SMED30018024
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30018024 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Alignments
SMED30018024 aligns in the following genomic locations:
Homology
BLAST of SMED30018024 vs. Ensembl Xenopus
Match: arrb2 (arrestin beta 2 [Source:NCBI gene;Acc:100101741]) HSP 1 Score: 45.4394 bits (106), Expect = 2.898e-6 Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 2 Query: 47 ISMSSDIQLELPFNLTHPNPEEDLT--VNTYDGLD--IFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 250 +S D+ +ELPF L HP P E+++ ++ Y D + N + F N+ QDDD++F DFARL+L Sbjct: 276 VSRGGDVAVELPFVLMHPKPPENISRPLSEYPQTDAPVDTNLIEFDTNF-------AQDDDIVFEDFARLRL 340
BLAST of SMED30018024 vs. Ensembl Cavefish
Match: arrb2b (arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1332]) HSP 1 Score: 45.0542 bits (105), Expect = 2.709e-6 Identity = 24/68 (35.29%), Postives = 33/68 (48.53%), Query Frame = 2 Query: 47 ISMSSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 250 +S D+ +ELPF L HP P E + G+ + N+ QDDD +F DFARL+L Sbjct: 323 VSRGGDVSVELPFVLMHPKPSEQPSSRPQSGM--------YATNF-------SQDDDFVFEDFARLRL 375
BLAST of SMED30018024 vs. Ensembl Nematostella
Match: EDO27814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T880]) HSP 1 Score: 44.669 bits (104), Expect = 2.320e-7 Identity = 27/76 (35.53%), Postives = 38/76 (50.00%), Query Frame = 2 Query: 47 ISMSSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDN----YEPISSQAEQDDDLIFVDFARLKLDVKD 262 ++ D+ LELPF L+HP P ED T N D+ ++ + + +DDLIF DFARL+L D Sbjct: 18 VAYGGDLTLELPFMLSHPKPCEDPTPPPTPAKQPSNNEQAAVDHNLIDFDTDGPEQDNNDDLIFEDFARLRLKGSD 93
BLAST of SMED30018024 vs. Ensembl Medaka
Match: arrb2a (arrestin beta 2 [Source:NCBI gene;Acc:101159286]) HSP 1 Score: 43.5134 bits (101), Expect = 8.631e-6 Identity = 23/68 (33.82%), Postives = 32/68 (47.06%), Query Frame = 2 Query: 47 ISMSSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 250 +S D+ +ELPF L HP P E G + + + + QDDD +F DFARL+L Sbjct: 330 VSRGGDVSVELPFILMHPKPVEPPLSRPQSGRSTRRRHYSGLELVSMETDHVSQDDDFVFEDFARLRL 397
BLAST of SMED30018024 vs. Planmine SMEST
Match: SMESG000078454.1 (SMESG000078454.1) HSP 1 Score: 142.895 bits (359), Expect = 4.445e-42 Identity = 70/70 (100.00%), Postives = 70/70 (100.00%), Query Frame = 2 Query: 56 SSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKLDVKDF 265 SSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKLDVKDF Sbjct: 351 SSDIQLELPFNLTHPNPEEDLTVNTYDGLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKLDVKDF 420
BLAST of SMED30018024 vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1) HSP 1 Score: 46.2098 bits (108), Expect = 6.566e-7 Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 2 Query: 56 SSDIQLELPFNLTHPNPEEDLTV--------NTYD--GLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 250 +SDIQLE+PF LTHPNP+ D + N D G+D N L F +Q+++ IF DFARL+L Sbjct: 341 TSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQF-----------KQEEEFIFEDFARLRL 404
BLAST of SMED30018024 vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1) HSP 1 Score: 46.2098 bits (108), Expect = 6.968e-7 Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 2 Query: 56 SSDIQLELPFNLTHPNPEEDLTV--------NTYD--GLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 250 +SDIQLE+PF LTHPNP+ D + N D G+D N L F +Q+++ IF DFARL+L Sbjct: 344 TSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQF-----------KQEEEFIFEDFARLRL 407 The following BLAST results are available for this feature:
BLAST of SMED30018024 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of SMED30018024 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30018024 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30018024 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 1
BLAST of SMED30018024 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30018024 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of SMED30018024 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 1
BLAST of SMED30018024 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30018024 ID=SMED30018024|Name=SMED30018024|organism=Schmidtea mediterranea sexual|type=transcript|length=320bpback to top Annotated Terms
The following terms have been associated with this transcript:
|