N(alpha)-acetyltransferase 35, NatC auxiliary subunit

Overview
NameN(alpha)-acetyltransferase 35, NatC auxiliary subunit
Smed IDSMED30018007
Length (bp)2549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N(alpha)-acetyltransferase 35, NatC auxiliary subunit (SMED30018007) t-SNE clustered cells

Violin plots show distribution of expression levels for N(alpha)-acetyltransferase 35, NatC auxiliary subunit (SMED30018007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N(alpha)-acetyltransferase 35, NatC auxiliary subunit (SMED30018007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N(alpha)-acetyltransferase 35, NatC auxiliary subunit (SMED30018007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Human
Match: NAA35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:HGNC Symbol;Acc:HGNC:24340])

HSP 1 Score: 171.4 bits (433), Expect = 7.901e-44
Identity = 112/363 (30.85%), Postives = 197/363 (54.27%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +D+T++F + C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +     +   + + + +TR++   L     K+T  S   E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ +       T  + I +   F C+ ++QS CV SRSLL   +++
Sbjct:   30 VDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLLTVLIAFTKKET--SAVAEAQKLMVQAADLLSAIHNSLHHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNL-------TNLHCILD---FFCEFSEQSPCVLSRSLLQTTFLV 377          

HSP 2 Score: 82.0333 bits (201), Expect = 2.221e-15
Identity = 85/319 (26.65%), Postives = 138/319 (43.26%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARG-SKPGPVVLNFDESKEKAFPLIKL 2307
            FV  C      +   H  NR+RQR++L  I++    L DE  KVD  + + + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     + +Q  E+  + +   +K R     +    +  ++  I   ++Y N+  G+F    A   DGK+  P+            V YE RF+P  S         Y QF +  +L          ELY AA+  F   +  +E  P     +   +++  +AK N +V ++LA G  K   V   FD S  K FP++KL
Sbjct:  424 FVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADGSQMAEERIMEE--QQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNS-VMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNP---DHEVNRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSAHKYFPVVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Human
Match: NAA35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:HGNC Symbol;Acc:HGNC:24340])

HSP 1 Score: 133.65 bits (335), Expect = 6.281e-34
Identity = 74/215 (34.42%), Postives = 124/215 (57.67%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFL 690
            +D+T++F + C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +       +++  R++F R  L
Sbjct:   30 VDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLL 244          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Celegans
Match: natc-1 (N-alpha-AcetylTransferase C complex subunit [Source:UniProtKB/TrEMBL;Acc:O17003])

HSP 1 Score: 72.0182 bits (175), Expect = 1.117e-12
Identity = 47/134 (35.07%), Postives = 70/134 (52.24%), Query Frame = 1
Query:   79 NTEIDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDV 480
            N   DV++ FF++C  +  GEL     F L DVM+AIEL +PKMD  +   + +  L EA+   L    D  P  L  I+D TL+ +V WL+G  LG TV+ N+ +     +K+           G+ +FIR+ 
Sbjct:    9 NESEDVSKTFFKLCDGLRLGELVTTEHFRLSDVMSAIELGEPKMDVGVG-SKHIKTLKEAISGGLYA--DDYPFQL-AIMDSTLAMVVAWLEGSALGSTVWTNVLLSNVTFVKHPVFHPF---ASGVNLFIRNA 135          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Fly
Match: Naa35 (gene:FBgn0034982 transcript:FBtr0100398)

HSP 1 Score: 209.92 bits (533), Expect = 7.258e-57
Identity = 201/773 (26.00%), Postives = 343/773 (44.37%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVI---YLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYI-STSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR-----------LTSWLDIESTIKLDEKLSIFVGACAE-NLFQIPITHC-LNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQ-SVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENT----------QQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDG--KLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIE--KCPAEQFIESTGSQLDNIAKNNMIVARILARG-SKPGPVVLNFDESKEKAFPLIKL 2307
            +DVT+ F   C ++ PGEL+    F L + M+AIE+MDPKMD  M   ++ +       A+    + L+D++P  L GI D   SCLV+WL+G+++ Q +F  +Y+H   QIK+K L+  C AV+ +IV I+ +I  A+V EEEDF +   S +   +      + S LK+ +D+  R  K      D   +++ +R+RF+R      +++    Q  +     D V I   K L      +  ++ T+  G    KG   P+      +GF P ++    PPA PR   I +R S+ ++LE++I +  +  ++       + ++  NF   + +         C+ SRS+L     +F +N ++                                      K  ++QF+R           L +   + +  K+ + L  F   C   N F   I  C  NR+RQR++L  +I+    +  +  ++D ++    N++  + + P          FS++V    FR M  +L+SGFEL LYA  E + +Y+   + ++ + +S     EN           Q + QS        +   +  K         A +++   +  +L  G++    ALTKDG  +LP       ++    + Y +RF P  +        SY +F    E +   S+ +LY  AA  FD  R  +E  + P ++ ++     L  IA+ N +V  +LARG  K       FD SK   FP+IKL
Sbjct:   80 VDVTKEFHDACAELQPGELAQDMLFGLFEAMSAIEIMDPKMDVGMGFDKQDLPPPSFEAAIATGAIKLDDLTPSELIGIYDALFSCLVSWLEGNSMDQVLFTCLYLHAPAQIKDKALRVFCTAVRNLIVVIKKIIAVAAVNEEEDFQLYGNSALLAAEKAQPATVYSSLKDVEDELIRKCKKLTSTED--WMAVVHRLRFMRHLF---QVIYHVEQMASNDTVDDKVDI--YKILLVASEMLPGIRNTLDRGTQPEKGSDAPNP-----MGFSPRIHDRSQPPAFPRSIKIRDRPSSYQFLEEMISRFKYACKVTKY---KDYYSALNFFIEYSK-----KSGQCILSRSVLQT---LFSANMRM-----------------------------------AHGKLPMKQFLRHSVQVFNSPPVLNAKHPVAADPKVQQHLENFFRYCINMNTFTQFIRICGFNRARQRDKLARLIENFDTIQVDAARLDSMMNQLANERAMEGNEPMATALKHSTHFSTWVLYNCFRAMLIFLMSGFELELYAVHEFLYIYWYPYEFLIGFLVSALTRTENILLAQEEYAEHQSKTQSGGSGAAKNRKAAKPKKNKKTQRPYRAEIVF-YHALLSLCGGMYKAMGALTKDGRVRLP-----LSKFDNEEIRYNRRFLPFATLTS-PPPVSYAEFKNVREHMMRHSVEDLYTYAAKHFDQARNVLESIQNPDQEMLD-----LLQIARTNFVVMNVLARGHQKEVKRQPEFDFSKHSYFPIIKL 782          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Fly
Match: Naa35 (gene:FBgn0034982 transcript:FBtr0072280)

HSP 1 Score: 209.534 bits (532), Expect = 9.058e-57
Identity = 202/776 (26.03%), Postives = 344/776 (44.33%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVI---YLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYI-STSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR-----------LTSWLDIESTIKLDEKLSIFVGACAE-NLFQIPITHC-LNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQ-SVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENT----------QQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDG--KLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIE--KCPAEQFIESTGSQLDNIAKNNMIVARILARGS----KPGPVVLNFDESKEKAFPLIKL 2307
            +DVT+ F   C ++ PGEL+    F L + M+AIE+MDPKMD  M   ++ +       A+    + L+D++P  L GI D   SCLV+WL+G+++ Q +F  +Y+H   QIK+K L+  C AV+ +IV I+ +I  A+V EEEDF +   S +   +      + S LK+ +D+  R  K      D   +++ +R+RF+R      +++    Q  +     D V I   K L      +  ++ T+  G    KG   P+      +GF P ++    PPA PR   I +R S+ ++LE++I +  +  ++       + ++  NF   + +         C+ SRS+L     +F +N ++                                      K  ++QF+R           L +   + +  K+ + L  F   C   N F   I  C  NR+RQR++L  +I+    +  +  ++D ++    N++  + + P          FS++V    FR M  +L+SGFEL LYA  E + +Y+   + ++ + +S     EN           Q + QS        +   +  K         A +++   +  +L  G++    ALTKDG  +LP       ++    + Y +RF P  +        SY +F    E +   S+ +LY  AA  FD  R  +E  + P ++ ++     L  IA+ N +V  +LARG     K  P    FD SK   FP+IKL
Sbjct:   81 VDVTKEFHDACAELQPGELAQDMLFGLFEAMSAIEIMDPKMDVGMGFDKQDLPPPSFEAAIATGAIKLDDLTPSELIGIYDALFSCLVSWLEGNSMDQVLFTCLYLHAPAQIKDKALRVFCTAVRNLIVVIKKIIAVAAVNEEEDFQLYGNSALLAAEKAQPATVYSSLKDVEDELIRKCKKLTSTED--WMAVVHRLRFMRHLF---QVIYHVEQMASNDTVDDKVDI--YKILLVASEMLPGIRNTLDRGTQPEKGSDAPNP-----MGFSPRIHDRSQPPAFPRSIKIRDRPSSYQFLEEMISRFKYACKVTKY---KDYYSALNFFIEYSK-----KSGQCILSRSVLQT---LFSANMRM-----------------------------------AHGKLPMKQFLRHSVQVFNSPPVLNAKHPVAADPKVQQHLENFFRYCINMNTFTQFIRICGFNRARQRDKLARLIENFDTIQVDAARLDSMMNQLANERAMEGNEPMATALKHSTHFSTWVLYNCFRAMLIFLMSGFELELYAVHEFLYIYWYPYEFLIGFLVSALTRTENILLAQEEYAEHQSKTQSGGSGAAKNRKAAKPKKNKKTQRPYRAEIVF-YHALLSLCGGMYKAMGALTKDGRVRLP-----LSKFDNEEIRYNRRFLPFATLTS-PPPVSYAEFKNVREHMMRHSVEDLYTYAAKHFDQARNVLESIQNPDQEMLD-----LLQIARTNFVVMNVLARGHQKEVKRQP---EFDFSKHSYFPIIKL 783          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Zebrafish
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:321587])

HSP 1 Score: 222.246 bits (565), Expect = 2.727e-61
Identity = 218/788 (27.66%), Postives = 368/788 (46.70%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKL---LKV------TNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +N   +DVT+ F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+  ++A++ + + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  LK     +  I    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + +P +       ++L  R++F       TR++   L +   K+T  S   E+ K +S     +  +  TI  G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ I       T  + I +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+    L+S   + +  +  + +  FV  C      +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L   LKV        KK  + + KEIT +           ++Y N+  G++    AL  D K+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 IPEKMRNNANWVDVTQEFKGACKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFDQAVKDEAIRVKDLSIPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIQDPALKAFALGILKICDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRNPEVELDHQQCLALFSRVKF-------TRLLLSALISFTKKET--SAVSEAQKLMSQAADLLPAVHATIQYG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSKLIERIKSVCEVINI-------TNLHSILD---FFCEFSEQSPCVLSRSLLQTTFLI--DNKKVF----------------------------GTHLMQDMIKDALRCFVSPPVLSSKCSLNNNHQAKDYIDSFVTHCTRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERILEEQLKVRSSKKSKKKKKARPLSKEITMS-----------QAYQNMCAGMYKTMIALDMDRKVRKPQF-----ELDSEQVRYEHRFAPFNS-VVTPPPVHYIQFKEMSDL----KKYNPPPRSADLYMAASKHFQQ--AKLILENVTSPDAEVNRILKVAKPNIVVMKLLAGGHKKETKALPEFDFSAHKYFPIVKI 723          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Xenopus
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:447988])

HSP 1 Score: 223.787 bits (569), Expect = 1.015e-61
Identity = 210/782 (26.85%), Postives = 358/782 (45.78%), Query Frame = 1
Query:   58 LSKKMIDNTE--IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCES----DPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCL------------NRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQ------LDNIAKNNMIVARILARGSKP-GPVVLNFDESKEKAFPLIKL 2307
            +  KM  N+   ID+T+ F   C ++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I   +R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +        DP +     +   + + + +TRI+   L     K+T  S  +E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +++  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+         S   L  K  ++    A++     +THC+            NR+RQR++L  I++    L DE  KVD  + S + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  + +   +K R     +    +  +   I   ++Y N+  G++    A   DGK+  P+            V YE RF+P  S         Y QF +  +L    +       ++  + A  K  ++  A   +ES  SQ      +  +AKNN++V ++LA G K    +  +FD S  K FP +KL
Sbjct:   18 MQDKMGKNSANWIDITQEFRDACSELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPDLIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEDPAMKAFALGILKICDIVREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDLQRRVKSTRSRQGEARDPEVELEHQQCLAVFSRVKFTRILLTVLIAFTKKET--SAVVEASKLIGQAVDLLSAIHNSLLHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKKEEMVIYFSKLIDR---------IKTVCEVVNLTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLV--DNKKVF----------------------------GTHLMQDMIKDALRSFV---------SPPALSPKCCLYNNHQAKDYIDSFVTHCVRPFCNLIQIHGHNRARQRDKLGHILEDFATLQDEAEKVDAALHSMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERIIEE--QQKGRSSKKTKKKKKVRPLGREITLSQAYQNMCAGMYKTMIAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-ITPPPVHYLQFKEMSDL----NKYSPPPQSSDLYLAASKHFQQ--ARMILESISSQDQEVNEILKVAKNNIVVMKLLAGGHKKDSKIPPDFDFSAHKYFPAVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Xenopus
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:447988])

HSP 1 Score: 180.644 bits (457), Expect = 6.158e-47
Identity = 191/757 (25.23%), Postives = 334/757 (44.12%), Query Frame = 1
Query:   58 LSKKMIDNTE--IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCES-DPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCL------------NRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQ------LDNIAKNNMIVARILARGSK 2244
            +  KM  N+   ID+T+ F   C                   M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I   +R+ + KA+V EEEDF   T    + ++V D ++T+        ++ + +    E+ DP +     +   + + + +TRI+   L     K+T  S  +E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +++  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+         S   L  K  ++    A++     +THC+            NR+RQR++L  I++    L DE  KVD  + S + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  + +   +K R     +    +  +   I   ++Y N+  G++    A   DGK+  P+            V YE RF+P  S         Y QF +  +L    +       ++  + A  K  ++  A   +ES  SQ      +  +AKNN++V ++LA G K
Sbjct:   18 MQDKMGKNSANWIDITQEFRDACS-----------------AMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPDLIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEDPAMKAFALGILKICDIVREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTAA------SYSNSTRSRQGEARDPEVELEHQQCLAVFSRVKFTRILLTVLIAFTKKET--SAVVEASKLIGQAVDLLSAIHNSLLHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKKEEMVIYFSKLIDR---------IKTVCEVVNLTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLV--DNKKVF----------------------------GTHLMQDMIKDALRSFV---------SPPALSPKCCLYNNHQAKDYIDSFVTHCVRPFCNLIQIHGHNRARQRDKLGHILEDFATLQDEAEKVDAALHSMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERIIEE--QQKGRSSKKTKKKKKVRPLGREITLSQAYQNMCAGMYKTMIAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-ITPPPVHYLQFKEMSDL----NKYSPPPQSSDLYLAASKHFQQ--ARMILESISSQDQEVNEILKVAKNNIVVMKLLAGGHK 676          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Xenopus
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:447988])

HSP 1 Score: 155.606 bits (392), Expect = 1.016e-38
Identity = 113/372 (30.38%), Postives = 193/372 (51.88%), Query Frame = 1
Query:   58 LSKKMIDNTE--IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCES-DPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +  KM  N+   ID+T+ F   C ++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I   +R+ + KA+V EEEDF   T    + ++V D ++T+        ++ + +    E+ DP +     +   + + + +TRI+   L     K+T  S  +E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +++  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++
Sbjct:   18 MQDKMGKNSANWIDITQEFRDACSELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPDLIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEDPAMKAFALGILKICDIVREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTAA------SYSNSTRSRQGEARDPEVELEHQQCLAVFSRVKFTRILLTVLIAFTKKET--SAVVEASKLIGQAVDLLSAIHNSLLHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKKEEMVIYFSKLIDR---------IKTVCEVVNLTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLV 368          

HSP 2 Score: 84.7297 bits (208), Expect = 3.306e-16
Identity = 85/315 (26.98%), Postives = 140/315 (44.44%), Query Frame = 1
Query: 1390 NLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQ------LDNIAKNNMIVARILARGSKP-GPVVLNFDESKEKAFPLIKL 2307
            NL QI   H  NR+RQR++L  I++    L DE  KVD  + S + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  + +   +K R     +    +  +   I   ++Y N+  G++    A   DGK+  P+            V YE RF+P  S         Y QF +  +L    +       ++  + A  K  ++  A   +ES  SQ      +  +AKNN++V ++LA G K    +  +FD S  K FP +KL
Sbjct:  422 NLIQI---HGHNRARQRDKLGHILEDFATLQDEAEKVDAALHSMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERIIEE--QQKGRSSKKTKKKKKVRPLGREITLSQAYQNMCAGMYKTMIAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-ITPPPVHYLQFKEMSDL----NKYSPPPQSSDLYLAASKHFQQ--ARMILESISSQDQEVNEILKVAKNNIVVMKLLAGGHKKDSKIPPDFDFSAHKYFPAVKL 712          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Xenopus
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:447988])

HSP 1 Score: 136.732 bits (343), Expect = 1.351e-32
Identity = 107/372 (28.76%), Postives = 184/372 (49.46%), Query Frame = 1
Query:   58 LSKKMIDNTE--IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCES-DPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +  KM  N+   ID+T+ F   C                   M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I   +R+ + KA+V EEEDF   T    + ++V D ++T+        ++ + +    E+ DP +     +   + + + +TRI+   L     K+T  S  +E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +++  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++
Sbjct:   18 MQDKMGKNSANWIDITQEFRDACS-----------------AMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPDLIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEDPAMKAFALGILKICDIVREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTAA------SYSNSTRSRQGEARDPEVELEHQQCLAVFSRVKFTRILLTVLIAFTKKET--SAVVEASKLIGQAVDLLSAIHNSLLHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKKEEMVIYFSKLIDR---------IKTVCEVVNLTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLV 351          

HSP 2 Score: 82.8037 bits (203), Expect = 1.273e-15
Identity = 81/307 (26.38%), Postives = 136/307 (44.30%), Query Frame = 1
Query: 1414 HCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQ------LDNIAKNNMIVARILARGSKP-GPVVLNFDESKEKAFPLIKL 2307
            H  NR+RQR++L  I++    L DE  KVD  + S + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  + +   +K R     +    +  +   I   ++Y N+  G++    A   DGK+  P+            V YE RF+P  S         Y QF +  +L    +       ++  + A  K  ++  A   +ES  SQ      +  +AKNN++V ++LA G K    +  +FD S  K FP +KL
Sbjct:  399 HGHNRARQRDKLGHILEDFATLQDEAEKVDAALHSMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERIIEE--QQKGRSSKKTKKKKKVRPLGREITLSQAYQNMCAGMYKTMIAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-ITPPPVHYLQFKEMSDL----NKYSPPPQSSDLYLAASKHFQQ--ARMILESISSQDQEVNEILKVAKNNIVVMKLLAGGHKKDSKIPPDFDFSAHKYFPAVKL 684          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Match: Naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:MGI Symbol;Acc:MGI:1925939])

HSP 1 Score: 167.548 bits (423), Expect = 1.220e-42
Identity = 114/362 (31.49%), Postives = 186/362 (51.38%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +D+T++F   C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +     +     + + +TR++   L     K+T  S   E+ K +      +  +  ++ +G     G          ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    EV    N +     F C+ ++QS CV SRSLL   +++
Sbjct:   30 VDITQDFEDACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDLQRRVKSTRSRQGEERDPEVELEHQQCLAAFSRVKFTRVLLTVLIAFTKKET--SAVAEAQKLMVQAADLLSAIHTSLHHGIQAQNGTTKGDHPI--MMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSRLIDR---------IKTVCEVVNLPN-LHCILDFFCEFSEQSPCVLSRSLLQTTFLV 377          

HSP 2 Score: 82.8037 bits (203), Expect = 9.580e-16
Identity = 86/319 (26.96%), Postives = 138/319 (43.26%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARG-SKPGPVVLNFDESKEKAFPLIKL 2307
            FV  C      +   H  NR+RQR++L  I++    L DE  KVD  + + + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     + +Q  E+  + +   +K R     +    +  ++  I   ++Y N+  G+F    A   DGK+  P+            V YE RF+P  S         Y QF +  +L          ELY AA+  F   +  +E  P     +   S++  +AK N +V ++LA G  K   V   FD S  K FP++KL
Sbjct:  424 FVTHCVRPFCSLVQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADGSQMAEERIMEE--QQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-MTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNP---DREVSRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSVHKYFPVVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Match: Naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:MGI Symbol;Acc:MGI:1925939])

HSP 1 Score: 159.073 bits (401), Expect = 9.138e-42
Identity = 111/358 (31.01%), Postives = 178/358 (49.72%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +D+T++F   C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD                  LQ R++  R+     R  +  L+T        S   E+ K +      +  +  ++ +G     G          ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    EV    N +     F C+ ++QS CV SRSLL   +++
Sbjct:   26 VDITQDFEDACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDD------------------LQRRVKSTRSRQGEERDPEVELET--------SAVAEAQKLMVQAADLLSAIHTSLHHGIQAQNGTTKGDHPI--MMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSRLIDR---------IKTVCEVVNLPN-LHCILDFFCEFSEQSPCVLSRSLLQTTFLV 345          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Match: Naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:MGI Symbol;Acc:MGI:1925939])

HSP 1 Score: 118.627 bits (296), Expect = 1.506e-29
Identity = 71/215 (33.02%), Postives = 116/215 (53.95%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFL 690
            +D+T++F   C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R         E+EDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +       ++   R++F R  L
Sbjct:   30 VDITQDFEDACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAR---------EKEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDLQRRVKSTRSRQGEERDPEVELEHQQCLAAFSRVKFTRVLL 235          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Match: Naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:MGI Symbol;Acc:MGI:1925939])

HSP 1 Score: 87.4261 bits (215), Expect = 1.127e-19
Identity = 45/131 (34.35%), Postives = 76/131 (58.02%), Query Frame = 1
Query:  226 IQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLK 618
            + RKV+   +A++   + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K
Sbjct:    1 VNRKVLNFEQAIKDGTIKIKDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDLQRRVK 131          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Match: Naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:MGI Symbol;Acc:MGI:1925939])

HSP 1 Score: 65.4698 bits (158), Expect = 1.818e-12
Identity = 33/81 (40.74%), Postives = 53/81 (65.43%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIID 321
            +D+T++F   C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D+S   L GI+D
Sbjct:   30 VDITQDFEDACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLSLPELIGIMD 110          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Match: sp|Q7T322|NAA35_DANRE (N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Danio rerio OX=7955 GN=naa35 PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 4.314e-61
Identity = 219/788 (27.79%), Postives = 368/788 (46.70%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKL---LKV------TNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +N   +DVT+ F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+  ++A++ + + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  LK     +  I    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  R++F       TR++   L +   K+T  S   E+ K +S     +  +  TI  G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ I       T  + I +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+    L+S   + +  +  + +  FV  C      +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L   LKV        KK  + + KEIT +           ++Y N+  G++    AL  D K+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 IPEKMRNNANWVDVTQEFKGACKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFDQAVKDEAIRVKDLSIPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIQDPALKAFALGILKICDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELDHQQCLALFSRVKF-------TRLLLSALISFTKKET--SAVSEAQKLMSQAADLLPAVHATIQYG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSKLIERIKSVCEVINI-------TNLHSILD---FFCEFSEQSPCVLSRSLLQTTFLI--DNKKVF----------------------------GTHLMQDMIKDALRCFVSPPVLSSKCSLNNNHQAKDYIDSFVTHCTRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERILEEQLKVRSSKKSKKKKKARPLSKEITMS-----------QAYQNMCAGMYKTMIALDMDRKVRKPQF-----ELDSEQVRYEHRFAPFNS-VVTPPPVHYIQFKEMSDL----KKYNPPPRSADLYMAASKHFQQ--AKLLLENVTSPDAEVNRILKVAKPNIVVMKLLAGGHKKETKALPEFDFSAHKYFPIVKI 723          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Match: sp|Q5ZHV2|NAA35_CHICK (N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Gallus gallus OX=9031 GN=NAA35 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.268e-59
Identity = 204/771 (26.46%), Postives = 362/771 (46.95%), Query Frame = 1
Query:   79 NTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCL------------NRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARGSKP-GPVVLNFDESKEKAFPLIKL 2307
            NT+ +D+T++F + C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +     +   + + + +TR++   L     K+T  S   E+ + ++     +  +  +  +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ +       T  + I +   F C+ ++QS CV SRSLL   +++   N ++                               +   +++K ++R F+         S   L  K  ++    A++     +THC+            NR+RQR++L  I++    L DE  KVD  + S + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  + +   +K R     +    +  ++  I   ++Y N+  G++    A   DGK+  P+            V YE RF+P  S         Y QF +  +L         ++LY AA+  F   +  +E  P     +   +++  +AK N++V ++LA G K    V   FD S  K FP++KL
Sbjct:   26 NTDWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTSPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLLTVLIAFTKKET--SAVAEAQELMTQAADLLSAIHNSCIHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSKLIDRIKTVCEVVNL-------TNLHCILD---FFCEFSEQSPCVLSRSLLQTTFLV--DNKKVF----------------------------GTHLMQDMVKDALRSFV---------SPPVLSPKCCLYNNHQAKDYIDSFVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHSMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERIMEE--QQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMYKTMIAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNSV-ITPPPVHYLQFKEMSDLNKYSPPPQSADLYMAASKHFQQAKMILENIPNP---DHEVNRILKVAKPNIVVMKLLAGGHKKDSKVPPEFDFSPHKYFPVVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Match: sp|Q9W1A2|NAA35_DROME (N-alpha-acetyltransferase 35, NatC auxiliary subunit homolog OS=Drosophila melanogaster OX=7227 GN=Naa35 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 9.079e-56
Identity = 202/776 (26.03%), Postives = 344/776 (44.33%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVI---YLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYI-STSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR-----------LTSWLDIESTIKLDEKLSIFVGACAE-NLFQIPITHC-LNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQ-SVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENT----------QQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDG--KLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIE--KCPAEQFIESTGSQLDNIAKNNMIVARILARGS----KPGPVVLNFDESKEKAFPLIKL 2307
            +DVT+ F   C ++ PGEL+    F L + M+AIE+MDPKMD  M   ++ +       A+    + L+D++P  L GI D   SCLV+WL+G+++ Q +F  +Y+H   QIK+K L+  C AV+ +IV I+ +I  A+V EEEDF +   S +   +      + S LK+ +D+  R  K      D   +++ +R+RF+R      +++    Q  +     D V I   K L      +  ++ T+  G    KG   P+      +GF P ++    PPA PR   I +R S+ ++LE++I +  +  ++       + ++  NF   + +         C+ SRS+L     +F +N ++                                      K  ++QF+R           L +   + +  K+ + L  F   C   N F   I  C  NR+RQR++L  +I+    +  +  ++D ++    N++  + + P          FS++V    FR M  +L+SGFEL LYA  E + +Y+   + ++ + +S     EN           Q + QS        +   +  K         A +++   +  +L  G++    ALTKDG  +LP       ++    + Y +RF P  +        SY +F    E +   S+ +LY  AA  FD  R  +E  + P ++ ++     L  IA+ N +V  +LARG     K  P    FD SK   FP+IKL
Sbjct:   81 VDVTKEFHDACAELQPGELAQDMLFGLFEAMSAIEIMDPKMDVGMGFDKQDLPPPSFEAAIATGAIKLDDLTPSELIGIYDALFSCLVSWLEGNSMDQVLFTCLYLHAPAQIKDKALRVFCTAVRNLIVVIKKIIAVAAVNEEEDFQLYGNSALLAAEKAQPATVYSSLKDVEDELIRKCKKLTSTED--WMAVVHRLRFMRHLF---QVIYHVEQMASNDTVDDKVDI--YKILLVASEMLPGIRNTLDRGTQPEKGSDAPNP-----MGFSPRIHDRSQPPAFPRSIKIRDRPSSYQFLEEMISRFKYACKVTKY---KDYYSALNFFIEYSK-----KSGQCILSRSVLQT---LFSANMRM-----------------------------------AHGKLPMKQFLRHSVQVFNSPPVLNAKHPVAADPKVQQHLENFFRYCINMNTFTQFIRICGFNRARQRDKLARLIENFDTIQVDAARLDSMMNQLANERAMEGNEPMATALKHSTHFSTWVLYNCFRAMLIFLMSGFELELYAVHEFLYIYWYPYEFLIGFLVSALTRTENILLAQEEYAEHQSKTQSGGSGAAKNRKAAKPKKNKKTQRPYRAEIVF-YHALLSLCGGMYKAMGALTKDGRVRLP-----LSKFDNEEIRYNRRFLPFATLTS-PPPVSYAEFKNVREHMMRHSVEDLYTYAAKHFDQARNVLESIQNPDQEMLD-----LLQIARTNFVVMNVLARGHQKEVKRQP---EFDFSKHSYFPIIKL 783          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Match: sp|Q5RBT3|NAA35_PONAB (N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Pongo abelii OX=9601 GN=NAA35 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.794e-43
Identity = 112/363 (30.85%), Postives = 197/363 (54.27%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +D+T++F + C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +     +   + + + +TR++   L     K+T  S   E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ +       T  + I +   F C+ ++QS CV SRSLL   +++
Sbjct:   30 VDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLLTVLIAFTKKET--SAVAEAQKLMVQAADLLSAIHNSLHHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNL-------TNLHCILD---FFCEFSEQSPCVLSRSLLQTTFLV 377          

HSP 2 Score: 82.0333 bits (201), Expect = 1.067e-14
Identity = 85/319 (26.65%), Postives = 138/319 (43.26%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARG-SKPGPVVLNFDESKEKAFPLIKL 2307
            FV  C      +   H  NR+RQR++L  I++    L DE  KVD  + + + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     + +Q  E+  + +   +K R     +    +  ++  I   ++Y N+  G+F    A   DGK+  P+            V YE RF+P  S         Y QF +  +L          ELY AA+  F   +  +E  P     +   +++  +AK N +V ++LA G  K   V   FD S  K FP++KL
Sbjct:  424 FVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADGSQMAEERIMEE--QQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNS-VMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNP---DHEVNRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSAHKYFPVVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Match: sp|Q5VZE5|NAA35_HUMAN (N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA35 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.794e-43
Identity = 112/363 (30.85%), Postives = 197/363 (54.27%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            +D+T++F + C+++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  +K     +  I    R+ + KA+V EEEDF   T    + ++V D ++T +LK+ +DD  R +K +      E DP +     +   + + + +TR++   L     K+T  S   E+ K +      +  +  ++ +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++    +++ +       T  + I +   F C+ ++QS CV SRSLL   +++
Sbjct:   30 VDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAIKDGTIKIKDLTLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYIHNPDFIEDPAMKAFALGILKICDIAREKVNKAAVFEEEDFQSMTYGFKMANSVTDLRVTGMLKDVEDDMQRRVKSTRSRQGEERDPEVELEHQQCLAVFSRVKFTRVLLTVLIAFTKKET--SAVAEAQKLMVQAADLLSAIHNSLHHG---IQAQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFARLIDRIKTVCEVVNL-------TNLHCILD---FFCEFSEQSPCVLSRSLLQTTFLV 377          

HSP 2 Score: 82.0333 bits (201), Expect = 1.067e-14
Identity = 85/319 (26.65%), Postives = 138/319 (43.26%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARG-SKPGPVVLNFDESKEKAFPLIKL 2307
            FV  C      +   H  NR+RQR++L  I++    L DE  KVD  + + + ++  Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     + +Q  E+  + +   +K R     +    +  ++  I   ++Y N+  G+F    A   DGK+  P+            V YE RF+P  S         Y QF +  +L          ELY AA+  F   +  +E  P     +   +++  +AK N +V ++LA G  K   V   FD S  K FP++KL
Sbjct:  424 FVTHCVRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHTMLLKQEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADGSQMAEERIMEE--QQKGRSSKKTKKKKKVRPLSREITMSQAYQNMCAGMFKTMVAFDMDGKVRKPKF-----ELDSEQVRYEHRFAPFNS-VMTPPPVHYLQFKEMSDLNKYSPPPQSPELYVAASKHFQQAKMILENIPNP---DHEVNRILKVAKPNFVVMKLLAGGHKKESKVPPEFDFSAHKYFPVVKL 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Match: A0A060WH53 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075194001 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 2.634e-62
Identity = 218/777 (28.06%), Postives = 367/777 (47.23%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXSXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLAN-IANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXX---XXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +N   +D+T  F   CK++N GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++   + + D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  LK     +  +    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  RI+F R  LL T ++          + + S   E+ K +      +  ++ +I +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    EV    N +     F C+ ++QS CV SRSLL   +++   N ++   +                               ++IK ++R F+    L+S   + +  +  + +  FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  + S + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L +    +S K+  K+  G  A  ++  I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L         ++LY AA+  F   +  +E  P+    +   +++  +AK N++V ++LA G K    VL  FD S  K FP++K+
Sbjct:   18 VPEKMRNNANWVDITHEFKGACKELNLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDGAIRVRDLSLPELIGIMDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEDPALKAFTLGILKVCDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELEHQQCLALFSRIKFTR--LLLTALIA-------FTKKETSSVSEAQKLMQQAADLLPALRSSIEHG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMINYFSKLIDR---------IKTVCEVINTTN-LHGILDFFCEFSEQSPCVLSRSLLQTTFLI--DNKKVFGTLP----------------------------MQDMIKDALRYFVSPPVLSSKCCLYNNHQAKDYIDSFVAHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHSLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQLAEERLLEEQQKGRSSKKTKKKKKGQGARPLSREITMSQAYQNMCAGMYKTMIALDMDGKVRKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYVQFKEMSDLKKYSPPPQSADLYMAASKHFQQAKLILENVPSP---DPEVNRILKVAKPNIVVMKLLAGGHKKETKVLPEFDFSTHKYFPVVKI 726          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Match: A0A5K4EFD3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.146e-62
Identity = 175/636 (27.52%), Postives = 278/636 (43.71%), Query Frame = 1
Query:   88 IDVTENFFQVCK-QINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVIYLNEALEKQLLPLEDISPKL-LHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDD-----NVGDN------------KITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIV--------------------------------KKFLQTPNCKQTKDSVYIESCK----YLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHT-----NQILAIDIGSE---VFTGWNFIQNFGRFGCDAAQQ----------------SCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIRLTSWLDIESTI----------KLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPN-----------KRNRDIPPI---FSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVY 1686
            +D+T  FF  C+  + PGEL H + FDLQ  M+AIE+MDPKMDAR+Q  RK++ + EAL  + LPL   S    L GIIDE L+  VNWL GD+L Q++FI MYMHCT  I++K L   CE ++  +  +RD+I    V +EED  I T  MP+ +     +V D+            ++T+ + + + +      +     + +++ L+ R++F++  LL+T  +                                 K  +  N  +     +I+ C+    ++ST+K   + + ET + G+  G+GK  P    YGL GFE +LNQ  +PP +P+ A+I  R  +  Y   L  +L H      N  L  D+  E   + + W FIQ  G+  C   +                 +CV SR++   FY       +++                             +           R F  L SW  +E T            + E +S F    + +   IP  +CLNRSRQR+ L   +    DL DEC  V+ ++   +  K      +              + + P+    S F+    +   +DY+VSGF+L LY+  E + +Y
Sbjct:    1 MDITNAFFSACRIGLEPGELLHSSWFDLQYSMSAIEVMDPKMDARIQGNRKIVTVCEALSSEQLPLGPFSSLYELLGIIDELLAAFVNWLTGDSLAQSIFICMYMHCTQLIRDKYLAAFCELLRRSVYQLRDIISTVGVFDEEDHDILTHGMPIHEPSHMFDVYDSFRNECLHKLSVLELTAHVNDLNGNLESESTMFADREEKLLMGLKSRLQFVQALLLFTNSISECIHPTRVDFNQDLFEGYTHADLDFSGQNSSSKLYEDQNNTEVVWDSFIDFCRKVSQHISTLKSLSDILVETSNIGKMAGEGKLKPKDAAYGLPGFEVFLNQASIPPFLPKVANIHNRHKSFVYFSSLFTRLHHILCTYENFALWHDLHPEPLRIHSLWTFIQKSGQISCPYVKALLFPDDPSKVNEPLLTTCVLSRTITYTFYSALMWQGKVI-----------------------------DFKPQSFSPMYFRYF--LNSWHQLEPTTHRPLIENVISNIPELMSFFT-TLSTHFAHIPAIYCLNRSRQRSALGPWLKNLPDLLDECAHVEFVIGVELRNKLANKTTDCFESVGKLEVLSTQKTVVPVQINLSCFITYMYYYLAWDYVVSGFQLELYSSSEWLFIY 604          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Match: A0A556U278 (N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Bagarius yarrelli OX=175774 GN=Baya_7603 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 5.008e-62
Identity = 216/794 (27.20%), Postives = 366/794 (46.10%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSH------------VNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNG----EPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            LS+KM +NTE +D+T++F   CK++  GEL H            V  F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++ +++ ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  D I++  LK     +  +    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  RI+F R  LL T ++       +  + + S   E+ K +S     +  +  TI  G        KG          ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI ++     +++I          N + +   F C+ ++QS CV SRSLL   +++   +S+ +                                  ++IK ++R F+    L+S   + +  +  + +  FV  C      +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+ ++L+   +K R     +       +   I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 LSEKMRNNTEWMDITQDFKASCKELKLGELLHDKFFQQHVSLDCVYRFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDEVIRVKDLTLPELIGIVDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIQDPALKAFALGILKVCDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELDHQQCLALFSRIKFTR--LLLTALI-------SFTKKETSAVSEAQKLMSQAADLLPAIHSTIQYGIQSQNDTTKGGLHMHTNHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFTKLIERIKTVCDVISI----------NNLHSILDFFCEFSEQSPCVLSRSLLQTTFLI---DSKKVFGTH---------------------------LMQDMIKDALRYFVSPPVLSSKCSLYNNHQAKDYIDSFVTHCCRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLMKLEPQ-------RQHLACLGTWVLYHNLRIMIHYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEE-RILEEQQQKGRSSKKSKKKKKARPLGKEITMSQAYQNMCAGMYKTMIALDMDGKVRKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYIQFKEMSDL----KKYSPPPRSADLYMAASKHFQQ--AKLILENVTSPDAEVNRILKVAKPNIVVMKLLAGGHKKDTKALPEFDFSAHKYFPIVKI 742          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Match: A0A5N5NNG2 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00236510 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 8.406e-62
Identity = 212/779 (27.21%), Postives = 366/779 (46.98%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +NT+ +D+T++F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++ + + ++D++   L GI+D    CL+ WL+G +L QTVF  +Y+H  + I++  LK     +  +    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  RI+F R  LL T ++       +  + + S   E+ K +S     +  +  TI  G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    +V    N + +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+    L+S   + +  +  + +  FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+ ++L+   +K R     +       +   I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 IPEKMRNNTDWVDITQDFKASCKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDEAIRVKDLTLPELIGIVDTCFCCLITWLEGHSLAQTVFTCLYVHNPELIQDPALKAFALGILKVCDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELDHQQCLALFSRIKFTR--LLLTALI-------SFTKKETSAVSEAQKLMSQAADLLPAIHSTIQYG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFTKLIER---------IKTVCDVINTSN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLI--DNKKVF----------------------------GTHLMQDMIKDALRYFVSPPVLSSKCSLYNNHQAKDYIDSFVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLMKLEPQ-------RQHLACLGTWVLYHNLRIMIHYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEE-RILEEQQQKGRSSKKSKKKKKARPLGKEITMSQAYQNMCAGMYKTMIALDMDGKVRKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYIQFKEMSDL----KKYSPPPRSADLYMAASKHFQQ--AKLILENVTSPDAEVNRILKVAKPNIVVMKLLAGGHKKDTKALPEFDFSAHKYFPIVKI 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Match: W5KVH1 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.831e-61
Identity = 212/779 (27.21%), Postives = 363/779 (46.60%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +N   +D+T++F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++ + + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  + I +  LK     +  +    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  RI+F R  LL T ++       +  + + S   E+ K +S     +  +  TI  G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+    L++   + +  +  + +  FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+ ++L+   +K R     +       +   I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 IPEKMRNNANWVDITQDFKGACKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDEAIRVKDLSLPELIGIVDTCFCCLITWLEGHSLAQTVFTCLYVHNPELILDPALKAFALGILKVCDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELDHQQCLALFSRIKFTR--LLLTALI-------SFTKKETSAVSEAQKLMSQAADLLHAIHSTIQYG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSKLIDR---------IKTMCEVINTTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLI--DNKKVF----------------------------GTHLMQDMIKDALRYFVSPPVLSTKCSLYNNHQAKDYIDSFVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLLKLEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEE-RILEEQQQKGRSSKKSKKKKKARPLGKEITMSQAYQNMCAGMYKTMIALDMDGKVRKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYIQFKEMSDL----KKYSPPPRSADLYMAASKHFQQ--AKLILENVASPDAEVNRILKVAKPNIVVMKLLAGGHKKETKALPEFDFSAHKYFPIVKI 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Cavefish
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:103036115])

HSP 1 Score: 231.876 bits (590), Expect = 6.934e-65
Identity = 212/779 (27.21%), Postives = 363/779 (46.60%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            + +KM +N   +D+T++F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A++ + + ++D+S   L GI+D    CL+ WL+G +L QTVF  +Y+H  + I +  LK     +  +    R+ + KA+V EEEDF   T    + +NV D ++T +LK+ +D+  R +K +      + DP +       ++L  RI+F R  LL T ++       +  + + S   E+ K +S     +  +  TI  G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    EV    N + +   F C+ ++QS CV SRSLL   +++   N ++                               +   ++IK ++R F+    L++   + +  +  + +  FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  +   + +   Q       R       ++V     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+ ++L+   +K R     +       +   I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K     L  FD S  K FP++K+
Sbjct:   18 IPEKMRNNANWVDITQDFKGACKELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKDEAIRVKDLSLPELIGIVDTCFCCLITWLEGHSLAQTVFTCLYVHNPELILDPALKAFALGILKVCDIAREKVNKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLKDVEDELQRKVKSTRSRQGEQRDPEVELDHQQCLALFSRIKFTR--LLLTALI-------SFTKKETSAVSEAQKLMSQAADLLHAIHSTIQYG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREEMVNYFSKLIDR---------IKTMCEVINTTN-LHSILDFFCEFSEQSPCVLSRSLLQTTFLI--DNKKVF----------------------------GTHLMQDMIKDALRYFVSPPVLSTKCSLYNNHQAKDYIDSFVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHGLLLKLEPQ-------RQHLACLGTWVLYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEE-RILEEQQQKGRSSKKSKKKKKARPLGKEITMSQAYQNMCAGMYKTMIALDMDGKVRKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYIQFKEMSDL----KKYSPPPRSADLYMAASKHFQQ--AKLILENVASPDAEVNRILKVAKPNIVVMKLLAGGHKKETKALPEFDFSAHKYFPIVKI 724          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000300.1 (pep scaffold:Pmarinus_7.0:GL501321:21469:29435:-1 gene:ENSPMAG00000000264.1 transcript:ENSPMAT00000000300.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 4.655e-18
Identity = 116/507 (22.88%), Postives = 187/507 (36.88%), Query Frame = 1
Query:  880 LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIR---LTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKLPEMAHVCGRYTKPV-------VCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQ-------LDNIA-------------KNNMIVARILARGSKP-GPVVLNFDESKEKAFPLIKL 2307
            ++GFEP +NQ LLPP  PR A I  R   +EY   LI ++    ++  I++ S       F      F   + Q  CV SRSLL    + F ++++ +           ++                            R F+    L+    + +  +  E +  F+         +   H  NR+RQR++L  +++  + L DE  KVD  + + +       +  +  R       ++V     R M  Y++SGFEL LY   E   +++ L + +  + +S     +  Q  E+   L    +K R     +       +   I   ++Y +   G++        DGK+           KP        V +E RF+P  S    V +     +AQ  E+ N                   K      AE F  S G         LDN+A             K N +V ++LA G K    V   FD S  K FP+IKL
Sbjct:  202 MMGFEPLVNQRLLPPTFPRYAKIIRRDDMVEYFRALIERIKAVCEL--INLAS-------FHSVLEFFIAFSEQSPCVLSRSLL---QVTFLADNKKVFGTHLLQEMLRDAL---------------------------RAFVSPPVLSHKCSLYNHAQAREYVETFLSHAVRPFCSLIQIHGHNRARQRDKLGHVLEDFYTLQDEAEKVDAALHTML-------IKQEPQRQHLAYIGTWVLYHNLRVMIQYILSGFELELYNVHEYHYIFWYLSELLYGWLISTLSRADAAQLAEEK--LSEETQKGRSSKKSKKKKRARPLGKEIAMNQAYQSYCAGMYKAMVGFDLDGKV----------VKPTFELDGEQVRFEHRFAPFNS----VITPPPVHYAQFKEMTNLA-----------------KYNPPLQAEDFYNSAGKHFQQTKLILDNMASPDPEINSLLKIVKTNYVVMKLLAGGHKKDSKVPPEFDFSAHKYFPIIKL 629          

HSP 2 Score: 53.9138 bits (128), Expect = 1.462e-7
Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 1
Query:   88 IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALE 264
            ++++ +F   CK++  GEL H   F L + M+AIE+MDPKMDA M   Q+ R+V+   +A++
Sbjct:   30 MEISTDFTDSCKELKLGELIHDKGFGLFEAMSAIEMMDPKMDAGMIGNQVNRQVLNFEQAIK 91          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Medaka
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:101172739])

HSP 1 Score: 172.94 bits (437), Expect = 2.171e-44
Identity = 122/381 (32.02%), Postives = 200/381 (52.49%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            + +KM +N   +D+T  F   CK+++ GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A+++  + ++D+S   L GIID    CL+ WL+G +L QTVF  +Y+H  D I+   LK     +  +    R+ I KA+V EEEDF   T    + +NV D ++T +L++ +D+  R +K +      + +P +       ++L  RI+F       TR++   L     K+T  S   E+ K ++     +  +  +I +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    +V    N +     F C+ ++QS CV SRSLL   +++
Sbjct:   18 IPEKMKNNANWVDITHEFKNACKELDLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKEGAIKVKDLSLPELIGIIDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEEPALKAFALGILKVCDIAREKINKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLRDVEDELQRKVKSTRSRQGEQRNPEVELEHQHCLALFNRIKF-------TRLLLSALIAFTKKET--SSVNEAQKLVTQAADLLSSIHSSIQHG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREDMVAYFSKLIER---------IKTVCDVINTTN-LHGILDFFCEFSEQSPCVLSRSLLQTTFLI 376          

HSP 2 Score: 70.0922 bits (170), Expect = 7.658e-12
Identity = 57/216 (26.39%), Postives = 95/216 (43.98%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIIS 2010
            FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  + S + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L +    K R     +    +  ++  I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S
Sbjct:  423 FVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHSLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERILEE--QLKGRSSKKSKKKKKVRPLSKEITMSQAYQNMCAGMYKTMVALDMDGKVHKPQF-----ELDSEQVRYEHRFAPFNS 624          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Medaka
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:101172739])

HSP 1 Score: 172.17 bits (435), Expect = 2.419e-44
Identity = 122/381 (32.02%), Postives = 200/381 (52.49%), Query Frame = 1
Query:   58 LSKKMIDNTE-IDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            + +KM +N   +D+T  F   CK+++ GEL H   F L + M+AIE+MDPKMDA M   Q+ RKV+   +A+++  + ++D+S   L GIID    CL+ WL+G +L QTVF  +Y+H  D I+   LK     +  +    R+ I KA+V EEEDF   T    + +NV D ++T +L++ +D+  R +K +      + +P +       ++L  RI+F       TR++   L     K+T  S   E+ K ++     +  +  +I +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    +V    N +     F C+ ++QS CV SRSLL   +++
Sbjct:   18 IPEKMKNNANWVDITHEFKNACKELDLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKEGAIKVKDLSLPELIGIIDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEEPALKAFALGILKVCDIAREKINKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLRDVEDELQRKVKSTRSRQGEQRNPEVELEHQHCLALFNRIKF-------TRLLLSALIAFTKKET--SSVNEAQKLVTQAADLLSSIHSSIQHG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREDMVAYFSKLIER---------IKTVCDVINTTN-LHGILDFFCEFSEQSPCVLSRSLLQTTFLI 376          

HSP 2 Score: 80.1073 bits (196), Expect = 4.749e-15
Identity = 84/322 (26.09%), Postives = 141/322 (43.79%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGS------QLDNIAKNNMIVARILARGSKPGPVVL-NFDESKEKAFPLIKL 2307
            FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  + S + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L +    K R     +    +  ++  I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S         Y QF +  +L            +A  + A  K  ++  A+  +E+  S      ++  +AK N++V ++LA G K    VL  FD S  K FP++K+
Sbjct:  423 FVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHSLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERILEE--QLKGRSSKKSKKKKKVRPLSKEITMSQAYQNMCAGMYKTMVALDMDGKVHKPQF-----ELDSEQVRYEHRFAPFNSV-VTPPPVHYIQFKEMSDL----KKYNPPPGSADLYLAASKHFQQ--AKLILENVLSPDPEVNRILKVAKPNIVVMKLLAGGHKKETKVLPEFDFSAHKYFPIVKI 723          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Medaka
Match: naa35 (N(alpha)-acetyltransferase 35, NatC auxiliary subunit [Source:NCBI gene;Acc:101172739])

HSP 1 Score: 150.214 bits (378), Expect = 3.592e-37
Identity = 108/340 (31.76%), Postives = 177/340 (52.06%), Query Frame = 1
Query:  178 MTAIELMDPKMDARM---QIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPC----ESDPII-------ISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYG-LIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQS-CVFSRSLLLAFYMM 1149
            M+AIE+MDPKMDA M   Q+ RKV+   +A+++  + ++D+S   L GIID    CL+ WL+G +L QTVF  +Y+H  D I+   LK     +  +    R+ I KA+V EEEDF   T    + +NV D ++T +L++ +D+  R +K +      + +P +       ++L  RI+F       TR++   L     K+T  S   E+ K ++     +  +  +I +G    + + D +K  +  ++GFEP +NQ LLPP  PR A I +R+  + Y  +LI +         I    +V    N +     F C+ ++QS CV SRSLL   +++
Sbjct:    1 MSAIEMMDPKMDAGMIGNQVNRKVLNFEQAVKEGAIKVKDLSLPELIGIIDTCFCCLITWLEGHSLAQTVFTCLYVHNPDLIEEPALKAFALGILKVCDIAREKINKAAVFEEEDFQAMTYGFKMANNVTDLRVTGMLRDVEDELQRKVKSTRSRQGEQRNPEVELEHQHCLALFNRIKF-------TRLLLSALIAFTKKET--SSVNEAQKLVTQAADLLSSIHSSIQHG---IQSQNDTTKGDHPIMMGFEPLVNQRLLPPTFPRYAKIIKREDMVAYFSKLIER---------IKTVCDVINTTN-LHGILDFFCEFSEQSPCVLSRSLLQTTFLI 318          

HSP 2 Score: 69.3218 bits (168), Expect = 1.008e-11
Identity = 57/216 (26.39%), Postives = 95/216 (43.98%), Query Frame = 1
Query: 1369 FVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKL--PEMAHVCGRYTKPVVCYEKRFSPIIS 2010
            FV  C+     +   H  NR+RQR++L  I++    L DE  KVD  + S + +   Q       R       +++     R M  YL+SGFEL LY+  E   +Y+ L + +  + +S     +++Q  E+  L +    K R     +    +  ++  I   ++Y N+  G++    AL  DGK+  P+            V YE RF+P  S
Sbjct:  365 FVTHCSRPFCSLIQIHGHNRARQRDKLGHILEEFATLQDEAEKVDAALHSLLMKLEPQ-------RQHLACLGTWILYHNLRIMIQYLLSGFELELYSMHEYYYIYWYLSEFLYAWLMSTLSRADSSQMAEERILEE--QLKGRSSKKSKKKKKVRPLSKEITMSQAYQNMCAGMYKTMVALDMDGKVHKPQF-----ELDSEQVRYEHRFAPFNS 566          
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Planmine SMEST
Match: SMESG000045115.1 (SMESG000045115.1)

HSP 1 Score: 1422.91 bits (3682), Expect = 0.000e+0
Identity = 734/746 (98.39%), Postives = 737/746 (98.79%), Query Frame = 1
Query:   70 MIDNTEIDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINXXXXXXXXXXXXXXFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARGSKPGPVVLNFDESKEKAFPLIKL 2307
            MIDN+EIDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDI SEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAID    + T +  SGGSNTINNHHNFVNNSKIEIIKSSIRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINSKSLSELYEAAAASFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARGSKPGPVVLNFDESKEKAFPLIKL
Sbjct:    1 MIDNSEIDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDARMQIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLGQTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFYISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRIRFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKETISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAMEYLEQLIIKLIHTNQILAIDISSEVFTGWNFIQNFGRFGCDAAQQSCVFSRSLLLAFYMMFFSNSQLMVAID---NSNTTTTNSGGSNTINNHHNFVNNSKIEIIKSSIRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHCLNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRDIPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYFLSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKSYYNLTIGLFYLTCALTKDGKLPEMAHVCGRYTKPVVCYEKRFSPIISRGWFVESASYRQFAQQIELINSKSLSELYEAAAASFDACRKSIEKCPAEQFIESTGSQLDNIAKNNMIVARILARGSKPGPVVLNFDESKEKAFPLIKL 743          
The following BLAST results are available for this feature:
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NAA357.901e-4430.85N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
NAA356.281e-3434.42N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
natc-11.117e-1235.07N-alpha-AcetylTransferase C complex subunit [Sour... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Naa357.258e-5726.00gene:FBgn0034982 transcript:FBtr0100398[more]
Naa359.058e-5726.03gene:FBgn0034982 transcript:FBtr0072280[more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naa352.727e-6127.66N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
naa351.015e-6126.85N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
naa356.158e-4725.23N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
naa351.016e-3830.38N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
naa351.351e-3228.76N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naa351.220e-4231.49N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
Naa359.138e-4231.01N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
Naa351.506e-2933.02N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
Naa351.127e-1934.35N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
Naa351.818e-1240.74N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T322|NAA35_DANRE4.314e-6127.79N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
sp|Q5ZHV2|NAA35_CHICK1.268e-5926.46N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
sp|Q9W1A2|NAA35_DROME9.079e-5626.03N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
sp|Q5RBT3|NAA35_PONAB3.794e-4330.85N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
sp|Q5VZE5|NAA35_HUMAN3.794e-4330.85N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A060WH532.634e-6228.06Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
A0A5K4EFD34.146e-6227.52Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A556U2785.008e-6227.20N-alpha-acetyltransferase 35, NatC auxiliary subun... [more]
A0A5N5NNG28.406e-6227.21Uncharacterized protein OS=Pangasianodon hypophtha... [more]
W5KVH11.831e-6127.21N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
naa356.934e-6527.21N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000300.14.655e-1822.88pep scaffold:Pmarinus_7.0:GL501321:21469:29435:-1 ... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
naa352.171e-4432.02N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
naa352.419e-4432.02N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
naa353.592e-3731.76N(alpha)-acetyltransferase 35, NatC auxiliary subu... [more]
back to top
BLAST of N(alpha)-acetyltransferase 35, NatC auxiliary subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000045115.10.000e+098.39SMESG000045115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018007 ID=SMED30018007|Name=N(alpha)-acetyltransferase 35, NatC auxiliary subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2549bp
TTTTTTTTGAATTATTTAATATTATTTAACAACTGTTTTTTAAGATATCA
ATGAATTCTTTCGAAAAAAATGATTGATAATACAGAAATTGATGTAACTG
AAAATTTTTTTCAAGTTTGTAAACAAATTAATCCAGGGGAACTAAGTCAT
GTCAATAGTTTTGATTTACAAGATGTTATGACAGCAATTGAGTTAATGGA
TCCTAAAATGGATGCACGCATGCAAATTCAAAGAAAAGTAATCTATTTGA
ATGAAGCTCTCGAAAAACAACTACTTCCTCTAGAGGATATTTCTCCTAAA
TTACTTCATGGAATTATTGATGAAACGTTGTCGTGCTTAGTGAATTGGTT
AAAAGGCGACACCTTAGGTCAAACAGTATTTATTAATATGTATATGCATT
GTACTGATCAAATTAAAAATAAAACCTTGAAAGGTGTCTGTGAAGCTGTG
AAAGGTATTATTGTATTCATTAGAGATGTCATATGTAAGGCTAGTGTTGT
TGAAGAAGAAGATTTTTACATATCTACATCTCGCATGCCTCTTGACGATA
ATGTCGGTGATAATAAAATCACTAGTCTGTTGAAAGAAGCAGACGATGAT
TTCGCTAGAACTCTCAAAATATCTCCCTGTGAATCTGATCCAATTATCAT
CAGCCTTCAATATCGAATTAGATTTATCAGAACGTTTCTTCTTTGGACTC
GAATAGTGAAAAAATTCCTTCAAACACCCAATTGTAAACAGACAAAAGAT
TCAGTTTACATTGAAAGTTGTAAATATTTATCGACAATGAAAGGATTTAT
TGAGAAAATGAAAGAAACGATTTCCAACGGTGAACCGGTGGGAAAAGGTA
AAAAAGACCCATCGAAAGAAACCTACGGATTGATTGGATTTGAACCGTAT
TTGAATCAACCTCTTTTACCTCCTGCAATTCCCCGTTGTGCAGATATCGA
AGAACGTCAATCGGCAATGGAGTATTTAGAACAGTTAATTATCAAATTGA
TCCACACCAATCAAATTCTAGCAATCGATATTGGCAGTGAAGTTTTCACC
GGTTGGAATTTTATTCAAAACTTTGGGAGATTTGGCTGTGACGCTGCACA
ACAGAGCTGTGTTTTCTCTCGCAGCTTGCTTCTGGCGTTCTATATGATGT
TTTTCAGCAACTCGCAACTGATGGTTGCCATTGACAATAGCAATACCACT
ACCACCAACAGTGGCGGAAGCGGCGGCAGCAACACCATCAACAATCATCA
TAATTTCGTCAACAACTCCAAAATCGAGATCATCAAATCGAGCATCCGCC
AATTTATCCGATTGACTAGCTGGTTGGATATCGAATCGACAATCAAGCTC
GACGAGAAACTATCGATTTTCGTGGGTGCTTGCGCGGAAAACCTCTTTCA
AATCCCGATTACCCACTGCTTGAATCGGTCTCGCCAACGGAACCGACTCG
AACTCATCATCGACGCTCACTGGGACCTCTACGATGAATGTCTGAAGGTC
GATCACATCGTTCGATCTTATATCAATCAGAAATACCAGCAATCGGTGCC
CAATAAGCGCAACAGAGATATCCCACCGATTTTCAGCTCGTTTGTCGCAT
TGTTCCAGTTCCGGACGATGTTCGATTATCTGGTCAGCGGATTCGAGCTG
AATCTCTATGCACCACAGGAACTGATGGCGGTTTACTTTATTCTCGGTGA
CAACGTGCTGAAATACTTTCTCTCCCATTACCACGAGATCGAGAACACTC
AACAGAGGGAACAATCGAAATTGTTGAAAGTGACCAATAAGAAGTCGAGA
AAACAAATCGATAAAGAAATCACGGGAAACCTCGCGAATATCGCAAACAT
GATATGGAAATTGAAATCCTACTACAATCTGACTATTGGACTGTTCTATT
TGACATGCGCTCTCACCAAGGACGGGAAATTGCCGGAAATGGCACACGTG
TGCGGTCGCTACACGAAACCGGTCGTTTGCTATGAGAAACGGTTCTCACC
GATTATTTCACGTGGCTGGTTTGTTGAGAGCGCCTCCTATCGGCAATTCG
CTCAACAGATCGAGCTGATCAACTCGAAATCACTTTCGGAACTTTATGAG
GCGGCAGCGGCAAGTTTTGACGCTTGCCGGAAATCGATAGAAAAGTGCCC
GGCTGAGCAGTTCATTGAGTCAACCGGCAGCCAATTGGATAATATTGCCA
AGAACAACATGATCGTCGCTAGGATACTCGCGCGTGGCTCCAAACCCGGC
CCGGTGGTTTTGAATTTCGATGAGTCGAAGGAAAAAGCTTTTCCATTGAT
TAAATTGTAATATAATTATGATTTCGAGCGAGTGAGAAATAATAATAAAA
AAATCGATTTTCTTTGCCTTTTCCTAGGTTCATTTTTTATATTTTAATTT
GGATAATTCAGTGAGCGAGCTAAGCCAATCAATCGATGAAGAGATTTGTT
TGTTATTAAACGTGGCCAAAAGTGTGATTCCGACTATTTTACCGTAAAAA
TAAATAGTTTAGGATTATTTTTATGATAATATGTAATGAAATAAATCGG
back to top

protein sequence of SMED30018007-orf-1

>SMED30018007-orf-1 ID=SMED30018007-orf-1|Name=SMED30018007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MGEKVFQHVVTENKVNRHQFLWCIEIQLESADQIIEHRPELEQCDKRAEN
RWDISVALIGHRLLVFLIDIRSNDVIDLQTFIVEVPVSVDDEFESVPLAR
PIQAVGNRDLKEVFRASTHENR*
back to top

protein sequence of SMED30018007-orf-2

>SMED30018007-orf-2 ID=SMED30018007-orf-2|Name=SMED30018007-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=747bp
MIDNTEIDVTENFFQVCKQINPGELSHVNSFDLQDVMTAIELMDPKMDAR
MQIQRKVIYLNEALEKQLLPLEDISPKLLHGIIDETLSCLVNWLKGDTLG
QTVFINMYMHCTDQIKNKTLKGVCEAVKGIIVFIRDVICKASVVEEEDFY
ISTSRMPLDDNVGDNKITSLLKEADDDFARTLKISPCESDPIIISLQYRI
RFIRTFLLWTRIVKKFLQTPNCKQTKDSVYIESCKYLSTMKGFIEKMKET
ISNGEPVGKGKKDPSKETYGLIGFEPYLNQPLLPPAIPRCADIEERQSAM
EYLEQLIIKLIHTNQILAIDIGSEVFTGWNFIQNFGRFGCDAAQQSCVFS
RSLLLAFYMMFFSNSQLMVAIDNSNTTTTNSGGSGGSNTINNHHNFVNNS
KIEIIKSSIRQFIRLTSWLDIESTIKLDEKLSIFVGACAENLFQIPITHC
LNRSRQRNRLELIIDAHWDLYDECLKVDHIVRSYINQKYQQSVPNKRNRD
IPPIFSSFVALFQFRTMFDYLVSGFELNLYAPQELMAVYFILGDNVLKYF
LSHYHEIENTQQREQSKLLKVTNKKSRKQIDKEITGNLANIANMIWKLKS
YYNLTIGLFYLTCALTKDGKLPEMAHVCGRYTKPVVCYEKRFSPIISRGW
FVESASYRQFAQQIELINSKSLSELYEAAAASFDACRKSIEKCPAEQFIE
STGSQLDNIAKNNMIVARILARGSKPGPVVLNFDESKEKAFPLIKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0017196N-terminal peptidyl-methionine acetylation
Vocabulary: cellular component
TermDefinition
GO:0031417NatC complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR007244Naa35/Mak10
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007244-alpha-acetyltransferase 35, NatC auxiliary subunitPFAMPF04112Mak10coord: 23..121
e-value: 1.2E-17
score: 64.0
IPR007244-alpha-acetyltransferase 35, NatC auxiliary subunitPANTHERPTHR21373GLUCOSE REPRESSIBLE PROTEIN MAK10coord: 6..723