TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30018039
Length (bp)829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30018039) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30018039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30018039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30018039SMESG000027280.1 SMESG000027263.1 SMESG000026967.1 SMESG000026956.1 SMESG000026954.1 SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025794.1 SMESG000025583.1 SMESG000025517.1 SMESG000025934.1 SMESG000025926.1 SMESG000025797.1 Contig3847GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30018039SMESG000025998.1 SMESG000025982.1 SMESG000025980.1 SMESG000025963.1 SMESG000025934.1 SMESG000025901.1 SMESG000025797.1 SMESG000025794.1 SMESG000025517.1 dd_Smed_v4_1139_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 100.138 bits (248), Expect = 3.296e-23
Identity = 47/117 (40.17%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L  K+ Q+++     D +M +++ K+LE  A+     +G F+WK+  F  K  +A  G    I+S +F T + G+KMCLR+  +GDG G+GTHLS+FF +MKG  D +L WPF
Sbjct:  313 KIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEAST---YDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPF 426          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 96.6709 bits (239), Expect = 4.528e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  208 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 407          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 96.6709 bits (239), Expect = 5.505e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  266 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 465          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 96.6709 bits (239), Expect = 5.505e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  266 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 465          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 96.2857 bits (238), Expect = 7.207e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  291 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 490          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 79.7221 bits (195), Expect = 1.147e-16
Identity = 37/116 (31.90%), Postives = 62/116 (53.45%), Query Frame = 2
Query:  371 LIDKIGQMKKKQNEIDKSMDNVD---MKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L D+I  +K     +++ M + +    ++L  A    +    + +WK+DK   +  +AK G +  I+S  F++H+ G+KM       GDG   G  +S++  L+KGEFD  LEWPF
Sbjct:  222 LCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPF 337          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 68.1662 bits (165), Expect = 5.061e-13
Identity = 32/91 (35.16%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  440 MKLLETAANQNQRINGEFVWKLDKFTDKMADAKKG-INAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++ +  A +  ++   +  +++ K    +  A K   +  IYS+ F +H  G+KM     P GDG+    + SVF CLMKGE+D ILEWPF
Sbjct:  143 LQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPF 233          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 68.1662 bits (165), Expect = 1.121e-12
Identity = 30/93 (32.26%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  440 MKLLETAANQ-NQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            +++L++A ++ +    G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G+G G+ TH+SV+  ++ GE+D +L+WPFSH
Sbjct:  315 IQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH 407          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 68.1662 bits (165), Expect = 1.171e-12
Identity = 30/93 (32.26%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  440 MKLLETAANQ-NQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            +++L++A ++ +    G  +WK+  ++ KMA+A+      + S  F T + G+K+   +  +G+G G+ TH+SV+  ++ GE+D +L+WPFSH
Sbjct:  306 IQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSH 398          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 51.9878 bits (123), Expect = 1.960e-7
Identity = 21/78 (26.92%), Postives = 43/78 (55.13%), Query Frame = 2
Query:  473 QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 706
            Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 51.9878 bits (123), Expect = 1.960e-7
Identity = 21/78 (26.92%), Postives = 43/78 (55.13%), Query Frame = 2
Query:  473 QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 706
            Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0334036)

HSP 1 Score: 51.9878 bits (123), Expect = 1.960e-7
Identity = 21/78 (26.92%), Postives = 43/78 (55.13%), Query Frame = 2
Query:  473 QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWP 706
            Q I G  +W++  ++ K+ ++K+  + I++S  F     G+ + L +  +G G  KG ++     ++ GE+D +L WP
Sbjct:  251 QNIRGHLIWRIKDYSKKLEESKQ-YDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWP 327          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 100.908 bits (250), Expect = 9.130e-25
Identity = 45/115 (39.13%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQ----RINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            DKI  +  K  ++++++   D+ ++E  A   +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:   86 DKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 100.908 bits (250), Expect = 9.130e-25
Identity = 45/115 (39.13%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQ----RINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            DKI  +  K  ++++++   D+ ++E  A   +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:   86 DKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 99.7525 bits (247), Expect = 2.857e-24
Identity = 48/129 (37.21%), Postives = 80/129 (62.02%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQS 733
            K + L +K+ Q++++    D ++  ++ +L E +A      +G F+W++  FT K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF+     + +DQS
Sbjct:   93 KIEALSNKVRQLERQVGVKDLTVAEMEGRLREMSATT---FDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQS 218          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 101.293 bits (251), Expect = 8.143e-24
Identity = 43/116 (37.07%), Postives = 76/116 (65.52%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFS 712
            +KI  +  K  ++++++   D++L E+  +    Q    +G F+WK+ +F+ +  DA  G    ++S +F + K G+KMCLR+  +GDG G+G+HLS+FF +MKG++D +L+WPFS
Sbjct:  343 EKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFS 458          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 101.293 bits (251), Expect = 8.143e-24
Identity = 43/116 (37.07%), Postives = 76/116 (65.52%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFS 712
            +KI  +  K  ++++++   D++L E+  +    Q    +G F+WK+ +F+ +  DA  G    ++S +F + K G+KMCLR+  +GDG G+G+HLS+FF +MKG++D +L+WPFS
Sbjct:  343 EKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFS 458          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 100.523 bits (249), Expect = 7.930e-24
Identity = 48/122 (39.34%), Postives = 73/122 (59.84%), Query Frame = 2
Query:  356 IKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLE--TAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            IK   L     Q++  +  +  +M ++ +  LE  +A  +    +G F+WK+   T+K  DA  G    +YS +F T K G+K+CLR+  +GDG GKGTH+S+FF +MKGE+D +L WPF H
Sbjct:  187 IKTPPLFPPSPQVENLRCTL--AMKDIVLNELEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKH 306          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 92.8189 bits (229), Expect = 9.261e-21
Identity = 68/228 (29.82%), Postives = 114/228 (50.00%), Query Frame = 2
Query:   47 ELLRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++L N++   +++ +R +         I  LQR    QA++++ L+++I   RN+ R   D  DG           M++     Q +++Q     K A S      + +       I++  QM    +     MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  259 QILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI---RNL-RQTGDEADG-----------MKSNYESLQNRLSQLEVMAKNAASWNPGVLETQ-------INRHDQMLSVHDIRLADMD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 458          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 92.4337 bits (228), Expect = 1.079e-20
Identity = 45/126 (35.71%), Postives = 75/126 (59.52%), Query Frame = 2
Query:  338 ANQIREIKQK--ELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            A Q+R  ++K   L  K+ Q+++   + +  +  ++ ++ E+  +     +G F+WK+ +F  K  DA  G    ++S  F T+K G+KMCLR+  +GDG G+ THLS+FF +MKG  D +L WPF
Sbjct:  284 ARQLRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELST---YDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPF 406          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 92.8189 bits (229), Expect = 1.096e-20
Identity = 68/236 (28.81%), Postives = 115/236 (48.73%), Query Frame = 2
Query:   47 ELLRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQA--------ESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++L N++   +++ +R +         I  LQR    QA++++ L+++I   RN+ R   D  DG           M++     Q +++Q     K A        E++ +  +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  284 QILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEI---RNL-RQTGDEADG-----------MKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 483          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 89.3521 bits (220), Expect = 1.191e-19
Identity = 41/111 (36.94%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  389 QMKKKQNEIDKSMDNVDMKL--LETAANQNQ--RINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            Q++     +++++   ++ +  LET   +++    +G F+WK+ +F  K  DA  G    ++S  F T+K G+KMCLR+  +GDG G+ THLS+FF +MKG  D +L WPF
Sbjct:  269 QLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPF 379          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 100.908 bits (250), Expect = 1.161e-23
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L +K+ Q+++     D +M +++ K+ E   +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  320 KIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 433          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 100.908 bits (250), Expect = 1.206e-23
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L +K+ Q+++     D +M +++ K+ E   +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  313 KIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 426          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 96.6709 bits (239), Expect = 3.236e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  265 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 464          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 96.6709 bits (239), Expect = 3.236e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  265 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 464          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 96.6709 bits (239), Expect = 4.323e-22
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  290 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 489          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 8.435e-23
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L +K+ Q+++     D +M +++ K+ E   +     +G F+WK+  FT K  +A  G    I+S +F T + G+KMCLRV  +GDG G+GTHLS+FF +MKG  D +L+WPF
Sbjct:  313 KIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVST---YDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPF 426          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 1.583e-22
Identity = 47/117 (40.17%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L  K+ Q+++     D +M +++ K+LE  A+     +G F+WK+  F  K  +A  G    I+S +F T + G+KMCLR+  +GDG G+GTHLS+FF +MKG  D +L WPF
Sbjct:  313 KIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEAST---YDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPF 426          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 3.024e-21
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  290 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 489          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 3.461e-21
Identity = 68/226 (30.09%), Postives = 113/226 (50.00%), Query Frame = 2
Query:   53 LRNEINELKLDGDRRR-------VEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L N+I   +++ +R++        +I  LQR    QAE+++ L+++I   R       +  D ++  +E  Q  +  +E+   +   Q A N    ES+    +Q+  +    L D               MD +  ++LETA+      NG  +WK+  +  +  +A  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  291 LHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQN----WEEADSMKSSVESLQNRVTELES-VDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLAD---------------MD-LRFQVLETAS-----YNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF 490          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 1.076e-18
Identity = 37/90 (41.11%), Postives = 57/90 (63.33%), Query Frame = 2
Query:  440 MKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
             KLLE         NG+ +WK+  +  K  +A  G    I+S+SF T + G+++C R   +GDG G+G+HLS++F +M+GEFD +L+WPF
Sbjct:  394 FKLLEGTC-----YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPF 478          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.123e-39
Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGL 223
            MEMLKANNNGLS VNELLRNEINELKLDGDRRRVEIGDLQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGL
Sbjct:  104 MEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGL 177          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: X1ZK62 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.094e-23
Identity = 55/166 (33.13%), Postives = 99/166 (59.64%), Query Frame = 2
Query:  230 IIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDK--IGQMKKKQNEIDK--SMDNVDMKLLET--AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++E     + ++ N +Q++I +             N + I  ++++  +D+  +  M+KK  ++++  SM ++++K +E   ++ +N   +G ++WKL  F+ K  DA  G    +YSE F THK G++MC+R+  +GDG+GKGTHLS+FF LM+G  D +L WPF
Sbjct:  200 VLESKTKTLASLCNVYQREIKK-------------NQDSIATLERQRRLDRELLDAMEKKCRDLERIVSMSDINLKEVELRLSSMENVSYDGRYLWKLSDFSRKRQDAIDGRTTSLYSEPFFTHKTGYRMCVRLYLNGDGLGKGTHLSLFFVLMRGPCDSLLPWPF 352          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3S0ZA40 (MATH domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_022039 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.278e-23
Identity = 52/163 (31.90%), Postives = 92/163 (56.44%), Query Frame = 2
Query:  281 QQIAQCATNCKQAESKFHNANQIREIKQ-----KELIDKIGQMKKKQNEIDKSMDNVDMK--LLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQSA 736
            ++I Q      + ++      Q++++ Q     K LI ++    ++    +  M  +D++  +LETA+      +G  +WK+  F+ +  DA +G    +YS+ F   + G+KMC R+  +GDG+G+GTH+S++F +MKGE+D +L WPF H    I +DQSA
Sbjct:    6 ERIMQLEQKTDELQTSLREIPQVQQLHQSVEQLKGLIPQLSNHDRQVATHEIRMAEMDLRFQMLETAS-----YDGRLLWKIRDFSHRKRDAVQGRTVSLYSQPFYAGRFGYKMCARIYLNGDGIGRGTHMSLYFVVMKGEYDALLPWPFQHRVSLILLDQSA 163          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7UQ34 (MATH domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.731e-23
Identity = 50/125 (40.00%), Postives = 76/125 (60.80%), Query Frame = 2
Query:  362 QKELIDKIGQMKKKQNEIDKSMDNVDMKLLET-------AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            Q EL  K  Q+   Q+++ +    +  K+ E        +  +N   +G  VWK+ +F+ +M DA+ G    I+S  F + + G+KMCLR+   GDG+GKGTH+S+FF +MKGEFD IL+WPF+H
Sbjct:  149 QAELTKKDSQIHTLQDKVAQLETTLSTKMSENEDRDFRLSLMENSNFDGSMVWKIPQFSQRMDDARTGKYTSIFSLPFYSSRYGYKMCLRLYILGDGIGKGTHMSLFFVVMKGEFDNILQWPFTH 273          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1X7UQ51 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 GN=109582571 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.399e-22
Identity = 50/125 (40.00%), Postives = 76/125 (60.80%), Query Frame = 2
Query:  362 QKELIDKIGQMKKKQNEIDKSMDNVDMKLLET-------AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            Q EL  K  Q+   Q+++ +    +  K+ E        +  +N   +G  VWK+ +F+ +M DA+ G    I+S  F + + G+KMCLR+   GDG+GKGTH+S+FF +MKGEFD IL+WPF+H
Sbjct:  285 QAELTKKDSQIHTLQDKVAQLETTLSTKMSENEDRDFRLSLMENSNFDGSMVWKIPQFSQRMDDARTGKYTSIFSLPFYSSRYGYKMCLRLYILGDGIGKGTHMSLFFVVMKGEFDNILQWPFTH 409          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 98.9821 bits (245), Expect = 4.318e-23
Identity = 43/116 (37.07%), Postives = 74/116 (63.79%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFS 712
            +KI  +  K  ++++++   D++L E+       Q    +G FVWK+  F+ +  DA  G    ++S +F + K G+KMCLR+  +GDG G+G+HLS+FF +M+G++D +L+WPFS
Sbjct:  342 EKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFS 457          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 98.2117 bits (243), Expect = 6.563e-23
Identity = 44/115 (38.26%), Postives = 70/115 (60.87%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQ----RINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            DKI  +  K  ++++++   D+ ++E      +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  270 DKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 384          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 98.5969 bits (244), Expect = 7.249e-23
Identity = 44/115 (38.26%), Postives = 70/115 (60.87%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQ----RINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            DKI  +  K  ++++++   D+ ++E      +      +G FVWK+  F+ K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  383 DKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 497          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 93.9745 bits (232), Expect = 2.318e-21
Identity = 37/84 (44.05%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  458 AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            +A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   GDGVGKGTH+S+FF +MKG++D +L WPF
Sbjct:  383 SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPF 466          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 93.9745 bits (232), Expect = 2.440e-21
Identity = 37/84 (44.05%), Postives = 58/84 (69.05%), Query Frame = 2
Query:  458 AANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            +A Q+   +G F+W++   + K+ +A  G  +  YS +F T + GFK+C+R+   GDGVGKGTH+S+FF +MKG++D +L WPF
Sbjct:  360 SAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPF 443          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 2.522e-23
Identity = 42/100 (42.00%), Postives = 63/100 (63.00%), Query Frame = 2
Query:  416 DKSMDNVDMK--LLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            D  +  +D++  +LETA+      NG+ VWK+  +  +  DA  G    +YS+ F T   G++MC R   +GDGVG+GTHLS+FF +M+GE+D +L WPF
Sbjct:  305 DTRLAEMDLRFQVLETAS-----YNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPF 399          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 2.871e-23
Identity = 40/90 (44.44%), Postives = 59/90 (65.56%), Query Frame = 2
Query:  440 MKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            +++LETA       +G+ VWK+  +  +  +A  G    +YS+ F T   G+KMC R   +GDGVG+GTHLS+FF +M+GE+D +LEWPF
Sbjct:  258 LQVLETAG-----YSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPF 342          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 4.722e-9
Identity = 30/115 (26.09%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  371 LIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGI--NAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            L +K+ +++    E ++S+  +  +L E    +N   NG F+WK+    +++ +A  G      I S +F T + G+++ LR+         G H+S +  L  G +D  L WP+
Sbjct:  290 LQNKMARVEHSDQETERSILGLTRRLAEL---ENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRL------CRSGEHVSAYAMLGPGPYDATLAWPY 395          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 55.0694 bits (131), Expect = 5.373e-9
Identity = 35/146 (23.97%), Postives = 69/146 (47.26%), Query Frame = 2
Query:  341 NQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMAD------AKKGIN----AIIYSESFLTHKNGFKMCLRVD-------PDGDG------VGKGTHLSVFFCLMKGEFDGILEWPF 709
            +QIRE+  K   D    +  +   + +S++         A ++++   G F W++++F+  +        A  G++    A+++S  F T   G+++CLR+        P G         G+  HL++F  L++G++D  L WPF
Sbjct:  353 HQIRELSAK--TDNQQGLLAEATRLVRSLEA------RVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPF 490          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 101.679 bits (252), Expect = 1.699e-24
Identity = 44/111 (39.64%), Postives = 69/111 (62.16%), Query Frame = 2
Query:  389 QMKKKQNEIDKSMDNVDMKL----LETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++ ++ ++++ S+     KL    L     Q    +G F+WK+DKFT++ A+AK G    IYS  F TH+ G+K+C R+ P+GDG  +  +LS+F  LM+GE+D IL WPF
Sbjct:  344 KLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPF 454          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 101.293 bits (251), Expect = 2.511e-24
Identity = 40/101 (39.60%), Postives = 65/101 (64.36%), Query Frame = 2
Query:  407 NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            ++I  +  ++ +++LE  +      +G ++WK+D++T +  +   G    IYS  F   + G+K C RV P+GDG+GKG+HLS+FF LM+GEFD +L WPF
Sbjct:  357 HDIQLAEHDLKLQMLEATS-----YDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPF 452          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 88.1965 bits (217), Expect = 6.945e-20
Identity = 43/120 (35.83%), Postives = 73/120 (60.83%), Query Frame = 2
Query:  356 IKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            ++QKE +D   Q  ++   I K +D+    L + A +Q        +W+++ +T K+ +AK G    ++S +F T K+G+++C  V  +GDG GKGTH+SVF  ++KG FD +L+WPF +
Sbjct:  270 LEQKEKLDNHAQKFEEHETIMKQVDSRVGDLEKIAHSQ-------IIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHY 382          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 87.0409 bits (214), Expect = 1.573e-19
Identity = 36/92 (39.13%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  482 NGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH----ICIDQSAHPT 745
            + + +W+++ +T KM +AK G    ++S +F T K+G+++C  V  +GDG GKGTH+SVF  ++KG FD +L+WPF +    + +DQ+  P 
Sbjct:  301 HSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPA 392          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 85.5001 bits (210), Expect = 5.968e-19
Identity = 48/143 (33.57%), Postives = 76/143 (53.15%), Query Frame = 2
Query:  320 ESKFHNANQIREI-----KQKELIDKIGQMKKKQNEIDKSMDN----VDMKLLETAANQ----NQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            E+ F +AN  RE+     +  E    +  +++K  ++  S D     +  KL+     +     +  NG F+WKLD F      +  G+ A I+S  F T   G+KMCLR++ +G   G G H+S+F  +M+G++DGILEWPF
Sbjct:  264 EALFQSANMQREVDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPF 406          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 99.7525 bits (247), Expect = 3.006e-23
Identity = 44/115 (38.26%), Postives = 69/115 (60.00%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAANQN----QRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            DKI  +  K  ++++++   D+ ++E             +G F+WK+  FT K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  380 DKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPF 494          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 97.4413 bits (241), Expect = 1.975e-22
Identity = 45/117 (38.46%), Postives = 72/117 (61.54%), Query Frame = 2
Query:  359 KQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            K + L +K+ Q+++     D ++  ++ +L E AA      +G F+W++  F  K  DA  G    ++S +F T K G+KMCLR+  +GDG G+GTHLS+FF +M+G  D +L+WPF
Sbjct:  408 KIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATT---FDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPF 521          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 95.9005 bits (237), Expect = 4.389e-22
Identity = 43/116 (37.07%), Postives = 72/116 (62.07%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFS 712
            +KI  +  K  ++++S+   D++L E        Q    +G FVWK+  F+ +  +A  G    ++S +F + K G+KMCLR+  +GDG G+GTHLS+FF +M+ ++D +L+WPFS
Sbjct:  327 EKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFS 442          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 95.9005 bits (237), Expect = 4.929e-22
Identity = 43/116 (37.07%), Postives = 72/116 (62.07%), Query Frame = 2
Query:  377 DKIGQMKKKQNEIDKSMDNVDMKLLETAAN----QNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFS 712
            +KI  +  K  ++++S+   D++L E        Q    +G FVWK+  F+ +  +A  G    ++S +F + K G+KMCLR+  +GDG G+GTHLS+FF +M+ ++D +L+WPFS
Sbjct:  334 EKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFS 449          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 93.9745 bits (232), Expect = 1.662e-21
Identity = 43/101 (42.57%), Postives = 64/101 (63.37%), Query Frame = 2
Query:  407 NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPF 709
            +EI  +  ++  ++LETA+      NG  +WK+  +  +  DA  G    +YS+ F T   G+KMC RV  +GDG+GKGTHLS+FF +M+GE+D +L WPF
Sbjct:  277 HEIRLADMDLRFQVLETAS-----YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPF 372          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025934.1 (SMESG000025934.1)

HSP 1 Score: 444.506 bits (1142), Expect = 3.394e-157
Identity = 224/259 (86.49%), Postives = 231/259 (89.19%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQ--------NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSAHPTASC 754
            MEMLKANNNGLSAVNELLRNEINELKLDG+RRR EI +LQ KCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC+QAE           IKQKELIDKIGQM+ KQ        N+IDKS  NVD KLLE AANQNQRINGEF+WKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSA PTA+C
Sbjct:  170 MEMLKANNNGLSAVNELLRNEINELKLDGERRREEIAELQMKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQAE-----------IKQKELIDKIGQMENKQKVDLTEMSNKIDKSSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSADPTATC 417          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025980.1 (SMESG000025980.1)

HSP 1 Score: 404.445 bits (1038), Expect = 1.616e-140
Identity = 207/246 (84.15%), Postives = 213/246 (86.59%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQ--------NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            ME+LKANNNGLS VNELLRNEINELKLDGDRRRVEIGDLQRKCA+QAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNC+QA           EIKQKELIDKIGQM+ KQ        N+IDK   NVD KLLE AANQNQRINGEF+WKLDKFTDKMADAKKGINA IYSESFLTHKNGFKMCL V PDGDG GKG HLSVFF LMKGEFDGILEWPF H
Sbjct:  171 MEILKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCQQA-----------EIKQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKKGINAFIYSESFLTHKNGFKMCLSVYPDGDGGGKGNHLSVFFHLMKGEFDGILEWPFRH 405          

HSP 2 Score: 74.3294 bits (181), Expect = 8.121e-15
Identity = 31/41 (75.61%), Postives = 37/41 (90.24%), Query Frame = 3
Query:  705 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDRNGG 827
            HSVTFALINQRTRLPHVS+  +CA+YPN++ +IQPTDRN G
Sbjct:  405 HSVTFALINQRTRLPHVSKITECANYPNNKEFIQPTDRNAG 445          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027308.1 (SMESG000027308.1)

HSP 1 Score: 395.971 bits (1016), Expect = 2.774e-137
Identity = 201/238 (84.45%), Postives = 210/238 (88.24%), Query Frame = 2
Query:    2 MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSH 715
            MEMLKANN  LSA       EIN LKLD +R +VEIGDLQRKCADQ EEIELLNEDIPALRN DR++SDRLDGLQL +EGNQVAMRA EN+ QQQIAQCATNCKQAESKFHNANQIREIKQKELIDKI QM+KKQNEIDKSMDNVDMKLLETAANQNQ   GEFVWKLDKFTDKMADAKKGIN  IYSESFLTHKNG+KMCL VDPDG+G GKGTHLSVFF LMKGEFD ILEWPF H
Sbjct:  171 MEMLKANNKELSA-------EINGLKLDRERMQVEIGDLQRKCADQVEEIELLNEDIPALRNADRSMSDRLDGLQLNVEGNQVAMRACENNLQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIDQMEKKQNEIDKSMDNVDMKLLETAANQNQLNYGEFVWKLDKFTDKMADAKKGINTHIYSESFLTHKNGYKMCLLVDPDGNGGGKGTHLSVFFHLMKGEFDDILEWPFRH 401          

HSP 2 Score: 85.1149 bits (209), Expect = 1.438e-18
Identity = 38/41 (92.68%), Postives = 39/41 (95.12%), Query Frame = 3
Query:  705 HSVTFALINQRTRLPHVSETVKCADYPNDEAYIQPTDRNGG 827
            HSVTFALINQRTRLPHVS T KCADYPN+EAYIQPTDRNGG
Sbjct:  401 HSVTFALINQRTRLPHVSWTEKCADYPNEEAYIQPTDRNGG 441          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026967.1 (SMESG000026967.1)

HSP 1 Score: 368.622 bits (945), Expect = 6.745e-130
Identity = 180/229 (78.60%), Postives = 199/229 (86.90%), Query Frame = 2
Query:   92 RRRVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQ--------NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSAHPTASC 754
            +++VEI DLQRKCA QAE+I+LLN +IPALRNVD NVSDRLDGLQL +EGNQ+A+RA EN+ QQQIAQC TN +QAESKFH+ANQ+REIKQKELIDKIGQM+ KQ        N+I+KSM N D KLLE AANQNQRING FVWKLDKFTDKMA+AK GIN  IYS+SFLTHKNG+KMCLRVDPDG  V KGTHLSVFF LMKGEFDGILEWPFSHICIDQSAHPTASC
Sbjct:   19 QKKVEIADLQRKCAGQAEKIKLLNGEIPALRNVDMNVSDRLDGLQLNVEGNQLAIRACENNLQQQIAQCVTNYQQAESKFHSANQMREIKQKELIDKIGQMENKQKTDMTKISNKINKSMANADRKLLEMAANQNQRINGRFVWKLDKFTDKMANAKNGINTDIYSKSFLTHKNGYKMCLRVDPDGFDVYKGTHLSVFFHLMKGEFDGILEWPFSHICIDQSAHPTASC 247          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026967.1 (SMESG000026967.1)

HSP 1 Score: 367.851 bits (943), Expect = 9.136e-130
Identity = 181/227 (79.74%), Postives = 197/227 (86.78%), Query Frame = 2
Query:   98 RVEIGDLQRKCADQAEEIELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCATNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQ--------NEIDKSMDNVDMKLLETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKMCLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSAHPTASC 754
            RVEI DLQRKCA QAE+I+LLN +IPALRNVD NVSDRLDGLQL +EGNQ+A+RA EN+ QQQIAQC TN +QAESKFH+ANQ+REIKQKELIDKIGQM+ KQ        N+I+KSM N D KLLE AANQNQRING FVWKLDKFTDKMA+AK GIN  IYS+SFLTHKNG+KMCLRVDPDG  V KGTHLSVFF LMKGEFDGILEWPFSHICIDQSAHPTASC
Sbjct:    2 RVEIADLQRKCAGQAEKIKLLNGEIPALRNVDMNVSDRLDGLQLNVEGNQLAIRACENNLQQQIAQCVTNYQQAESKFHSANQMREIKQKELIDKIGQMENKQKTDMTKISNKINKSMANADRKLLEMAANQNQRINGRFVWKLDKFTDKMANAKNGINTDIYSKSFLTHKNGYKMCLRVDPDGFDVYKGTHLSVFFHLMKGEFDGILEWPFSHICIDQSAHPTASC 228          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF23.296e-2340.17TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF34.528e-2230.09TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.505e-2230.09TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.505e-2230.09TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF37.207e-2230.09TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.147e-1631.90TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-25.061e-1335.16TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf41.121e-1232.26gene:FBgn0026319 transcript:FBtr0077429[more]
Traf41.171e-1232.26gene:FBgn0026319 transcript:FBtr0334401[more]
Traf-like1.960e-726.92gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like1.960e-726.92gene:FBgn0030748 transcript:FBtr0074274[more]
Traf-like1.960e-726.92gene:FBgn0030748 transcript:FBtr0334036[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX901915.19.130e-2539.13pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.19.130e-2539.13pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
unm_sa8082.857e-2437.21un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2b8.143e-2437.07Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.143e-2437.07Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hspb67.930e-2439.34heat shock protein family B (small) member 6 [Sour... [more]
ssh29.261e-2129.82slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.079e-2035.71TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh21.096e-2028.81slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.191e-1936.94TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf21.161e-2340.17TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.206e-2340.17TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf33.236e-2230.09TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.236e-2230.09TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf34.323e-2230.09TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE8.435e-2340.17TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.583e-2240.17TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q60803|TRAF3_MOUSE3.024e-2130.09TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN3.461e-2130.09TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|O00463|TRAF5_HUMAN1.076e-1841.11TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWW34.123e-3997.30TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
X1ZK621.094e-2333.13Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3S0ZA401.278e-2331.90MATH domain-containing protein OS=Elysia chlorotic... [more]
A0A1X7UQ342.731e-2340.00MATH domain-containing protein OS=Amphimedon queen... [more]
A0A1X7UQ511.399e-2240.00Uncharacterized protein OS=Amphimedon queenslandic... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b4.318e-2337.07TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a6.563e-2338.26TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a7.249e-2338.26TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf12.318e-2144.05TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf12.440e-2144.05TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.12.522e-2342.00pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.12.871e-2344.44pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000008091.14.722e-926.09pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf65.373e-923.97TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.699e-2439.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.511e-2439.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328496.945e-2035.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.573e-1939.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487735.968e-1933.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.23.006e-2338.26TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.975e-2238.46TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b4.389e-2237.07TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.929e-2237.07TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf31.662e-2142.57TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025934.13.394e-15786.49SMESG000025934.1[more]
SMESG000025980.11.616e-14084.15SMESG000025980.1[more]
SMESG000027308.12.774e-13784.45SMESG000027308.1[more]
SMESG000026967.16.745e-13078.60SMESG000026967.1[more]
SMESG000026967.19.136e-13079.74SMESG000026967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018039 ID=SMED30018039|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=829bp
AATGGAGATGTTGAAGGCCAATAATAACGGATTGAGCGCAGTGAATGAAT
TATTGCGAAATGAAATCAACGAATTGAAATTGGATGGCGACAGGAGACGA
GTTGAAATTGGAGATTTGCAGAGGAAATGTGCCGATCAAGCTGAGGAAAT
CGAATTACTGAATGAAGACATTCCGGCATTGAGGAATGTAGATAGAAATG
TGAGCGATAGATTGGATGGATTGCAATTGATTATCGAGGGCAACCAGGTG
GCCATGCGAGCAGTTGAGAACGATTTCCAGCAACAAATTGCCCAATGCGC
CACCAACTGCAAGCAAGCAGAAAGCAAATTTCACAATGCAAATCAAATTA
GAGAAATTAAACAAAAAGAATTGATTGACAAAATCGGTCAAATGAAAAAG
AAACAAAATGAAATCGATAAATCAATGGACAATGTCGACATGAAATTATT
GGAAACGGCAGCCAATCAAAATCAGCGGATAAATGGAGAATTTGTGTGGA
AGCTCGACAAATTCACTGACAAAATGGCAGACGCAAAAAAGGGAATCAAC
GCAATCATTTATAGCGAATCATTTCTCACGCATAAAAATGGTTTCAAAAT
GTGTTTGCGTGTGGATCCTGATGGAGATGGTGTTGGCAAGGGCACTCATT
TGTCTGTGTTCTTTTGTTTGATGAAGGGCGAGTTTGATGGCATTTTGGAA
TGGCCATTCAGTCACATTTGCATTGATCAATCAGCGCACCCGACTGCCTC
ATGTTAGTGAGACTGTGAAATGTGCAGATTATCCAAATGATGAAGCATAT
ATCCAGCCAACAGATAGAAATGGGGGGAT
back to top

protein sequence of SMED30018039-orf-1

>SMED30018039-orf-1 ID=SMED30018039-orf-1|Name=SMED30018039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MEMLKANNNGLSAVNELLRNEINELKLDGDRRRVEIGDLQRKCADQAEEI
ELLNEDIPALRNVDRNVSDRLDGLQLIIEGNQVAMRAVENDFQQQIAQCA
TNCKQAESKFHNANQIREIKQKELIDKIGQMKKKQNEIDKSMDNVDMKLL
ETAANQNQRINGEFVWKLDKFTDKMADAKKGINAIIYSESFLTHKNGFKM
CLRVDPDGDGVGKGTHLSVFFCLMKGEFDGILEWPFSHICIDQSAHPTAS
C*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0033209tumor necrosis factor-mediated signaling pathway
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 1..124
e-value: 1.0E-40
score: 141.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 32..120
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 2..118
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 2..118
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 31..124
score: 14.612