WSC domain-containing protein

Overview
NameWSC domain-containing protein
Smed IDSMED30017997
Length (bp)1585
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WSC domain-containing protein (SMED30017997) t-SNE clustered cells

Violin plots show distribution of expression levels for WSC domain-containing protein (SMED30017997) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WSC domain-containing protein (SMED30017997) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WSC domain-containing protein (SMED30017997) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017997

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017997SMESG000057220.1 SmedASXL_010493SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30017997SMESG000057220.1 dd_Smed_v4_10762_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017997SMESG000057220.1 dd_Smed_v6_10762_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30017997SMESG000057220.1 dd_Smed_v4_10762_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017997SMESG000057220.1 dd_Smed_v4_10762_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30017997SMESG000057220.1 dd_Smed_v4_10762_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WSC domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|15803463 (tr|A0A1I8J796|A0A1I8J796_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023664g1 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 4.336e-79
Identity = 156/472 (33.05%), Postives = 282/472 (59.75%), Query Frame = 2
Query:   95 EATRLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIK---LMYSSSGVQLQIGSVSGANNQVTEFLIDIDKF-SKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRK 1498
            E  R +G+FKDYL  LD++R  + + E  L +    FY  +  + +E +   + + ++K  + CN  +     + II+DGQ PIA ++N L++  +  + +    +  FWE+ K  LE  Q + D ++  + ++++   L+ SS       G+++ A + +++         SK +     + RLL  S G H+R  LL K+S ++R+L   N   YP+L V+PD+  KL  + +I  +WLD++ET+++E++  +R  R   RE E ++ + RE  + +LKS+K++YL+CQN+KK+L+EI+ E+K LEE I  +   ++   DEK +   M++FL+LSI+QT+ NY LQ+K+QR++ Q+++LE  L ++E +I S+K +I +K +EK        +++ ++ + KTDLE Y++++     EL  +++ L+ +ES + LKTSPE ++      +P++  V+LAPSL  +I+ K
Sbjct:   51 EVARSSGMFKDYLAGLDNLRSIVNDCENRLAQALNEFYGTT--EKDEQMFNAFNIEVNKAFEACNSCLDKAGHQAIIVDGQAPIATLVNKLKEYRLAANPEDTQLLLQFWESFKLALEQLQTIADDYERRVLSKLRTGCLIASS-------GAMATAKSPLSKAYEAEAAAYSKELETVRTRVRLLCHSAGTHMRMELLGKASHTERVLINCNDDFYPILCVVPDLTVKLESMARIAYQWLDKDETYLFEVSRQLRDKRSETREMEQQLRAEREKHRLLLKSVKSAYLMCQNSKKRLREITQELKNLEEHIEHSARERRAKMDEKKQKKEMADFLDLSITQTKMNYALQLKRQRLMAQIQELEEFLRKVEQEISSLKTQIQTKTNEKKSAEDLYQAQDSNFANMKTDLEGYTKKVQEMSNELRGVRQHLSHLESIQSLKTSPETVDTFY--ERPRS--VKLAPSLMESINMK 509          
BLAST of WSC domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18250241 (tr|A0A267G123|A0A267G123_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023664g2 PE=4 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 7.939e-79
Identity = 155/472 (32.84%), Postives = 282/472 (59.75%), Query Frame = 2
Query:   95 EATRLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIK---LMYSSSGVQLQIGSVSGANNQVTEFLIDIDKF-SKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRK 1498
            E  R +G+FKDYL  LD++R  + + E  L +    FY  +  + +E +   + + ++K  + CN  +     + II+DGQ PIA ++N L++  +  + +    +  FWE+ K  LE  Q + D ++  + ++++   L+ SS       G+++ A + +++         SK +     + RLL  S G H+R  LL K+S ++R+L   N   YP+L V+PD+  KL  + +I  +WLD++ET+++E++  +R  R   RE E ++ + RE  + +LKS+K++YL+CQN+KK+L+EI+ E+K LEE I  +   ++   DEK +   M++FL+LSI+QT+ NY LQ+K+QR++ Q+++LE  L ++E +I S+K +I +K +E+        +++ ++ + KTDLE Y++++     EL  +++ L+ +ES + LKTSPE ++      +P++  V+LAPSL  +I+ K
Sbjct:   51 EVARSSGMFKDYLAGLDNLRSIVNDCENRLAQALNEFYGTT--EKDEQMFNAFNIEVNKAFEACNSCLDKAGHQAIIVDGQAPIATLVNKLKEYRLAANPEDTQLLLQFWESFKLALEQLQTIADDYERRVLSKLRTGCLIASS-------GAMATAKSPLSKAYEAEAAAYSKELETVRTRVRLLCHSAGTHMRMELLGKASHTERVLINCNDDFYPILCVVPDLTVKLESMARIAYQWLDKDETYLFEVSRQLRDKRSETREMEQQLRAEREKHRLLLKSVKSAYLMCQNSKKRLREITQELKNLEEHIEHSARERRAKMDEKKQKKEMADFLDLSITQTKMNYALQLKRQRLMAQIQELEEFLRKVEQEISSLKTQIQTKTNERKSAEDLYQAQDSNFANMKTDLEGYTKKVQEMSNELRGVRQHLSHLESIQSLKTSPETVDTFY--ERPRS--VKLAPSLMESINMK 509          
BLAST of WSC domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|18185115 (tr|A0A1I8IMX5|A0A1I8IMX5_9PLAT WSC domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 4.155e-72
Identity = 155/472 (32.84%), Postives = 284/472 (60.17%), Query Frame = 2
Query:   95 EATRLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIK---LMYSSSGVQLQIGSVSGANNQVTEFLIDIDKF-SKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRK 1498
            E  R +G+FKDYL  LD++R  + + E  L +    FY  +  + +E +   + + ++K  + CN  +     + II+DGQ PIA ++N L++  +  + +    +  FWE+ K  LE  Q + D ++  + ++++   L+ SS       G+++ A + +++         SK +     + RLL  S G H+R  LL K+S ++R+L   N   YP+L V+PD+  KL  + +I  +WLD++ET+++E++  +R  R   RE E ++ + RE  + +LKS+K++YL+CQN+KK+L+EI+ E+K LEE I  +   ++   DEK +   M++FL+LSI+QT+ NY LQ+K+QR++ Q+++LE  L ++E +I S+K +I +K +E+    + + +++ ++ + KTDLE Y++++     EL  +++ L+ +ES + LKTSPE ++      +P++  V+LAPSL  +I+ K
Sbjct:  507 EVARSSGMFKDYLAGLDNLRSIVNDCENRLAQALNEFYGTT--EKDEQMFNAFNIEVNKAFEACNSCLDKAGHQAIIVDGQAPIATLVNKLKEYRLAANPEDTQLLLQFWESFKLALEQLQTIADDYERRVLSKLRTGCLIASS-------GAMATAKSPLSKAYEAEAAAYSKELETVRTRVRLLCHSAGTHMRMELLGKASHTERVLINCNDDFYPILCVVPDLTVKLESMARIAYQWLDKDETYLFEVSRQLRDKRSETREMEQQLRAEREKHRLLLKSVKSAYLMCQNSKKRLREITQELKNLEEHIEHSARERRAKMDEKKQKKEMADFLDLSITQTKMNYALQLKRQRLMAQIQELEEFLRKVEQEISSLKTQIQTKTNER----KPVPAQDSNFANMKTDLEGYTKKVQEMSNELRGVRQHLSHLESIQSLKTSPETVDTFY--ERPRS--VKLAPSLMESINMK 961          
BLAST of WSC domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23916787 (tr|K1QNA7|K1QNA7_CRAGI Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10021785 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 8.015e-66
Identity = 154/471 (32.70%), Postives = 275/471 (58.39%), Query Frame = 2
Query:   98 ATRLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIK---LMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSS-ISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRK 1498
             T   G+ + YL  L+ +R+ + + E E+ K +L FY  S ++ +E+   +YL   +      N ++   N K  +ID ++ I  ++N+LR+ A   D   +  IT FWENIK+ +E +  L+D+F  ++ NR+      Y+++ + L++       N+ TE   +I  +   +  +L   RLL+K+  + +   L  ++S  ++++L   ++  +P+L++ PD+  K+  +  I RKWLDR+E +MYE+N  I++ R +A+++E  + + +E QK I K++K + +L  N K+KL++I  E+  LE Q+      +K    EK +  SM++FL+++++QTR+NY LQMK+QR++ Q+++LE  L+ LE ++ +++ E+  K+ E+    +K+ +  K+Y   KTD E YS  L   ++E+N L   L  +E  +  KTSPE +E I    +PQT  V+LAPSLK  I RK
Sbjct:   58 TTMRAGLQRAYLDGLEFIRNKISDTETEVTKTRLSFY--SCNETDEDSFLQYLKECNDHFLMANNELRRKNIKLEVIDSEMRIVTLLNHLRE-AAEFDKGEIAFITGFWENIKHTVESFHSLVDKFQTNVLNRLNQNCTSYNNADISLEVS------NRYTE---EISGYIAELERELTNMRLLMKTYDSGIHQDLFSQNSKFAEKVLVSCDLKAFPILRLAPDLAEKMENVCAIARKWLDRDEQYMYEVNNYIKETRNIAKKREEDLKNQKEKQKKIEKAVKTASILLHNNKEKLQKIESELNSLEGQLNGFKQEKKCKHTEKAQKSSMADFLSITMTQTRKNYNLQMKRQRLVKQVRELEEFLIGLERELSNVEDELMVKSQERILINEKVETSVKTYDTLKTDFEKYSDNLEKLEQEVNILSGQLLQLEIIQTYKTSPENVEQIF--DRPQT--VKLAPSLKEKIKRK 512          
BLAST of WSC domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23528351 (tr|A0A210R0S9|A0A210R0S9_MIZYE Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12505 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.614e-59
Identity = 143/466 (30.69%), Postives = 268/466 (57.51%), Query Frame = 2
Query:  113 GIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKI-SGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIK---LMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRK 1498
            GI + YL  L+ +R  + E E+E+ +++  FY    G++  E    EYL   ++     N ++   N K  +ID ++ +  +IN LR++A ++D   +  IT FWEN+K  +E  ++++++F  ++  R+      Y+++ + L++            ++ +I  +   +  ++   RLLLKS  + +   L   S  SD+L+   ++  +P+L+++PD+  K+ ++  I RKWLDR++ +M E+N  I++ R + + +E  + + +E QK I K++K +++L  N ++KL++I +E+  LE Q+      +K    EK +  SM++FL ++++QT++NY LQMK+QR++ Q+  LE  LV +E ++  ++ ++  K  EK    +K+ + +K+Y+  KTD + YS  L   ++E+N L   L  +E  +  K+SPE +E I    +PQT  V+LAPSLK  I RK
Sbjct:   96 GIQRAYLDGLEFIRTKISEMEQEVGQVRTSFYDCKDGEEESEEKREEYLKRCNENFLIANNELRRKNVKLNVIDSEMKVVGVINKLREVA-DVDQGEIAFITQFWENVKQTVEGLRMIVEKFQTNVLQRLNQSCTSYNNADINLEVSD---------RYMEEIISYIAGLEREITNIRLLLKSFDSGIHQDLYTDSKFSDKLMVSCDLKAFPILRLVPDLTAKVERLCDISRKWLDRDQQYMDEVNNYIKKTRNMTKRREEVLKNQKEKQKKIEKAVKTAHILLHNNREKLQKIEMELDNLEVQLSGFKTEKKTKHSEKSQKSSMADFLKITLTQTKKNYNLQMKRQRLVKQVHDLEEFLVSIERELSDVEDQMMVKKQEKFLLREKVDTHQKTYEAFKTDFDRYSDGLEKLEQEVNVLSGQLLQLEIIQTYKSSPENVEQIF--DRPQT--VKLAPSLKEKIRRK 547          
BLAST of WSC domain-containing protein vs. Planmine SMEST
Match: SMESG000057220.1 (SMESG000057220.1)

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 2
Query:   71 MSSTGSKQEATRLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIKLMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRKIGLISNKNSI 1528
            MSSTGSKQEATRLTGIFKDYLLALDSVRDHLLEKEEELHKIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIKLMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRKIGLISNKNSI
Sbjct:    1 MSSTGSKQEATRLTGIFKDYLLALDSVRDHLLEKEEELHKIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLRDLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIKLMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRKIGLISNKNSI 486          
BLAST of WSC domain-containing protein vs. Planmine SMEST
Match: SMESG000074503.1 (SMESG000074503.1)

HSP 1 Score: 217.238 bits (552), Expect = 2.597e-64
Identity = 158/475 (33.26%), Postives = 269/475 (56.63%), Query Frame = 2
Query:  104 RLTGIFKDYLLALDSVRDXXXXXXXXXXXIQLGFYKISGDKMEENLAREYLMSISKCLDQCNGQIANNNRKPII-IDGQVPIANMINNL-RDLAMNLDADTLGTI---TDFWENIKYYLELYQILIDRFDYDIHNRIKLMYSSSGVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRAHLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREETFMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKKLKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNYGLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLSEEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIENILGSSKPQTQIVQLAPSLKNAIDRKIGLIS 1513
            R +G FKDYL  LD +R  +  +E+EL +    FYK   + ++E     YL    K ++   G I  N++  ++ ID +  +  +IN   + +      D L  I   TDF EN+KY  E+ QI++D F+ +   +++ +       L+  S S      +++ + I+ +S  I   + + RLL+ S    +  +LL KS++ DRL    +  ++PLL ++PD+  KL + F++ + WLDREE F+Y++ E IRQ R+L +EK ++I + +++   +LK +K S L+ QN K+K+ E+   +  L EQI  +    +   ++K  + SM EFL +SISQT+RNY LQ K+Q++  ++ +LE++L  ++  I  M  + ++ +        K  ++EK +   K DLE YSQ + + K+EL  LKK L T +S +IL+TSPE+++NI    +  ++ V+LAPSL   ID K  ++S
Sbjct:   18 RYSGSFKDYLKGLDLIRQSITNQEQELKRALTEFYK--ANDVDEKSYNLYL----KSMNNFFGSIKENSQLTLMTIDSENSLLKVINEFAKSINRTEKMDCLLIIENLTDFHENLKYSQEILQIIMDNFEKESLVKLRKLSIDDFYNLEYSSKS------SDYKVKIESYSSEIDRIINQFRLLIISSKTKMDLNLLTKSTLVDRLTENCDTERFPLLLMLPDLNAKLEETFRLGKLWLDREEVFLYQIREEIRQLRVLTKEKSSKIENEKQNHSRLLKEMKTSNLMVQNNKQKMSEVRRNLNKLNEQILFSKSEYEKKVNQKQHSKSMVEFLEISISQTKRNYSLQFKRQKLQREITELENSLKIIQENIVQMTSKTNTISQTAEFIEMKSKNDEKDFIKIKLDLEMYSQNVFSLKKELEDLKKILNTFQSIEILRTSPEYVDNIFD--QHSSEYVKLAPSLLKKIDMKKQMLS 478          
The following BLAST results are available for this feature:
BLAST of WSC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|158034634.336e-7933.05tr|A0A1I8J796|A0A1I8J796_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182502417.939e-7932.84tr|A0A267G123|A0A267G123_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|181851154.155e-7232.84tr|A0A1I8IMX5|A0A1I8IMX5_9PLAT WSC domain-containi... [more]
gnl|BL_ORD_ID|239167878.015e-6632.70tr|K1QNA7|K1QNA7_CRAGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|235283518.614e-5930.69tr|A0A210R0S9|A0A210R0S9_MIZYE Uncharacterized pro... [more]
back to top
BLAST of WSC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WSC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000057220.10.000e+0100.00SMESG000057220.1[more]
SMESG000074503.12.597e-6433.26SMESG000074503.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017997 ID=SMED30017997|Name=WSC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1585bp
GTCTATTACTATGATAATATTTTATTGATTGTCTAAAATATCTTTCAGGA
AGATTCATAAAAATGTTGTAATGTCTTCCACCGGTTCCAAACAAGAAGCT
ACGAGATTAACTGGAATATTTAAAGATTACTTACTAGCTTTGGACTCAGT
TAGAGATCATTTGTTGGAGAAAGAAGAGGAATTACACAAAATACAACTTG
GATTTTATAAGATCAGTGGAGATAAGATGGAAGAGAATTTAGCGCGAGAA
TATCTGATGTCTATCAGCAAATGTTTGGACCAATGCAACGGGCAGATAGC
AAACAATAACAGAAAACCAATAATAATCGATGGACAAGTGCCCATCGCAA
ACATGATAAATAATTTAAGGGATTTGGCAATGAATTTAGATGCCGACACT
TTGGGGACAATCACAGATTTCTGGGAGAACATTAAATATTATTTGGAACT
TTATCAGATTCTTATTGACCGATTCGACTATGACATCCACAACAGAATAA
AGTTAATGTATTCCTCCAGTGGAGTGCAGCTTCAAATTGGATCGGTTTCA
GGAGCCAACAACCAGGTAACGGAATTTCTTATAGACATTGACAAATTCTC
TAAATTGATTCCGGAAAAACTTTTCAAGTGTCGGTTATTGCTCAAGAGTT
GTGGAAATCACTTGAGAGCACATCTATTAGACAAATCTTCGATTTCTGAT
AGACTTTTGAATGGAATAAACATTTCTCAATATCCTCTATTAAAAGTCAT
TCCGGATATTTGTCACAAATTGAATCAAATATTCCAAATTTGCCGGAAAT
GGTTGGATCGAGAAGAAACATTTATGTATGAGATGAATGAATTAATTAGA
CAAAATCGAATGCTTGCCAGAGAGAAAGAAACCAGAATTATGTCTGCAAG
AGAACATCAAAAAGATATTCTTAAATCGATTAAAGCATCTTATCTGCTTT
GTCAAAATACAAAAAAAAAGCTAAAAGAAATTTCAGTTGAGATGAAATTG
CTGGAAGAACAGATTAGAGAAACGACATTTGTTCAAAAGAATTTGTCAGA
TGAAAAAGTGAAAACAATGAGCATGTCAGAATTTCTCAATCTCAGCATCT
CTCAGACTAGGAGGAATTATGGACTCCAGATGAAAAAACAGAGAATGTTA
AATCAAATGAAAAAATTAGAATCGACATTAGTAGAATTAGAATCACAAAT
CCATTCAATGAAACAAGAAATTTCTTCGAAAGCTGACGAAAAGAATAAAA
CGTATCAAAAACTTTTGTCAGAAGAGAAATCTTACCAAGACGCTAAAACA
GATCTTGAATCATATTCCCAAAGATTACATACTTACAAGGAAGAACTCAA
CACTTTAAAAAAGAGCTTAGCAACTATGGAGAGCTTCAAAATACTCAAGA
CCAGTCCGGAATTTATTGAAAACATTCTTGGCTCATCAAAACCTCAGACT
CAAATCGTTCAGTTAGCTCCATCGCTAAAGAATGCAATTGACAGAAAAAT
AGGATTAATATCTAATAAGAATTCAATATGATATTTTGAATCTTTCAGTA
GTGATCTCGTGTTGTTTGTGTCAGTTCAATTAAAT
back to top

protein sequence of SMED30017997-orf-1

>SMED30017997-orf-1 ID=SMED30017997-orf-1|Name=SMED30017997-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MSSTGSKQEATRLTGIFKDYLLALDSVRDHLLEKEEELHKIQLGFYKISG
DKMEENLAREYLMSISKCLDQCNGQIANNNRKPIIIDGQVPIANMINNLR
DLAMNLDADTLGTITDFWENIKYYLELYQILIDRFDYDIHNRIKLMYSSS
GVQLQIGSVSGANNQVTEFLIDIDKFSKLIPEKLFKCRLLLKSCGNHLRA
HLLDKSSISDRLLNGINISQYPLLKVIPDICHKLNQIFQICRKWLDREET
FMYEMNELIRQNRMLAREKETRIMSAREHQKDILKSIKASYLLCQNTKKK
LKEISVEMKLLEEQIRETTFVQKNLSDEKVKTMSMSEFLNLSISQTRRNY
GLQMKKQRMLNQMKKLESTLVELESQIHSMKQEISSKADEKNKTYQKLLS
EEKSYQDAKTDLESYSQRLHTYKEELNTLKKSLATMESFKILKTSPEFIE
NILGSSKPQTQIVQLAPSLKNAIDRKIGLISNKNSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 294..314
NoneNo IPR availableCOILSCoilCoilcoord: 405..432
NoneNo IPR availableCOILSCoilCoilcoord: 356..401