGACGATGAATGACAAAAGATCACTAAATTATACTCA
AGCTGTAATGGATGAA
back to top

protein sequence of SMED30018042-orf-1

>SMED30018042-orf-1 ID=SMED30018042-orf-1|Name=SMED30018042-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MDLIYYVVFLLIFVFVYFWTFKKDRLPNGQREVPTAYGLPLIGVIHKIKP
TLPYYLLRLGKELGPIFSIKLGMRKVFVLNSYDSIKKALVDDGYNFSGRW
KTTFFSDFIHDSGVLFTDGKLWETQRSFILNVLRDFGFGKSRSVEMVQEE
CSNFIEELDTLVSQTLNFSTLIPIYSMNIISRFITNRRYTRDDPMIQLIE
ESGRKVLTNKDKAQFILLMFPIFEQSTLFAKFMQLTSSWKSLIPVQEYFA
EIIEEHREALDFNSEGEDLIDRFLINQHQLQQRNGNIETFNNWQMIRNAS
ELFIAGSETSSTTLTWSCLFMSRYPDIQKKVHNEIVEIIGRERLPTMNDK
RSLNYTQAVMDE
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036396Cyt_P450_sf
IPR002401Cyt_P450_E_grp-I
IPR001128Cyt_P450
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0020037heme binding
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0019825oxygen binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002401Cytochrome P450, E-class, group IPRINTSPR00463EP450Icoord: 84..105
score: 31.07
coord: 314..340
score: 35.48
coord: 294..311
score: 32.71
coord: 60..79
score: 35.41
coord: 175..193
score: 24.84
coord: 357..362
score: 13.77
IPR036396Cytochrome P450 superfamilyGENE3DG3DSA:1.10.630.10coord: 23..362
e-value: 1.3E-72
score: 247.2
IPR036396Cytochrome P450 superfamilySUPERFAMILYSSF48264Cytochrome P450coord: 34..362
IPR001128Cytochrome P450PFAMPF00067p450coord: 37..362
e-value: 4.8E-54
score: 183.8
NoneNo IPR availablePANTHERPTHR24300FAMILY NOT NAMEDcoord: 4..362
NoneNo IPR availablePANTHERPTHR24300:SF315CYTOCHROME P450 18A1coord: 4..362
NoneNo IPR availableTMHMMTMhelixcoord: 4..21