SMED30018004

Overview
NameSMED30018004
Smed IDSMED30018004
Length (bp)2058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30018004 (SMED30018004) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30018004 (SMED30018004) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30018004 (SMED30018004) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30018004 (SMED30018004) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30018004

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30018004SMESG000039905.1 SmedASXL_015093SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30018004SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30018004SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30018004SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30018004SMESG000039905.1 dd_Smed_v6_8655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30018004SMESG000039905.1 OX_Smed_1.0.01644ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30018004SMESG000039905.1 dd_Smed_v4_8655_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30018004 vs. Ensembl Human
Match: BYSL (bystin like [Source:HGNC Symbol;Acc:HGNC:1157])

HSP 1 Score: 121.709 bits (304), Expect = 6.971e-29
Identity = 88/303 (29.04%), Postives = 160/303 (52.81%), Query Frame = -2
Query:  177 INEEDKIALEKFLNP-----EIVTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNI-TGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N        + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G+L PK  K++P +++W   +   +   W++ A+    ++F+  ++ +     + ++   LLP VR+ +AE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM   +  MEYS    I LR  LDKKY LPY  ++  V +F      + ++P++W Q L   +  Y   L  +    L  L R+  H +++P +
Sbjct:  125 VDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFP-MPQLD----PRVLEVYRGVREVLSKYRSGKL-PKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKER---MAQRFYNLVLLPRVRDDVAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAM-LKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEI 417          
BLAST of SMED30018004 vs. Ensembl Human
Match: BYSL (bystin like [Source:HGNC Symbol;Acc:HGNC:1157])

HSP 1 Score: 61.2326 bits (147), Expect = 3.932e-10
Identity = 46/167 (27.54%), Postives = 92/167 (55.09%), Query Frame = -2
Query:  582 INEEDKIALEKFLNP-----EIVTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFR 1040
            ++ ED+ A+E F+N        + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G+L PK  K++P +++W   +   +   W++ A+    ++F+  ++ +  +    ++   LLP VR+ +AE+KRL+  LY  L+ ALF+
Sbjct:   16 VDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFP-MPQLD----PRVLEVYRGVREVLSKYRSGKL-PKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQR---FYNLVLLPRVRDDVAEYKRLNFHLYMALKKALFK 173          
BLAST of SMED30018004 vs. Ensembl Celegans
Match: byn-1 (Cell adhesion protein byn-1 [Source:UniProtKB/Swiss-Prot;Acc:Q20932])

HSP 1 Score: 112.079 bits (279), Expect = 4.375e-26
Identity = 84/310 (27.10%), Postives = 153/310 (49.35%), Query Frame = -2
Query:  147 INEEDKIALEKFLNPEIVT-----DMIEGMAEARKEVSEL-MGFDDIEEIDLADVEG-LAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDN-ITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKSSD 1040
            ++  D+  L +FL  + +      D+I+   EA++  +EL +   D  E ++ D++  + E  + I + M  Y+ G++ PK  K++P++ +W   +       W++ A+    ++F+  +     K  + ++   LLP +R+ I E K+L+  LY+ L  A+++   F   L+LP  +    T REA I  +++    I +  +A AM   +  MEY+    + LRA +DKKY LPY  ++  V +F +    E  MP++W Q L      Y   LN E    +  L R H H  ++P +   L  K ++
Sbjct:  125 LDPRDEADLARFLKKDAIQMSTLYDIIQAKIEAKQNDAELALSQVDPNEFNMRDMDPEVVEMYEQIGQYMSKYRSGKV-PKAFKIIPKMINWEQILFLTKPETWTAAAMYQATRLFASNM---NPKMCQRFYTLVLLPRLRDDIDEFKKLNYHLYQALCKAIYKPAAFFKGLILPLLESGTCTLREAVIFSSVLTKVPIPIFHSAAAM-LRIAEMEYTGANSVFLRALIDKKYALPYRAVDGVVNHFIRLKTDERDMPVLWHQCLLALCQRYKNDLNAEQKAAIYELIRFHGHYLISPEIRRELESKETE 429          
BLAST of SMED30018004 vs. Ensembl Fly
Match: bys (gene:FBgn0010292 transcript:FBtr0071090)

HSP 1 Score: 118.242 bits (295), Expect = 4.977e-28
Identity = 89/315 (28.25%), Postives = 157/315 (49.84%), Query Frame = -2
Query:  153 INEEDKIALEKFLNPE------------IVTDMIEGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDD-NITGREADILGNIIKSSTIKLDVAAPAMTCLMN--NMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKS 1040
            ++E+D  A E+F  P             I+  + E  A+   ++S+  G   IEEID      + E  + +R ++  Y+ G++ PK  K++P++ +W   +   +  NWS+ A+    ++F   +        + ++   LLP VR+ + E+K+L+  LY  L+ ALF+   FM  ++LP  +  + T REA I G+++  S+I +     +  CL+    M YS    I +R FLDK+Y LPY  ++  V +F +    + ++P++W Q+L  F   Y   ++ E    L  L +   H K+TP V   L+  S
Sbjct:  104 MDEDDVAAFERFQQPAQEGKRTLHLSKMIMQKIQEKEADIHTKISD-EGSLKIEEID----PKVKEMYEGVRDVLKRYRSGKI-PKAFKIIPKLRNWEQILFITEPHNWSAAAMFQGTRIFCSVL---SQAMAQRFYNLVLLPRVRDDLCEYKKLNMHLYNALKRALFKPAAFMKGIILPLLEGGDCTLREAIIFGSVVARSSIPV---LHSSACLLKICEMAYSGANSIFIRYFLDKRYALPYRVVDAAVFHFLRFENDKRELPVLWHQSLLTFAQRYKNDISSEQRDALLQLLKKKSHFKITPDVRRELQAAS 406          
BLAST of SMED30018004 vs. Ensembl Zebrafish
Match: bysl (bystin-like [Source:ZFIN;Acc:ZDB-GENE-040426-1287])

HSP 1 Score: 123.25 bits (308), Expect = 2.219e-29
Identity = 86/299 (28.76%), Postives = 157/299 (52.51%), Query Frame = -2
Query:  177 INEEDKIALEKFL--NPEI---VTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDD-NITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A++ F+  NP +   + D+I E + E + EV  ++       +   D   + E  + + K++  Y+ G+L PK  K++P +++W   +   +   WS+ A+    ++FS  ++ +  +    ++   LLP +R+ IAE+KRL+  LY  L+ ALF+   +   +LLP C+  + T REA I+G+II   +I +  ++ AM  L   MEY+    I LR  LDKKY LP+  ++  V +F      +  +P++W Q+L   +  Y   L+ E    L  L + H H +++  +
Sbjct:  152 VDPEDEQAIQMFMSKNPPMRRTLADIIMEKITEKQTEVGTVLSEVSGHAMPQMDPR-VVEVYRGVSKVLSKYRSGKL-PKAFKIIPALSNWEQVLYLTEPETWSAAAMYQATRIFSSNLKERMAQR---FYNLVLLPRIRDDIAEYKRLNFHLYSALKKALFKPAAWFKGILLPLCESGSCTLREAIIIGSIITKCSIPVLHSSAAMLKL-AEMEYNGANSIFLRLMLDKKYALPFRVLDALVAHFLSFRTDKRILPVLWHQSLLTLVQRYKADLSSEQKEALLELLKAHTHPQISSEI 444          
BLAST of SMED30018004 vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:Xenbase;Acc:XB-GENE-974407])

HSP 1 Score: 124.79 bits (312), Expect = 5.348e-30
Identity = 89/296 (30.07%), Postives = 155/296 (52.36%), Query Frame = -2
Query:  186 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNI-TGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVT 1040
            IN ED+ A+E F+N  P +   + D+I E + E + EV  +M       +   D   L E  K +++++  Y+ G+L PK  K++P +++W   +   +   W++ A+    ++FS  +     +  + Y+   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM  +   MEY+    I LR  +DKKY LP+  ++  V +F      +  +P++W Q+L      Y   ++ E    L  L R+H H +++
Sbjct:  129 INPEDEKAMEMFMNKNPPLRRTLADIIMEKITEKQTEVETMMSEVSGRPMPQLDPRVL-EVYKGVKEVLSSYRSGKL-PKAFKIVPALSNWEQILYITEPETWTAAAMYQATRIFSSNL---SERMAQRYYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAVIIGSIITKCSIPVLHSSAAMLKIAE-MEYNGANSIFLRLLIDKKYALPFRVLDALVFHFLAFRSDKRTLPVLWHQSLLTLCQRYKDDMSSEQKEALLDLLRIHTHPQIS 418          
BLAST of SMED30018004 vs. Ensembl Mouse
Match: Bysl (bystin-like [Source:MGI Symbol;Acc:MGI:1858419])

HSP 1 Score: 125.946 bits (315), Expect = 1.990e-30
Identity = 92/303 (30.36%), Postives = 161/303 (53.14%), Query Frame = -2
Query:  177 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDN-ITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N  P +   + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G+L PK  KV+P +++W   +   +   W++ A+    ++F+  ++ +     + ++   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM   +  MEYS    I LR  LDKKY LPY  ++  V +F      + ++P++W Q L      Y   L  E    L  L R+  H +++P +
Sbjct:  124 VDPEDERAIEMFMNKNPPVRRTLADIIMEKLTEKQTEVETVMSEVSGFP-MPQLD----PRVLEVYRGVREVLCKYRSGKL-PKAFKVIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKER---MAQRFYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAM-LKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFHFLAFRTEKRQLPVLWHQCLLTLAQRYKADLATEQKEALLELLRLQPHPQLSPEI 416          
BLAST of SMED30018004 vs. UniProt/SwissProt
Match: sp|A9UNU6|BYST_MONBE (Bystin OS=Monosiga brevicollis OX=81824 GN=bysl PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 4.514e-33
Identity = 92/315 (29.21%), Postives = 166/315 (52.70%), Query Frame = -2
Query:  132 INEEDKIALEKFLNPE-----IVTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSST----AVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCD-DNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV-LAFLRMKSSDQAMDI 1040
            I+E D++AL  F+  E      + D+I E +   R EV+  +      E++      + E  + + +++  Y+ G+L PK  K++P++ +W   +   +  NW++     A ++F+  ++ K  +    ++   LLP VR+ IAE+KRL+  LY+ ++ A+F+   F    LLP C+  + T REA I+G I+   +I +  ++ AM   M  M YS    I LR  LDKKY+LP+  ++  V +F++ +    ++P++W Q L +F+  Y   +  E  R L  + R H H  +TP +    ++ KS D+ M +
Sbjct:  104 IDEHDEVALRAFMPAEPAQRRTLADIIMEKIQGKRTEVASQVSQTGPRELN----PKVIEVYQGVGQVLSRYRSGKL-PKAFKIIPRLKNWEEIVYITEPENWTAASMYAATRLFASNLKEKMAQR---FYNLILLPRVRDDIAEYKRLNFHLYQAIKKAIFKPGAFFKGFLLPLCEAGDCTLREAVIIGGILVRKSIPVLHSSAAM-LKMAEMPYSGATSIFLRVLLDKKYSLPFRVVDAVVAHFYRFNADHRQLPVLWHQCLLVFVQRYKEDITSEQKRALLDVLRSHNHYAITPEIRRELVQSKSRDREMPL 409          
BLAST of SMED30018004 vs. UniProt/SwissProt
Match: sp|A7S7F2|BYST_NEMVE (Bystin OS=Nematostella vectensis OX=45351 GN=bysl PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.098e-32
Identity = 83/246 (33.74%), Postives = 133/246 (54.07%), Query Frame = -2
Query:  177 EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWN--FFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDD-NITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 893
            E L +  K + +++  Y+ G+L PK  K +P + +W    F+ + D   WS+ A+    ++F   + AK  +    +F   LLP +++ IAE+KRL+  LY  L+ ALF+   F   +LLP C+  N + REA I+ +++  +TI + + + A+   +  M YS    I LR   DKKY LPY  I+  V +F +    +  +P++W Q L  F+  Y   ++ E    L  LCRVH HDK+TP V
Sbjct:  171 ERLVKVFKGVGEILKKYRSGKL-PKAFKFIPSLTNWEEVLFITEPD--EWSAAALFQATKIFVSNLNAKMAQR---FFNLVLLPRIQDDIAEYKRLNYHLYMALKKALFKPAAFFKGILLPMCESGNCSLREAIIISSVLAKTTIPV-LHSSAVILKIAEMNYSGANSIFLRTLFDKKYALPYRVIDAAVYHFLRFLTDKRTLPVLWHQCLLTFVQRYKEDISSEQKEALMELCRVHVHDKITPEV 409          
BLAST of SMED30018004 vs. UniProt/SwissProt
Match: sp|O54825|BYST_MOUSE (Bystin OS=Mus musculus OX=10090 GN=Bysl PE=1 SV=3)

HSP 1 Score: 125.946 bits (315), Expect = 1.392e-29
Identity = 92/303 (30.36%), Postives = 161/303 (53.14%), Query Frame = -2
Query:  177 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDN-ITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N  P +   + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G+L PK  KV+P +++W   +   +   W++ A+    ++F+  ++ +     + ++   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM   +  MEYS    I LR  LDKKY LPY  ++  V +F      + ++P++W Q L      Y   L  E    L  L R+  H +++P +
Sbjct:  124 VDPEDERAIEMFMNKNPPVRRTLADIIMEKLTEKQTEVETVMSEVSGFP-MPQLD----PRVLEVYRGVREVLCKYRSGKL-PKAFKVIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKER---MAQRFYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAM-LKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFHFLAFRTEKRQLPVLWHQCLLTLAQRYKADLATEQKEALLELLRLQPHPQLSPEI 416          
BLAST of SMED30018004 vs. UniProt/SwissProt
Match: sp|Q80WL2|BYST_RAT (Bystin OS=Rattus norvegicus OX=10116 GN=Bysl PE=1 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 3.650e-29
Identity = 90/303 (29.70%), Postives = 160/303 (52.81%), Query Frame = -2
Query:  177 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDN-ITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N  P +   + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G + PK  K++P +++W   +   +   W++ A+    ++F+  ++ +  +    ++   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM  +   MEYS    I LR  LDKKY LPY  ++  V +F      + ++P++W Q L      Y   L  E    L  L R+  H +++P +
Sbjct:  124 VDPEDERAIEMFMNKNPPVRRTLADIIMEKLTEKQTEVETVMSEVSGFP-MPQLD----PRVLEVYRGVREVLCKYRSG-ILPKAFKIIPALSNWEQILYVTEPEAWTAAAMYQATRIFASNLKERMAQR---FYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIISKCSIPVLHSSAAMLKI-AEMEYSGASSIFLRLLLDKKYALPYRVLDALVFHFLAFRTEKRQLPVLWHQCLLTLAQRYKADLATEQKEALLELLRLQPHPQLSPEI 416          
BLAST of SMED30018004 vs. UniProt/SwissProt
Match: sp|Q5E9N0|BYST_BOVIN (Bystin OS=Bos taurus OX=9913 GN=BYSL PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 5.638e-29
Identity = 90/303 (29.70%), Postives = 160/303 (52.81%), Query Frame = -2
Query:  177 INEEDKIALEKFLNP-----EIVTDMI-EGMAEARKEV----SELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNI-TGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N        + D+I E + E + EV    SE+ GF  + ++D      + E  + +R+++  Y+ G+L PK  K++P +++W   +   +   W++ A+    ++F+  ++ +     + ++   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM   +  MEYS    I LR  LDKKY LPY  ++  V +F      + ++P++W Q L   +  Y   L  E    L  L R+  H +++P +
Sbjct:  123 VDPEDERAIEMFMNQNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFP-VPQLD----PRVLEVYRGVREVLSKYRSGKL-PKAFKIIPALSNWEQILYITEPEAWTAAAMYQATRIFASNLKER---MAQRFYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIITKCSIPVLHSSAAM-LKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATEQKEALLELLRLQPHPQLSPEI 415          
BLAST of SMED30018004 vs. TrEMBL
Match: A0A267EIE9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022562g2 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 5.969e-41
Identity = 99/296 (33.45%), Postives = 161/296 (54.39%), Query Frame = -2
Query:  147 MAEARKEVSE--LMGFDDIEEIDLADV-----EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYF-----HKASEI--EGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFL--------RMKSSD 968
            +AE R E+ E  + G     E   + V     + + EH +  R ++  Y+ G+L PK VK LP  + W   +E LD  +W++ A+   +    AKG      +F+ +LLP  R+ IAE++RL+  LY  L+ ALFR+REF   LLLPW  ++I+  EA I+G +++  +I +  AAPA+  L+  + YS  R I++R  L+KKYNLP   +   + +F       A  +  +G++P++W Q L   +  Y   L+ +  + L  LCR H+H ++TP+V   L        RM+++D
Sbjct:  117 IAEKRTEIDEELVSGVGGGSEAGASRVSSCLPDSVREHFESCRAVLSQYRSGKL-PKPVKQLPHFSQWQELVELLDPNSWTAAAMCAVTKYFAAKGKTQALQFFQGYLLPRCRDDIAEYRRLNFHLYSALRKALFRQREFFCGLLLPWARESISLPEATIIGGLLRRVSIPVKYAAPALHMLL-QLPYSGGRAILIRVLLEKKYNLPDPVLGQALAHFVAMETDSADHLNEDGRLPVLWHQALLALVERYGDYLSGDERQRLLRLCRQHQHPEITPAVRQALGALQQRDARMETAD 410          
BLAST of SMED30018004 vs. TrEMBL
Match: A0A1I8GTL9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 8.354e-41
Identity = 95/278 (34.17%), Postives = 154/278 (55.40%), Query Frame = -2
Query:  177 MAEARKEVSE--LMGFDDIEEIDLADV-----EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYF-----HKASEI--EGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 968
            +AE R E+ E  + G     E   + V     + + EH +  R ++  Y+ G+L PK VK LP  + W   +E LD  +W++ A+   +    AKG      +F+ +LLP  R+ IAE++RL+  LY  L+ ALFR+REF   LLLPW  ++I+  EA I+G +++  +I +  AAPA+  L+  + YS  R I++R  L+KKYNLP   +   + +F       A  +  +G++P++W Q L   +  Y   L+ +  + L  LCR H+H ++TP+V
Sbjct:  136 IAEKRTEIDEELVSGVGGGSEAGASRVSSCLPDSVREHFESCRAVLSQYRSGKL-PKPVKQLPHFSQWQELVELLDPNSWTAAAMCAVTKYFAAKGKTQALQFFQGYLLPRCRDDIAEYRRLNFHLYSALRKALFRQREFFCGLLLPWARESISLPEATIIGGLLRRVSIPVKYAAPALHMLL-QLPYSGGRAILIRVLLEKKYNLPDPVLGQALAHFVAMETDSADHLNEDGRLPVLWHQALLALVERYGDYLSGDERQRLLRLCRQHQHPEITPAV 411          
BLAST of SMED30018004 vs. TrEMBL
Match: A0A1I8GL83 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 9.687e-41
Identity = 95/278 (34.17%), Postives = 154/278 (55.40%), Query Frame = -2
Query:  177 MAEARKEVSE--LMGFDDIEEIDLADV-----EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYF-----HKASEI--EGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 968
            +AE R E+ E  + G     E   + V     + + EH +  R ++  Y+ G+L PK VK LP  + W   +E LD  +W++ A+   +    AKG      +F+ +LLP  R+ IAE++RL+  LY  L+ ALFR+REF   LLLPW  ++I+  EA I+G +++  +I +  AAPA+  L+  + YS  R I++R  L+KKYNLP   +   + +F       A  +  +G++P++W Q L   +  Y   L+ +  + L  LCR H+H ++TP+V
Sbjct:  136 IAEKRTEIDEELVSGVGGGSEAGASRVSSCLPDSVREHFESCRAVLSQYRSGKL-PKPVKQLPHFSQWQELVELLDPNSWTAAAMCAVTKYFAAKGKTQALQFFQGYLLPRCRDDIAEYRRLNFHLYSALRKALFRQREFFCGLLLPWARESISLPEATIIGGLLRRVSIPVKYAAPALHMLL-QLPYSGGRAILIRVLLEKKYNLPDPVLGQALAHFVAMETDSADHLNEDGRLPVLWHQALLALVERYGDYLSGDERQRLLRLCRQHQHPEITPAV 411          
BLAST of SMED30018004 vs. TrEMBL
Match: A0A1I8GG71 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.069e-40
Identity = 95/278 (34.17%), Postives = 154/278 (55.40%), Query Frame = -2
Query:  177 MAEARKEVSE--LMGFDDIEEIDLADV-----EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYF-----HKASEI--EGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 968
            +AE R E+ E  + G     E   + V     + + EH +  R ++  Y+ G+L PK VK LP  + W   +E LD  +W++ A+   +    AKG      +F+ +LLP  R+ IAE++RL+  LY  L+ ALFR+REF   LLLPW  ++I+  EA I+G +++  +I +  AAPA+  L+  + YS  R I++R  L+KKYNLP   +   + +F       A  +  +G++P++W Q L   +  Y   L+ +  + L  LCR H+H ++TP+V
Sbjct:  136 IAEKRTEIDEELVSGVGGGSEAGASRVSSCLPDSVREHFESCRAVLSQYRSGKL-PKPVKQLPHFSQWQELVELLDPNSWTAAAMCAVTKYFAAKGKTQALQFFQGYLLPRCRDDIAEYRRLNFHLYSALRKALFRQREFFCGLLLPWARESISLPEATIIGGLLRRVSIPVKYAAPALHMLL-QLPYSGGRAILIRVLLEKKYNLPDPVLGQALAHFVAMETDSADHLNEDGRLPVLWHQALLALVERYGDYLSGDERQRLLRLCRQHQHPEITPAV 411          
BLAST of SMED30018004 vs. TrEMBL
Match: A0A267EMR7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022562g1 PE=4 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.276e-40
Identity = 99/296 (33.45%), Postives = 161/296 (54.39%), Query Frame = -2
Query:  147 MAEARKEVSE--LMGFDDIEEIDLADV-----EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYF-----HKASEI--EGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFL--------RMKSSD 968
            +AE R E+ E  + G     E   + V     + + EH +  R ++  Y+ G+L PK VK LP  + W   +E LD  +W++ A+   +    AKG      +F+ +LLP  R+ IAE++RL+  LY  L+ ALFR+REF   LLLPW  ++I+  EA I+G +++  +I +  AAPA+  L+  + YS  R I++R  L+KKYNLP   +   + +F       A  +  +G++P++W Q L   +  Y   L+ +  + L  LCR H+H ++TP+V   L        RM+++D
Sbjct:  165 IAEKRTEIDEELVSGVGGGSEAGASRVSSCLPDSVREHFESCRAVLSQYRSGKL-PKPVKQLPHFSQWQELVELLDPNSWTAAAMCAVTKYFAAKGKTQALQFFQGYLLPRCRDDIAEYRRLNFHLYSALRKALFRQREFFCGLLLPWARESISLPEATIIGGLLRRVSIPVKYAAPALHMLL-QLPYSGGRAILIRVLLEKKYNLPDPVLGQALAHFVAMETDSADHLNEDGRLPVLWHQALLALVERYGDYLSGDERQRLLRLCRQHQHPEITPAVRQALGALQQRDARMETAD 458          
BLAST of SMED30018004 vs. Ensembl Cavefish
Match: bysl (bystin like [Source:NCBI gene;Acc:103046097])

HSP 1 Score: 121.324 bits (303), Expect = 5.312e-29
Identity = 84/305 (27.54%), Postives = 158/305 (51.80%), Query Frame = -2
Query:  186 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLA---------EHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNI-TGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVT 1040
            ++ +D+ A++ F+N  P +   + D+I E + E + EV  +M          ++V G+          E  + + K++  Y+ G+L PK  K++P +++W   +   D   W++ A+    ++FS  ++ +     + ++   LLP +R+ IAE+KRL+  LY +L+ ALF+   +   +L+P C+    T REA I+G+II   +I +  ++ AM  L   MEY+    I LR  +DKKY LP+  ++  V +F      +  +P++W Q+L   +  Y   L+ E    L  L ++  H +++
Sbjct:  121 VDPDDEKAIQMFMNKNPPVRRTLADIIMEKLTEKQTEVGTVM----------SEVSGMPNPQLDPRVIEVYRGVSKVLCRYRSGKL-PKAFKIIPALSNWEQVLYLTDPEKWTAAAMYQATRIFSANLKER---MAQRFYNLVLLPRIRDDIAEYKRLNFHLYGSLKKALFKPGAWFKGILIPLCESGTCTLREAIIIGSIITKCSIPVLHSSAAMLKLAE-MEYNGANSIFLRLLMDKKYALPFRVLDALVAHFLSFRSEKRTLPVLWHQSLLTLVQRYKADLSSEQKGALLELLKIQNHSQIS 410          
BLAST of SMED30018004 vs. Ensembl Sea Lamprey
Match: bysl (bystin-like [Source:ZFIN;Acc:ZDB-GENE-040426-1287])

HSP 1 Score: 137.117 bits (344), Expect = 8.561e-36
Identity = 94/299 (31.44%), Postives = 157/299 (52.51%), Query Frame = -2
Query:  177 INEEDKIALEKFLNP-----EIVTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDN-ITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N      + + D+I E + E + EV+  +       +   D   L E  K +R+++  Y+ G+L PK  K++P +++W   +   +  +WS+ AV    ++F+  ++ +  +    +F   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +LLP C+    T REA I+G+I+  S+I + + + A    +  MEYS    + LR FLDKKY LPY  ++  V +F +       +P++W Q L +    Y   L+ E    L  L +VH H  VT  V
Sbjct:   34 VDAEDERAIEMFMNKNPPARQTLADIIMEKITEKQTEVASALSEATGRPMPALDPRVL-EVYKGVREILTKYRSGKL-PKAFKIIPALSNWEQILYVTEPESWSAAAVYQATRIFTSNLKERMAQR---FFNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILLPLCESGTCTLREAIIVGSILSKSSIPV-LHSSAALLKIAEMEYSGANSVFLRLFLDKKYALPYRVLDALVSHFLRFRSDRRTLPVLWHQALLVLTQRYKEDLSSEQKEALLELIKVHGHPAVTGEV 326          
BLAST of SMED30018004 vs. Ensembl Yeast
Match: ENP1 (Protein associated with U3 and U14 snoRNAs; required for pre-rRNA processing and 40S ribosomal subunit synthesis; localized in the nucleus and concentrated in the nucleolus; human BYSL functionally complements the heat sensitivity of an enp1 ts mutant [Source:SGD;Acc:S000000451])

HSP 1 Score: 75.8702 bits (185), Expect = 5.759e-15
Identity = 63/278 (22.66%), Postives = 123/278 (44.24%), Query Frame = -2
Query:  135 LADVEGLAEHLKVIR------KLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSS----TAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHI--AEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHK---------ASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKSSDQAMD 905
            L   EG+A   KVI+       ++  +  G+L PK+ KV+P + +W   +   +   WS      A ++F   + AK  +    +    LL   R++I  +E   L+  +Y+ ++ +L++   F    L P  +     REA I G+++   ++    ++ A++ L+  + +S    + ++  LDKKY LPY T++  V YF +           +    +P++W +    F   Y   + ++    L    R   H  + P +   L   +S + +D
Sbjct:  198 LKSGEGVALPEKVIKAYTTVGSILKTWTHGKL-PKLFKVIPSLRNWQDVIYVTNPEEWSPHVVYEATKLFVSNLTAKESQK---FINLILLERFRDNIETSEDHSLNYHIYRAVKKSLYKPSAFFKGFLFPLVETGCNVREATIAGSVLAKVSVPALHSSAALSYLLR-LPFSPPTTVFIKILLDKKYALPYQTVDDCVYYFMRFRILDDGSNGEDATRVLPVIWHKAFLTFAQRYKNDITQDQRDFLLETVRQRGHKDIGPEIRRELLAGASREFVD 470          
BLAST of SMED30018004 vs. Ensembl Nematostella
Match: BYSL (Bystin [Source:UniProtKB/Swiss-Prot;Acc:A7S7F2])

HSP 1 Score: 134.035 bits (336), Expect = 8.598e-34
Identity = 83/246 (33.74%), Postives = 133/246 (54.07%), Query Frame = -2
Query:  177 EGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWN--FFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDD-NITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 893
            E L +  K + +++  Y+ G+L PK  K +P + +W    F+ + D   WS+ A+    ++F   + AK  +    +F   LLP +++ IAE+KRL+  LY  L+ ALF+   F   +LLP C+  N + REA I+ +++  +TI + + + A+   +  M YS    I LR   DKKY LPY  I+  V +F +    +  +P++W Q L  F+  Y   ++ E    L  LCRVH HDK+TP V
Sbjct:  171 ERLVKVFKGVGEILKKYRSGKL-PKAFKFIPSLTNWEEVLFITEPD--EWSAAALFQATKIFVSNLNAKMAQR---FFNLVLLPRIQDDIAEYKRLNYHLYMALKKALFKPAAFFKGILLPMCESGNCSLREAIIISSVLAKTTIPV-LHSSAVILKIAEMNYSGANSIFLRTLFDKKYALPYRVIDAAVYHFLRFLTDKRTLPVLWHQCLLTFVQRYKEDISSEQKEALMELCRVHVHDKITPEV 409          
BLAST of SMED30018004 vs. Ensembl Medaka
Match: bysl (bystin like [Source:NCBI gene;Acc:101167780])

HSP 1 Score: 118.627 bits (296), Expect = 4.190e-28
Identity = 86/299 (28.76%), Postives = 153/299 (51.17%), Query Frame = -2
Query:  177 INEEDKIALEKFLN--PEI---VTDMI-EGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAV----QVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNI-TGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSV 1040
            ++ ED+ A+E F+N  P +   + D+I E + E + EV  +M       +   D   + E  + + K++  Y+ G+L PK  K++P + +W   +   +  +WS+ A+    ++FS  ++ +     + ++   LLP VR+ IAE+KRL+  LY  L+ ALF+   +   +L+P C+    T REA I+G+I+   +I +  ++ AM  L   MEY+    I LR  LDKKY LP+  ++  V +F      +  +P++W Q+L      Y   L  E    L  L ++  H  ++  +
Sbjct:  122 VDPEDEKAIEMFMNKNPPMRRTLADIIMEKITEKQTEVGTVMSEVSGRPMPQLDPR-ITEVYRGVGKVLSKYRSGKL-PKAFKIIPALANWEQVLYLTEPESWSAAAMYQATRIFSSNLKER---MAQRFYNLVLLPRVRDDIAEYKRLNFHLYSALKKALFKPGAWFKGILIPLCESGTCTLREAIIIGSILTKCSIPVLHSSAAMLKLAE-MEYNGANSIFLRLLLDKKYALPFRVLDALVAHFLSFRSEKRVLPVLWHQSLLTLAQRYKADLASEQKTALLELLKLQTHPPISAEI 414          
BLAST of SMED30018004 vs. Planmine SMEST
Match: SMESG000079213.1 (SMESG000079213.1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 380/380 (100.00%), Postives = 380/380 (100.00%), Query Frame = -2
Query:  132 MKRKTSENYDNTVDGKELKKIKRLVFQLNEDNEEESENVPTKDVVRDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXEINEEDKIALEKFLNPEIVTDMIEGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKSSDQAMDI 1271
            MKRKTSENYDNTVDGKELKKIKRLVFQLNEDNEEESENVPTKDVVRDTISKSIKSDSESDISDDEDVVEYEQDDCEEINEEDKIALEKFLNPEIVTDMIEGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKSSDQAMDI
Sbjct:    1 MKRKTSENYDNTVDGKELKKIKRLVFQLNEDNEEESENVPTKDVVRDTISKSIKSDSESDISDDEDVVEYEQDDCEEINEEDKIALEKFLNPEIVTDMIEGMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFPKIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKDFLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGREADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNLPYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLEHLCRVHRHDKVTPSVLAFLRMKSSDQAMDI 380          
BLAST of SMED30018004 vs. Planmine SMEST
Match: SMESG000039905.1 (SMESG000039905.1)

HSP 1 Score: 204.912 bits (520), Expect = 7.985e-56
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 1
Query: 1453 VCLREKXXXXXXXXISQPVTVRKVCIYXXXXXXXXXXXXXQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYXXXXXXXXXXXRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD 1860
            VCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDDNCQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEWSACSSRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD
Sbjct:  702 VCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDDNCQNQQTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEWSACSSRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD 837          
The following BLAST results are available for this feature:
BLAST of SMED30018004 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
BYSL6.971e-2929.04bystin like [Source:HGNC Symbol;Acc:HGNC:1157][more]
BYSL3.932e-1027.54bystin like [Source:HGNC Symbol;Acc:HGNC:1157][more]
back to top
BLAST of SMED30018004 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
byn-14.375e-2627.10Cell adhesion protein byn-1 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SMED30018004 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bys4.977e-2828.25gene:FBgn0010292 transcript:FBtr0071090[more]
back to top
BLAST of SMED30018004 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bysl2.219e-2928.76bystin-like [Source:ZFIN;Acc:ZDB-GENE-040426-1287][more]
back to top
BLAST of SMED30018004 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ugp25.348e-3030.07UDP-glucose pyrophosphorylase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of SMED30018004 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Bysl1.990e-3030.36bystin-like [Source:MGI Symbol;Acc:MGI:1858419][more]
back to top
BLAST of SMED30018004 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A9UNU6|BYST_MONBE4.514e-3329.21Bystin OS=Monosiga brevicollis OX=81824 GN=bysl PE... [more]
sp|A7S7F2|BYST_NEMVE2.098e-3233.74Bystin OS=Nematostella vectensis OX=45351 GN=bysl ... [more]
sp|O54825|BYST_MOUSE1.392e-2930.36Bystin OS=Mus musculus OX=10090 GN=Bysl PE=1 SV=3[more]
sp|Q80WL2|BYST_RAT3.650e-2929.70Bystin OS=Rattus norvegicus OX=10116 GN=Bysl PE=1 ... [more]
sp|Q5E9N0|BYST_BOVIN5.638e-2929.70Bystin OS=Bos taurus OX=9913 GN=BYSL PE=2 SV=1[more]
back to top
BLAST of SMED30018004 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EIE95.969e-4133.45Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GTL98.354e-4134.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GL839.687e-4134.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GG711.069e-4034.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EMR71.276e-4033.45Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30018004 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bysl5.312e-2927.54bystin like [Source:NCBI gene;Acc:103046097][more]
back to top
BLAST of SMED30018004 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bysl8.561e-3631.44bystin-like [Source:ZFIN;Acc:ZDB-GENE-040426-1287][more]
back to top
BLAST of SMED30018004 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ENP15.759e-1522.66Protein associated with U3 and U14 snoRNAs; requir... [more]
back to top
BLAST of SMED30018004 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
BYSL8.598e-3433.74Bystin [Source:UniProtKB/Swiss-Prot;Acc:A7S7F2][more]
back to top
BLAST of SMED30018004 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bysl4.190e-2828.76bystin like [Source:NCBI gene;Acc:101167780][more]
back to top
BLAST of SMED30018004 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000079213.10.000e+0100.00SMESG000079213.1[more]
SMESG000039905.17.985e-56100.00SMESG000039905.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30018004 ID=SMED30018004|Name=SMED30018004|organism=Schmidtea mediterranea sexual|type=transcript|length=2058bp
ACTAAACAAATCCATATTTATTTAAAACAATTGCAAAGACGAGAATGACC
AATCAAATCACAGCAAAATTCAAATTATTCGTTGGAAAATAATGAAACAA
ATAAAAGACCCAAATAATTTATTGACTATTAAATATCCATTGCTTGATCA
GAGGATTTCATCCTCAAGAACGCCAGCACTGACGGGGTGACCTTATCATG
TCGATGGACCCGACACAAATGCTCCAGATTCCGGATGCCCTCCTCATTCA
AGCTGCGATAATATAAGCTGAGGAATAGATTCAGTGTCTGGAACCAGACC
AGTGGCATTTTGCCCTCGATTTCGGAGGCCTTGTGAAAGTACTGAACGAA
ACAATTGATAGTAGCGTAAGGCAGATTGTATTTCTTGTCGAGGAATGCAC
GGAGGACGATCAATCTGTCTCTAGAGTACTCCATGTTGTTCATTAAGCAT
GTCATCGCTGGTGCGGCAACATCGAGTTTGATTGTGGAGCTCTTGATAAT
ATTTCCCAAAATATCGGCCTCCCTTCCGGTGATGTTGTCATCGCACCATG
GCAACAGTAAATGGGTCATGAACTCTCGGCGTCTGAATAGGGCACCTTGA
AGAGTCTTATACAAAGTATTATCCAATCTCTTGTGTTCTGCGATATGTTC
TCTTACGTAGGGCAATAGAAAGTCTTTGAAATATATTTCGACAGTTTTAC
CACCTTTTGCTCGAACTTGATCAGAAAATACCTGAACTGCAGTAGATGAC
CAATTTGGAAAATCGAGTTGTTCCATGAAAAAATTCCAATCATTAATTTG
AGGCAAAACTTTAACGATTTTCGGAAATAATCGTCCTTTTTTATAATGAA
CCATTAACTTTCTAATTACTTTCAAATGTTCAGCTAATCCTTCAACATCA
GCCAAATCTATTTCTTCAATGTCATCAAAACCCATTAACTCTGAAACTTC
TTTTCTGGCTTCAGCCATTCCCTCAATCATATCTGTTACAATTTCAGGAT
TTAAAAATTTTTCTAAAGCGATTTTATCTTCTTCGTTTATTTCTTCACAA
TCATCTTGTTCATATTCCACTACATCTTCATCATCCGAAATATCAGACTC
TGAATCAGATTTTATTGATTTACTAATAGTATCTCTCACAACATCTTTAG
TAGGTACATTTTCACTTTCTTCTTCATTATCTTCGTTTAATTGAAATACG
AGTCTTTTAATTTTTTTCAACTCTTTGCCATCAACGGTATTATCGTAATT
TTCAGATGTTTTTCGTTTCATTTTTATTTGAAAGTGAAAAAAATTAATAT
TATTTAAACAAAATGAAATATAGTGAAGTCAAATAAAATTAAAGGAAAAA
AGTGTTTTTCCAATAATTTTGTTATTGGCTATAAATAGAAAAATTGCATT
ATAAATTAAATTTAAGATTTTAGTATTTCACATGATTATTTCGAGCTTTA
GTGTTTGCTTGAGAGAAAAGTCTACTTCAACAACAACGACAACGATCAGT
CAGCCAGTAACGGTAAGAAAAGTCTGCATCTATTCCAACTGGTCGGACTG
GAGTTCTTGTGATGACAACTGTCAAAATCAACAAACAAGAATAAGATTTT
TAATTGAAAAAAATGACGACTGCACCGAAAGTATCAGTGAAACAAGAAAA
TGTCAATCAGAGAAATGCAATTCGCCAAATAACGGGTTTATTTCACTAAG
GAATTGCAAGTATTCGAGTTGGTCGGAATGGTCGGCTTGTTCATCAAGAT
GCGGTCCTGGCGTTAGAGAGAGAAAGCGGAAGAAACTTTCTCGTAATTGT
AAACCGGAATTTCCGCAATTTACTGACCGAGAATCATGTTACAATGCTTG
TGCTTATGACTGAATCCGGTAAAGAAAAAAAAACTGTCAATGTATTTGTG
TCATGACATTTTACCTATTGTGCATTTCATTTTGTGAACTTTGTTTGGTT
TTTGATTTATTTTTTCTTGGTGTTTTTCTCTAGAATATGATTTGTTATAA
TTAGAAAATTTTTGGAAAATTAATTTTGAATTTAAAATTTCTTTGGGGAT
AAAAAAAA
back to top

protein sequence of SMED30018004-orf-1

>SMED30018004-orf-1 ID=SMED30018004-orf-1|Name=SMED30018004-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=381bp
MKRKTSENYDNTVDGKELKKIKRLVFQLNEDNEEESENVPTKDVVRDTIS
KSIKSDSESDISDDEDVVEYEQDDCEEINEEDKIALEKFLNPEIVTDMIE
GMAEARKEVSELMGFDDIEEIDLADVEGLAEHLKVIRKLMVHYKKGRLFP
KIVKVLPQINDWNFFMEQLDFPNWSSTAVQVFSDQVRAKGGKTVEIYFKD
FLLPYVREHIAEHKRLDNTLYKTLQGALFRRREFMTHLLLPWCDDNITGR
EADILGNIIKSSTIKLDVAAPAMTCLMNNMEYSRDRLIVLRAFLDKKYNL
PYATINCFVQYFHKASEIEGKMPLVWFQTLNLFLSLYYRSLNEEGIRNLE
HLCRVHRHDKVTPSVLAFLRMKSSDQAMDI*
back to top

protein sequence of SMED30018004-orf-2

>SMED30018004-orf-2 ID=SMED30018004-orf-2|Name=SMED30018004-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MIISSFSVCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDDNCQNQ
QTRIRFLIEKNDDCTESISETRKCQSEKCNSPNNGFISLRNCKYSSWSEW
SACSSRCGPGVRERKRKKLSRNCKPEFPQFTDRESCYNACAYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000884TSP1_rpt
IPR007955Bystin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 18..38
IPR007955BystinPFAMPF05291Bystincoord: 128..374
e-value: 4.4E-50
score: 170.6
IPR007955BystinPANTHERPTHR12821BYSTINcoord: 4..373