Palmitoyltransferase

Overview
NamePalmitoyltransferase
Smed IDSMED30017994
Length (bp)822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Palmitoyltransferase (SMED30017994) t-SNE clustered cells

Violin plots show distribution of expression levels for Palmitoyltransferase (SMED30017994) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30017994SMESG000041464.1 dd_Smed_v4_28351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017994SMESG000041464.1 dd_Smed_v6_28351_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: RIPK4 (receptor interacting serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:496])

HSP 1 Score: 65.4698 bits (158), Expect = 2.106e-11
Identity = 40/144 (27.78%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN---EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAV 716
             ++ C+     +V  LL+ GVD++ +G     PL +  W G+     LL K   ++      D   G TPL LA  +G+Y + ++L++  +    CS L    + PL V  +  +T   +LL++ G     +  DG+T L +A 
Sbjct:  541 MHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD---GRTPLHLAAQRGHYRVARILIDLCSDVNVCSLL---AQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAA 678          

HSP 2 Score: 50.447 bits (119), Expect = 2.167e-6
Identity = 42/143 (29.37%), Postives = 63/143 (44.06%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINH-GFSVNTVNKDGWTPLSMAVE 719
             ++  E+    VV  LL   + +N++       L +   NG+E   + L+  N  +N  D E G TP+ +A   G   I ++LL  G      S   K    PL     Q +  I++LL    G SVN    DG TPL +A +
Sbjct:  475 LHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFE-GRTPMHVACQHGQENIVRILLRRG---VDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQ 613          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 61.6178 bits (148), Expect = 2.930e-10
Identity = 48/167 (28.74%), Postives = 69/167 (41.32%), Query Frame = 3
Query:  321 FEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL-------------------VCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+                             L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  153 VEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 58.151 bits (139), Expect = 4.128e-9
Identity = 49/177 (27.68%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  198 YAPELDFIVKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            Y   LD +   +N   E   ++K   +      +         VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N  +   G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  Y
Sbjct:  182 YMGHLDVVALLINHGAEVTCKDKKGYTP----LHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNN-NGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARY 349          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 61.6178 bits (148), Expect = 3.961e-10
Identity = 48/166 (28.92%), Postives = 69/166 (41.57%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL-------------------VCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+                             L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 58.151 bits (139), Expect = 5.715e-9
Identity = 49/177 (27.68%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  198 YAPELDFIVKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            Y   LD +   +N   E   ++K   +      +         VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N  +   G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  Y
Sbjct:  182 YMGHLDVVALLINHGAEVTCKDKKGYTP----LHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNN-NGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARY 349          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD44 (ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:HGNC:25259])

HSP 1 Score: 61.2326 bits (147), Expect = 6.650e-10
Identity = 50/166 (30.12%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 56.225 bits (134), Expect = 2.867e-8
Identity = 43/134 (32.09%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N      G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  Y
Sbjct:  221 VVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ-PNNNGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARY 349          
BLAST of Palmitoyltransferase vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 60.8474 bits (146), Expect = 7.237e-10
Identity = 46/166 (27.71%), Postives = 74/166 (44.58%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+V  LL  G +IN+     RR + W  + G+  ++K L++   E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q+N +                 L+LL+ +G  VN  +KDG TPL M   + +
Sbjct:   98 EMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKS-YTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGR 262          

HSP 2 Score: 58.5362 bits (140), Expect = 4.126e-9
Identity = 48/163 (29.45%), Postives = 79/163 (48.47%), Query Frame = 3
Query:  282 VSHLFNIVC-EKNSF------------EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            VSH   + C +K S+             VV YLL +GVD+N    +   PL    +NG + ++ +LI+    +N  + E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  +  R +R  Q +I  G  ++  +K+G TPL +A  Y 
Sbjct:  137 VSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKN-EKGFTPLHFAAASTHGALCLELLVGNGA---DVNMKSKDGKTPLHMTALHGRFSRS-QTIIQSGAVIDCEDKNGNTPLHIAARYG 294          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.225 bits (134), Expect = 1.085e-8
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            ++V  LL+ G + N+    +  PL      G E +   L++ N +     ++ G+TPL LA   GN  + +LLLE G          K    PL V     N ++  LL+ +G S     K+G+TPL +A + N+
Sbjct:  505 DIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGT---PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ 635          

HSP 2 Score: 48.1358 bits (113), Expect = 4.052e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  318 SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +  +V YLL+ G + + E V    PL          +++ LI    +++   RE   TPL +A   GN  I  LLL+AGA     +   +   +PL +  K+    +  +L++H      + K G+TPL +A +Y
Sbjct:  437 AINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGA---NSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY 567          

HSP 3 Score: 47.3654 bits (111), Expect = 7.517e-6
Identity = 40/146 (27.40%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I C+KN  +VV  LLK    I +       PL    + G      YLL++  N + E        G TPL LA       + ++L+  GA         + ++ PL +  +  NT I+ LL+  G + N   +D ++PL +A +
Sbjct:  396 LHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE-----TVRGETPLHLAARANQTDVVRVLIRNGA---KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAK 533          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.225 bits (134), Expect = 1.085e-8
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            ++V  LL+ G + N+    +  PL      G E +   L++ N +     ++ G+TPL LA   GN  + +LLLE G          K    PL V     N ++  LL+ +G S     K+G+TPL +A + N+
Sbjct:  505 DIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGT---PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ 635          

HSP 2 Score: 48.1358 bits (113), Expect = 4.052e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  318 SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +  +V YLL+ G + + E V    PL          +++ LI    +++   RE   TPL +A   GN  I  LLL+AGA     +   +   +PL +  K+    +  +L++H      + K G+TPL +A +Y
Sbjct:  437 AINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGA---NSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY 567          

HSP 3 Score: 47.3654 bits (111), Expect = 7.517e-6
Identity = 40/146 (27.40%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I C+KN  +VV  LLK    I +       PL    + G      YLL++  N + E        G TPL LA       + ++L+  GA         + ++ PL +  +  NT I+ LL+  G + N   +D ++PL +A +
Sbjct:  396 LHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE-----TVRGETPLHLAARANQTDVVRVLIRNGA---KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAK 533          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.225 bits (134), Expect = 1.087e-8
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            ++V  LL+ G + N+    +  PL      G E +   L++ N +     ++ G+TPL LA   GN  + +LLLE G          K    PL V     N ++  LL+ +G S     K+G+TPL +A + N+
Sbjct:  505 DIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGT---PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ 635          

HSP 2 Score: 48.1358 bits (113), Expect = 4.057e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  318 SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +  +V YLL+ G + + E V    PL          +++ LI    +++   RE   TPL +A   GN  I  LLL+AGA     +   +   +PL +  K+    +  +L++H      + K G+TPL +A +Y
Sbjct:  437 AINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGA---NSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY 567          

HSP 3 Score: 47.3654 bits (111), Expect = 7.527e-6
Identity = 40/146 (27.40%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I C+KN  +VV  LLK    I +       PL    + G      YLL++  N + E        G TPL LA       + ++L+  GA         + ++ PL +  +  NT I+ LL+  G + N   +D ++PL +A +
Sbjct:  396 LHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE-----TVRGETPLHLAARANQTDVVRVLIRNGA---KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAK 533          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.225 bits (134), Expect = 1.087e-8
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            ++V  LL+ G + N+    +  PL      G E +   L++ N +     ++ G+TPL LA   GN  + +LLLE G          K    PL V     N ++  LL+ +G S     K+G+TPL +A + N+
Sbjct:  505 DIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGT---PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ 635          

HSP 2 Score: 48.1358 bits (113), Expect = 4.057e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  318 SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +  +V YLL+ G + + E V    PL          +++ LI    +++   RE   TPL +A   GN  I  LLL+AGA     +   +   +PL +  K+    +  +L++H      + K G+TPL +A +Y
Sbjct:  437 AINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGA---NSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY 567          

HSP 3 Score: 47.3654 bits (111), Expect = 7.527e-6
Identity = 40/146 (27.40%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I C+KN  +VV  LLK    I +       PL    + G      YLL++  N + E        G TPL LA       + ++L+  GA         + ++ PL +  +  NT I+ LL+  G + N   +D ++PL +A +
Sbjct:  396 LHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE-----TVRGETPLHLAARANQTDVVRVLIRNGA---KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAK 533          
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.225 bits (134), Expect = 1.088e-8
Identity = 40/135 (29.63%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            ++V  LL+ G + N+    +  PL      G E +   L++ N +     ++ G+TPL LA   GN  + +LLLE G          K    PL V     N ++  LL+ +G S     K+G+TPL +A + N+
Sbjct:  505 DIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKK-GFTPLHLASKYGNLEVVRLLLERGT---PVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQ 635          

HSP 2 Score: 48.1358 bits (113), Expect = 4.062e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 3
Query:  318 SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +  +V YLL+ G + + E V    PL          +++ LI    +++   RE   TPL +A   GN  I  LLL+AGA     +   +   +PL +  K+    +  +L++H      + K G+TPL +A +Y
Sbjct:  437 AINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGA---NSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKY 567          

HSP 3 Score: 47.3654 bits (111), Expect = 7.536e-6
Identity = 40/146 (27.40%), Postives = 65/146 (44.52%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I C+KN  +VV  LLK    I +       PL    + G      YLL++  N + E        G TPL LA       + ++L+  GA         + ++ PL +  +  NT I+ LL+  G + N   +D ++PL +A +
Sbjct:  396 LHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE-----TVRGETPLHLAARANQTDVVRVLIRNGA---KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAK 533          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 57.3806 bits (137), Expect = 6.025e-9
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKK-------------LINLNCELNFFD---------------RETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
             ++ C+     VV  LL+ G  I+ +G +   PL       N    E LLK               I++ C+ N+ +                ++G++PL LA   GN  + +LLLE G I    S   K    PL V  ++ +  + Q+L+ HG +++   ++G+TPL MA  Y
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVI----SAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHY 737          

HSP 2 Score: 47.7506 bits (112), Expect = 8.670e-6
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 3
Query:  222 VKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNG--------------------------------NEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            V KL L+++ N  N   L+  + L +I C+KN  ++V  L+K G +I +       PL    + G                                N+  + +++  + +++   RE G TPL +A   GN  I  LLL+ GA I+   +  +    + L +  K+    I+Q+L+ +G   N V K G+TPL +A +Y K
Sbjct:  381 VAKLLLDYKAN-PNARALNGFTPL-HIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKY----SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGK 575          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 57.3806 bits (137), Expect = 6.025e-9
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKK-------------LINLNCELNFFD---------------RETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
             ++ C+     VV  LL+ G  I+ +G +   PL       N    E LLK               I++ C+ N+ +                ++G++PL LA   GN  + +LLLE G I    S   K    PL V  ++ +  + Q+L+ HG +++   ++G+TPL MA  Y
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVI----SAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHY 737          

HSP 2 Score: 47.7506 bits (112), Expect = 8.670e-6
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 3
Query:  222 VKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNG--------------------------------NEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            V KL L+++ N  N   L+  + L +I C+KN  ++V  L+K G +I +       PL    + G                                N+  + +++  + +++   RE G TPL +A   GN  I  LLL+ GA I+   +  +    + L +  K+    I+Q+L+ +G   N V K G+TPL +A +Y K
Sbjct:  381 VAKLLLDYKAN-PNARALNGFTPL-HIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKY----SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGK 575          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 57.3806 bits (137), Expect = 6.025e-9
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKK-------------LINLNCELNFFD---------------RETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
             ++ C+     VV  LL+ G  I+ +G +   PL       N    E LLK               I++ C+ N+ +                ++G++PL LA   GN  + +LLLE G I    S   K    PL V  ++ +  + Q+L+ HG +++   ++G+TPL MA  Y
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVI----SAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHY 737          

HSP 2 Score: 47.7506 bits (112), Expect = 8.670e-6
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 3
Query:  222 VKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNG--------------------------------NEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            V KL L+++ N  N   L+  + L +I C+KN  ++V  L+K G +I +       PL    + G                                N+  + +++  + +++   RE G TPL +A   GN  I  LLL+ GA I+   +  +    + L +  K+    I+Q+L+ +G   N V K G+TPL +A +Y K
Sbjct:  381 VAKLLLDYKAN-PNARALNGFTPL-HIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKY----SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGK 575          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089173)

HSP 1 Score: 57.3806 bits (137), Expect = 6.025e-9
Identity = 47/175 (26.86%), Postives = 77/175 (44.00%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN----EYLLKK-------------LINLNCELNFFD---------------RETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
             ++ C+     VV  LL+ G  I+ +G +   PL       N    E LLK               I++ C+ N+ +                ++G++PL LA   GN  + +LLLE G I    S   K    PL V  ++ +  + Q+L+ HG +++   ++G+TPL MA  Y
Sbjct:  567 LHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVI----SAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHY 737          

HSP 2 Score: 47.7506 bits (112), Expect = 8.670e-6
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 3
Query:  222 VKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNG--------------------------------NEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            V KL L+++ N  N   L+  + L +I C+KN  ++V  L+K G +I +       PL    + G                                N+  + +++  + +++   RE G TPL +A   GN  I  LLL+ GA I+   +  +    + L +  K+    I+Q+L+ +G   N V K G+TPL +A +Y K
Sbjct:  381 VAKLLLDYKAN-PNARALNGFTPL-HIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIARE-GQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKY----SALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGK 575          
BLAST of Palmitoyltransferase vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 54.6842 bits (130), Expect = 3.063e-8
Identity = 39/145 (26.90%), Postives = 64/145 (44.14%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             +I C+KN  +VV  LL+ G  I++       PL    + G   ++  L+  +   +      G TPL LA       I ++LL  GA         +  + PL +  +  N  I+ LL+ HG  V+   KD +T L +A +  +
Sbjct:  374 LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVR-GETPLHLAARANQTDIIRILLRNGA---QVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 514          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 63.929 bits (154), Expect = 1.052e-11
Identity = 42/142 (29.58%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             C      +  +LL +GV+++ +      PL      G E +++ LI+   +LN  + + G TPL  A SK  Y I ++LLE GA     +   K    PL     + N R++QLL+    S N  + +G TPL +A +  +
Sbjct:   47 ACSAGHVNIAQFLLDLGVEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVN-QNGCTPLHYAASKNLYEIAQILLENGA---DPNATDKLQSTPLHRASAKGNYRLIQLLLKESASTNIQDSEGNTPLHLACDEER 184          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:ZFIN;Acc:ZDB-GENE-050112-1])

HSP 1 Score: 63.929 bits (154), Expect = 1.052e-11
Identity = 42/142 (29.58%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             C      +  +LL +GV+++ +      PL      G E +++ LI+   +LN  + + G TPL  A SK  Y I ++LLE GA     +   K    PL     + N R++QLL+    S N  + +G TPL +A +  +
Sbjct:   47 ACSAGHVNIAQFLLDLGVEVDLKDDACWTPLHIAASAGREEIVRSLISKGAQLNSVN-QNGCTPLHYAASKNLYEIAQILLENGA---DPNATDKLQSTPLHRASAKGNYRLIQLLLKESASTNIQDSEGNTPLHLACDEER 184          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 61.6178 bits (148), Expect = 2.994e-10
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSY----LFKFI--------------ENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
             +I  ++N  EV + LL+ G + NSE +    PL      G   ++  LI+    +N  ++  G TPL L   +G+ GI  +L++ GA            +H  C Y    + KF+                PL    +Q +T I+ LL+ HG   N +  +G +PL +A
Sbjct:  547 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK-NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 715          

HSP 2 Score: 48.9062 bits (115), Expect = 4.575e-6
Identity = 36/134 (26.87%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            EV  +LL+    ++++    + PL      G++ L+K L+      +      G+TPL +A  +G+    ++LL+  A     + + K    PL V  K     +++LL+  G + N   K+G TPL +AV +N
Sbjct:  392 EVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQ---TKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 521          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 61.6178 bits (148), Expect = 3.153e-10
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSY----LFKFI--------------ENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
             +I  ++N  EV + LL+ G + NSE +    PL      G   ++  LI+    +N  ++  G TPL L   +G+ GI  +L++ GA            +H  C Y    + KF+                PL    +Q +T I+ LL+ HG   N +  +G +PL +A
Sbjct:  592 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK-NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 760          

HSP 2 Score: 47.7506 bits (112), Expect = 9.707e-6
Identity = 36/134 (26.87%), Postives = 64/134 (47.76%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            EV  +LL+    ++++    + PL      G++ L+K L+      +      G+TPL +A  +G+    ++LL+  A     + + K    PL V  K     + +LL+  G + N   K+G TPL +AV +N
Sbjct:  437 EVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQ---TKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHN 566          
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 61.6178 bits (148), Expect = 3.156e-10
Identity = 46/170 (27.06%), Postives = 75/170 (44.12%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSY----LFKFI--------------ENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
             +I  ++N  EV + LL+ G + NSE +    PL      G   ++  LI+    +N  ++  G TPL L   +G+ GI  +L++ GA            +H  C Y    + KF+                PL    +Q +T I+ LL+ HG   N +  +G +PL +A
Sbjct:  609 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK-NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIA 777          

HSP 2 Score: 48.9062 bits (115), Expect = 4.784e-6
Identity = 36/134 (26.87%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            EV  +LL+    ++++    + PL      G++ L+K L+      +      G+TPL +A  +G+    ++LL+  A     + + K    PL V  K     +++LL+  G + N   K+G TPL +AV +N
Sbjct:  454 EVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQ---TKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 583          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:549110])

HSP 1 Score: 67.3958 bits (163), Expect = 9.161e-13
Identity = 42/142 (29.58%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             C     EV  YLL++GV ++++      PL      G + +++ LI    ++N  + + G TPL  A SK  + I  +LLE GA   +          PL     + N RI+Q+L+ H  S N  + +G TPL +A +  +
Sbjct:   48 ACSAGRTEVAEYLLRLGVPVDAKDDAGWTPLHIAASAGRDDIVRALIGKGAQVNAAN-QIGCTPLHYAASKNKHEIALMLLENGA---SPDAKDNLESTPLHRAASKGNLRIVQILLKHQASTNIQDTEGNTPLHLACDEER 185          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: gorasp1 (golgi reassembly stacking protein 1 [Source:Xenbase;Acc:XB-GENE-976361])

HSP 1 Score: 60.077 bits (144), Expect = 1.095e-9
Identity = 43/136 (31.62%), Postives = 69/136 (50.74%), Query Frame = 3
Query:  321 FEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            +++V  L+  G ++NS     R  L      G   + + LI     LNF D ++ YT L +A  KGN  ICKLL++ GA     S+       PL +   + +T I+ LL + G ++++     WTPL +AV Y++
Sbjct:  504 YKLVKLLISQGANVNSIQNDQRTALHIAADKGYFRVAQHLIQKGANLNFPD-QSNYTALHMAAVKGNSMICKLLIKHGANADAKSFQDW---TPLHLATYKGHTEIINLLKDGGSNIDSEGDLKWTPLHLAVRYSE 635          

HSP 2 Score: 49.6766 bits (117), Expect = 2.984e-6
Identity = 34/107 (31.78%), Postives = 58/107 (54.21%), Query Frame = 3
Query:  402 VVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             V  GN   +   ++LN  +N     +G+TPL LAV K    IC  L+E GA ++ T   ++    +PL    +  + RI++LL++H  +V++  +D WT L +A +
Sbjct:  366 AVAQGNLEKVNHFLSLNLNINS-KSISGFTPLILAVQKKLPDICMCLIENGADVNITDEDMW----SPLHFAAQGGDDRIVRLLLDHSANVDSKERDDWTALHLAAQ 467          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 59.3066 bits (142), Expect = 2.317e-9
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            V+ YLL +GVD+N    +   PL    +NG + ++ +LI+    +N  + E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  I  R +R  Q++I +G  ++  +K+G TPL +A  Y
Sbjct:  223 VIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVN-ERGFTPLHFAAASTHGALCLELLVCNGA---DVNIKSKDGKTPLHMTAIHGRFSRS-QIIIQNGAEIDCEDKNGNTPLHIAARY 351          

HSP 2 Score: 57.3806 bits (137), Expect = 1.124e-8
Identity = 47/160 (29.38%), Postives = 71/160 (44.38%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSM 710
            E+V+ LL  G +IN+     RR + W  + G+  ++K L+    E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q N R                 L+LL+ +G  VN  +KDG TPL M
Sbjct:  156 EMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKS-YTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHM 314          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 59.3066 bits (142), Expect = 2.320e-9
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            V+ YLL +GVD+N    +   PL    +NG + ++ +LI+    +N  + E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  I  R +R  Q++I +G  ++  +K+G TPL +A  Y
Sbjct:  225 VIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVN-ERGFTPLHFAAASTHGALCLELLVCNGA---DVNIKSKDGKTPLHMTAIHGRFSRS-QIIIQNGAEIDCEDKNGNTPLHIAARY 353          

HSP 2 Score: 57.3806 bits (137), Expect = 1.126e-8
Identity = 47/160 (29.38%), Postives = 71/160 (44.38%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSM 710
            E+V+ LL  G +IN+     RR + W  + G+  ++K L+    E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q N R                 L+LL+ +G  VN  +KDG TPL M
Sbjct:  158 EMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKS-YTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHM 316          
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 59.3066 bits (142), Expect = 2.321e-9
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            V+ YLL +GVD+N    +   PL    +NG + ++ +LI+    +N  + E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  I  R +R  Q++I +G  ++  +K+G TPL +A  Y
Sbjct:  248 VIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVN-ERGFTPLHFAAASTHGALCLELLVCNGA---DVNIKSKDGKTPLHMTAIHGRFSRS-QIIIQNGAEIDCEDKNGNTPLHIAARY 376          

HSP 2 Score: 57.3806 bits (137), Expect = 1.126e-8
Identity = 47/160 (29.38%), Postives = 71/160 (44.38%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSM 710
            E+V+ LL  G +IN+     RR + W  + G+  ++K L+    E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q N R                 L+LL+ +G  VN  +KDG TPL M
Sbjct:  181 EMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKS-YTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHM 339          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ripk4 (receptor-interacting serine-threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1919638])

HSP 1 Score: 61.6178 bits (148), Expect = 2.606e-10
Identity = 38/145 (26.21%), Postives = 68/145 (46.90%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN---EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             ++ C+     +V  LL+ GVD+  +G     PL +  W G+     LL K   ++      D   G TPL LA  +G+Y + ++L++  +    CS      + PL V  +  +T   +LL++ G     +  +G+T L +A +
Sbjct:  543 MHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD---GRTPLHLAAQRGHYRVARILIDLCSDVNICSLQ---AQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQ 681          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 60.8474 bits (146), Expect = 4.868e-10
Identity = 50/166 (30.12%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 54.6842 bits (130), Expect = 5.911e-8
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N     +G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  +
Sbjct:  221 VVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ-PNNSGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARH 349          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd44 (ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MGI:3045243])

HSP 1 Score: 60.8474 bits (146), Expect = 4.886e-10
Identity = 50/166 (30.12%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 54.6842 bits (130), Expect = 5.931e-8
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N     +G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  +
Sbjct:  221 VVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ-PNNSGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARH 349          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 59.6918 bits (143), Expect = 1.165e-9
Identity = 46/166 (27.71%), Postives = 74/166 (44.58%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+V  LL  G +IN+     RR + W  + G+  ++K L++   E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q+N +                 L+LL+ +G  VN  +KDG TPL M   + +
Sbjct:  154 EMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKS-YTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGR 318          

HSP 2 Score: 56.6102 bits (135), Expect = 1.421e-8
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 3
Query:  282 VSHLFNIVC-EKNSF------------EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VSH   + C +K S+             VV YLL +GVD+N    +   PL    +NG + ++ +LI+    +N    E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  +  R +R  Q +I  G  ++  +K+G TPL +A  Y
Sbjct:  193 VSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGA---DVNMKSKDGKTPLHMTALHGRFSRS-QTIIQSGAVIDCEDKNGNTPLHIAARY 349          
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 59.6918 bits (143), Expect = 1.171e-9
Identity = 46/166 (27.71%), Postives = 74/166 (44.58%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+V  LL  G +IN+     RR + W  + G+  ++K L++   E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q+N +                 L+LL+ +G  VN  +KDG TPL M   + +
Sbjct:  184 EMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKS-YTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGR 348          

HSP 2 Score: 56.6102 bits (135), Expect = 1.428e-8
Identity = 48/162 (29.63%), Postives = 78/162 (48.15%), Query Frame = 3
Query:  282 VSHLFNIVC-EKNSF------------EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VSH   + C +K S+             VV YLL +GVD+N    +   PL    +NG + ++ +LI+    +N    E G+TPL  A +  +  +C +LL+  GA     +   K  + PL +  +  R +R  Q +I  G  ++  +K+G TPL +A  Y
Sbjct:  223 VSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVN-QKNEKGFTPLHFAAASTHGALCLELLVGNGA---DVNMKSKDGKTPLHMTALHGRFSRS-QTIIQSGAVIDCEDKNGNTPLHIAARY 379          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q5F478|ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus OX=9031 GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.518e-9
Identity = 51/166 (30.72%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   I K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLEVVALLINHGAEVTCKDKK-GYTPLHAAASNGQINIVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 55.4546 bits (132), Expect = 1.998e-7
Identity = 41/134 (30.60%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +V +LL +GV+I+   ++    L    +NG + ++ +LI+    +N      G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  Y
Sbjct:  221 IVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVNQ-PNNNGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARY 349          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q9ERK0|RIPK4_MOUSE (Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 1.823e-9
Identity = 38/145 (26.21%), Postives = 68/145 (46.90%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGN---EYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             ++ C+     +V  LL+ GVD+  +G     PL +  W G+     LL K   ++      D   G TPL LA  +G+Y + ++L++  +    CS      + PL V  +  +T   +LL++ G     +  +G+T L +A +
Sbjct:  543 MHVACQHGQENIVRTLLRRGVDVGLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLD---GRTPLHLAAQRGHYRVARILIDLCSDVNICSLQ---AQTPLHVAAETGHTSTARLLLHRGAGKEALTSEGYTALHLAAQ 681          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q8N8A2|ANR44_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3)

HSP 1 Score: 61.2326 bits (147), Expect = 3.194e-9
Identity = 50/166 (30.12%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 56.225 bits (134), Expect = 1.377e-7
Identity = 43/134 (32.09%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N      G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  Y
Sbjct:  221 VVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ-PNNNGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARY 349          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|B2RXR6|ANR44_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus OX=10090 GN=Ankrd44 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.405e-9
Identity = 50/166 (30.12%), Postives = 72/166 (43.37%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLL---VCIKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN LL  G +IN+     RR L W  + G+  ++  LIN   E+   D++ GYTPL  A S G   + K LL  G            A+H  C      + N L+     + Q N                   L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  154 EMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKK-GYTPLHAAASNGQISVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGR 318          

HSP 2 Score: 54.6842 bits (130), Expect = 4.135e-7
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GV+I+   V+    L    +NG + ++ +LI+    +N     +G+TPL  A +  +  +C +LL+  GA     +   K  ++PL +  +  R TR  Q LI +G  ++ V+KDG TPL +A  +
Sbjct:  221 VVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQ-PNNSGFTPLHFAAASTHGALCLELLVNNGA---DVNIQSKDGKSPLHMTAVHGRFTRS-QTLIQNGGEIDCVDKDGNTPLHVAARH 349          
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Match: sp|Q9J508|V227_FOWPN (Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) OX=928301 GN=FPV227 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.746e-9
Identity = 48/160 (30.00%), Postives = 81/160 (50.62%), Query Frame = 3
Query:  237 LNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAV 716
            L+ E N+    Y   V  LFN V + N+  +V +LL+ GVD N    + R P+ + V  GN  ++K L+    + N FD    Y P+  ++ +    I K+LL+ GA   T    F  + +     IK ++  + ++LI++G S+   + D +TPL  A+
Sbjct:   14 LDLEPNYNECRYC--VRMLFNAV-KFNNIRLVMHLLRNGVDPNFYDEYMRSPIHYAVEKGNTEMVKALLEHKADPNIFDDNFDY-PITNSIIENKVEIVKILLQYGA-DKTMINEFDLLHD----AIKNKHIDMAKILIDNGISLTMKDTDDYTPLHYAM 164          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A3D8Q7F7 (ANK_REP_REGION domain-containing protein OS=Coleophoma crateriformis OX=565419 GN=BP5796_12554 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.261e-15
Identity = 48/138 (34.78%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAV 716
              EK    VV  LL+ G D+ ++  + R PL W   NG E +++ L+    +L+  D + G TPL LA   G+  + +LLLE GA   T +   ++   PL + +++ +  I+QLL+  G   +T + DGWTPLS+A 
Sbjct:  470 AVEKGHKAVVKLLLEKGADLETKDQYGRTPLSWAAANGYEAIVQLLLEKGADLDTKDHD-GRTPLSLATENGHEAMIQLLLEKGADLETKN---QYGRTPLSLAVEEGHEDIVQLLLEKGADPDTKDHDGWTPLSLAA 603          

HSP 2 Score: 73.559 bits (179), Expect = 6.593e-11
Identity = 45/142 (31.69%), Postives = 74/142 (52.11%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             ++  E+   ++V  LL+ G D +++      PL     NG+E +++ L+    +L+  ++  G TPL LA  +G+  I +LLLE GA   T +   +    PL      R+  I+QLL+  G   +T + DG TPLS+A E
Sbjct:  566 LSLAVEEGHEDIVQLLLEKGADPDTKDHDGWTPLSLAAANGHEAIVQLLLEKGADLDTKNQH-GRTPLSLAAEEGHEAIVQLLLEKGADLDTKN---QHGRTPLSFATAHRHEAIVQLLLEKGADPDTKDHDGRTPLSLAAE 703          

HSP 3 Score: 72.0182 bits (175), Expect = 1.904e-10
Identity = 43/143 (30.07%), Postives = 76/143 (53.15%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
             ++  E     ++  LL+ G D+ ++  + R PL   V  G+E +++ L+    + +  D + G+TPL LA + G+  I +LLLE GA   T +   +    PL +  ++ +  I+QLL+  G  ++T N+ G TPLS A  +
Sbjct:  533 LSLATENGHEAMIQLLLEKGADLETKNQYGRTPLSLAVEEGHEDIVQLLLEKGADPDTKDHD-GWTPLSLAAANGHEAIVQLLLEKGADLDTKN---QHGRTPLSLAAEEGHEAIVQLLLEKGADLDTKNQHGRTPLSFATAH 671          

HSP 4 Score: 69.707 bits (169), Expect = 1.187e-9
Identity = 41/131 (31.30%), Postives = 71/131 (54.20%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            +V  LL+ G D++++  H R PL      G+E +++ L+    +L+  ++  G TPL  A +  +  I +LLLE GA   T  +  +    PL +  ++ +  I+QLL+  G   +T ++ G TPLS+A E
Sbjct:  610 IVQLLLEKGADLDTKNQHGRTPLSLAAEEGHEAIVQLLLEKGADLDTKNQH-GRTPLSFATAHRHEAIVQLLLEKGADPDTKDHDGR---TPLSLAAEEGHEAIVQLLLEKGADPDTKDQYGQTPLSLATE 736          

HSP 5 Score: 60.4622 bits (145), Expect = 1.594e-6
Identity = 47/160 (29.38%), Postives = 77/160 (48.12%), Query Frame = 3
Query:  240 NFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            +FE N ++K   + +S+      E N       L + G+  +         L+W V  G++ ++K L+    +L   D + G TPL  A + G   I +LLLE GA   T  +  +    PL +  +  +  ++QLL+  G  + T N+ G TPLS+AVE
Sbjct:  419 DFEVNRKDKDNRAVLSY---AAQEGNEILTRQLLARSGIKTDLADNRGWTALFWAVEKGHKAVVKLLLEKGADLETKD-QYGRTPLSWAAANGYEAIVQLLLEKGADLDTKDHDGR---TPLSLATENGHEAMIQLLLEKGADLETKNQYGRTPLSLAVE 571          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A7RAG4 (Uncharacterized protein C015L OS=Paramecium bursaria Chlorella virus AR158 OX=380598 GN=C015L PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.064e-14
Identity = 50/165 (30.30%), Postives = 85/165 (51.52%), Query Frame = 3
Query:  231 LNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            L++    + RN     D     ++ C ++  E    L+K G  ++S+  H R PL    ++G    +K L++   +L+  D + G TPL LA  + +Y   K+L+EAGA       +     +PL + I   N  +LQLLI+HG  +N V+ DG++PL +A+  +
Sbjct:   40 LDIGMSVHIRN----DDRQTPLHLACLRDHVECAKMLIKSGARLDSKDEHRRTPLHLASFHGQADCVKVLVDSGSKLDERD-DIGCTPLLLACLERHYDCAKILIEAGA---DVDVVDSGGYSPLTISIHDNNIDLLQLLIDHGVDINVVDDDGYSPLMLAIAVD 196          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A1S3H061 (tankyrase OS=Lingula unguis OX=7574 GN=LOC106150852 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.336e-14
Identity = 47/148 (31.76%), Postives = 80/148 (54.05%), Query Frame = 3
Query:  300 IVCEKNSFEVVNYLLKIG----VDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            + CEKN+ EV   LL+ G     D+N E    +R +WW   +GN  L+ +L+  +C+++  D+E+G TPL  A+   +  +C+LL+ AGA ++          E+PL+ C++  N  I ++LIN   ++N      +  L  AV Y +
Sbjct:  146 LACEKNNLEVAKVLLQPGNKMIPDVNLEDKKGKRAVWWAAMHGNAELVDQLLIHDCDVDILDKESGTTPLYRAILSNSAKVCQLLIHAGANVNLRILGFNVGGESPLMKCVQLDNKEICEVLINSLCNLNAKTDTRYNALHYAVAYRR 293          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A356NCJ7 (ANK_REP_REGION domain-containing protein OS=Synechococcus sp. UBA8638 OX=2055762 GN=DD643_01820 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 5.446e-14
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  309 EKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIEN--PLLVCIKQRN-TRILQLLINHGFSVNTVNKDGWTPLSMAV 716
            E+   E    L++ G D N    + R PL+WVV NG   L++ L+    + N  DR  G TPL  A   G+  I + LL AGA ++   S L  F +   PLL  +  RN T ++ LLI HG  VN  ++ G  PL + +
Sbjct:  314 ERGDPEPAKLLIQAGADPNIPNRYGRTPLFWVVMNGQAELVRLLLQAGADANAADR-YGATPLRFAAESGSVDIAEALLSAGADVNPDPSSLPTFHDGNTPLLAAVGGRNPTAMVALLIRHGVDVNAKDEHGNAPLHLVI 452          

HSP 2 Score: 62.3882 bits (150), Expect = 3.262e-7
Identity = 42/144 (29.17%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  291 LFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            L   V  +N   +V  L++ GVD+N++  H   PL  V+  GN  L K LI    ++       G +P+ +A   G   +  LL+EAGA     +   +  + PL     Q      ++L++ G  VN  N +G TPL++A ++
Sbjct:  414 LLAAVGGRNPTAMVALLIRHGVDVNAKDEHGNAPLHLVIHEGNGALAKLLIEGGADV-LATNNAGNSPVQVAAFAGLPEVITLLVEAGA---PINVQDQVGDTPLHDAALQGRVEAARVLLDAGADVNIKNNEGKTPLNLARQH 553          
BLAST of Palmitoyltransferase vs. TrEMBL
Match: A0A382MGI9 (ANK_REP_REGION domain-containing protein OS=marine metagenome OX=408172 GN=METZ01_LOCUS300069 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.893e-13
Identity = 46/142 (32.39%), Postives = 66/142 (46.48%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHR---RPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVN-KDGWTPLSMAV 716
              E+   E +  L+  G DINS  + H     PL      G     K LI+  C++N    + G TPLDLA S+G+  I KLL E GA         +  + PL    ++ +    + LI  G  +N+ N +DG TPL  A+
Sbjct:   56 AAEQGDIEAIKKLIADGADINS--LKHEDGETPLHRAATRGQTEAAKLLIDSGCDINIGRSKDGQTPLDLAESRGSVEIAKLLREKGAKKSERRARGRDGQTPLHKAAEEGDIGAAKKLITDGADINSQNGRDGETPLHRAI 195          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 63.929 bits (154), Expect = 1.032e-11
Identity = 45/159 (28.30%), Postives = 72/159 (45.28%), Query Frame = 3
Query:  258 RNKFYLSDVSHLFNI--VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            R +   +D  H   +   C      +V +LL +G +++ +      PL      G E +++ LI+   +LN  + + G TPL  A SK  Y I  LLLE GA     +   K    PL     + N R++QLL+    S N  + +G T L +A +  +
Sbjct:   30 RAQASRTDQDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVN-QNGCTPLHYAASKNQYEIALLLLENGA---DPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEER 184          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 63.1586 bits (152), Expect = 1.436e-11
Identity = 44/155 (28.39%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  264 KFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            K  + D     +  C      +V +LL +G +++ +      PL      G E +++ LI+   +LN  + + G TPL  A SK  Y I  LLLE GA     +   K    PL     + N R++QLL+    S N  + +G T L +A +  +
Sbjct:   20 KIGVEDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVN-QNGCTPLHYAASKNQYEIALLLLENGA---DPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEER 170          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:103037594])

HSP 1 Score: 63.1586 bits (152), Expect = 1.969e-11
Identity = 44/151 (29.14%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  276 SDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            SD     +  C      +V +LL +G +++ +      PL      G E +++ LI+   +LN  + + G TPL  A SK  Y I  LLLE GA     +   K    PL     + N R++QLL+    S N  + +G T L +A +  +
Sbjct:   52 SDHRTALHWACSAGHANIVQFLLDVGAEVDLKDDASWTPLHIAASAGREEIVRSLISKGAQLNSVN-QNGCTPLHYAASKNQYEIALLLLENGA---DPNATDKLESTPLHRASAKGNYRLIQLLLKQSASTNIQDSEGNTALHLACDEER 198          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 60.4622 bits (145), Expect = 5.397e-10
Identity = 39/144 (27.08%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLI---NLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAV 716
             ++ C      VV  LL  G D ++ G      L    W G+  ++K L+    +N +    D   G  PL LA  +G Y + ++L++ GA     S     +  PL V  +  +T   +LL+ HG  + +    G TPL +A 
Sbjct:  528 IHVACHHGRENVVRVLLSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVD---GRAPLHLASQRGQYRVARVLVDLGA---DVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRTAQGLTPLHLAA 665          
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 60.077 bits (144), Expect = 7.062e-10
Identity = 39/144 (27.08%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLI---NLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAV 716
             ++ C      VV  LL  G D ++ G      L    W G+  ++K L+    +N +    D   G  PL LA  +G Y + ++L++ GA     S     +  PL V  +  +T   +LL+ HG  + +    G TPL +A 
Sbjct:  537 IHVACHHGRENVVRVLLSRGADAHARGKDEWTALHLAAWQGHLGIVKLLVKQAGVNVDGQTVD---GRAPLHLASQRGQYRVARVLVDLGA---DVSITSACLSTPLHVAAETGHTSTSRLLLKHGADIQSRTAQGLTPLHLAA 674          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 9.491e-14
Identity = 49/166 (29.52%), Postives = 78/166 (46.99%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAG------------AIHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E+VN+L+  G +IN+     RR + W  + G+  ++K L+    ++   D++ GY+PL  A S G  G+ KLLL+ G            A+H  C      + N L+ C   + Q N R                 L+LL+N+G  VN  +KDG +PL M   + +
Sbjct:  152 EMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKK-GYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGR 316          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ankrd1a (ankyrin repeat domain 1a (cardiac muscle) [Source:ZFIN;Acc:ZDB-GENE-100405-1])

HSP 1 Score: 54.6842 bits (130), Expect = 2.392e-9
Identity = 41/135 (30.37%), Postives = 63/135 (46.67%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPL 704
               +   EVV   L+ G D +S    HR  L      G+  +++KLI+   +L   D+    T +  A   G+  + + LL++GA I  T S L     +PL V  +     + + LI  G SVN  +K+G TPL
Sbjct:    9 AAARGKVEVVEEYLQQGGDPDSCDATHRTALHQSSQAGHLEVVQKLIDKGAQLENKDK-LKSTAMHCASRGGHVAVLETLLDSGASIKATDSIL----SSPLHVAARVGQYNVAEFLIERGASVNAQDKEGDTPL 138          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.190e-8
Identity = 36/142 (25.35%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I  +K+  E+   LL+ G + N+       PL      G+  +   L+    ++N   + +G +PL LA  +    + ++L++ GA H   +    +   PL+V     N +++  L+ HG  VN+  K+G+TPL  A +
Sbjct:  250 LHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK-SGLSPLHLAAQEDKVNVAEILVKHGA-HVNATTKLGY--TPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQ 387          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.237e-8
Identity = 36/142 (25.35%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
             +I  +K+  E+   LL+ G + N+       PL      G+  +   L+    ++N   + +G +PL LA  +    + ++L++ GA H   +    +   PL+V     N +++  L+ HG  VN+  K+G+TPL  A +
Sbjct:  340 LHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATK-SGLSPLHLAAQEDKVNVAEILVKHGA-HVNATTKLGY--TPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQ 477          
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007071.1 (pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 gene:ENSPMAG00000006394.1 transcript:ENSPMAT00000007071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 3.201e-8
Identity = 37/131 (28.24%), Postives = 63/131 (48.09%), Query Frame = 3
Query:  330 VNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            V+ LL+ G + +        P++  +  G+  ++K L+    ++N     TG+T L  A  KG+  + +LLLE GA +     Y       PL +  +      L++L+ HG  VN  +KD  TPL +A +
Sbjct:   30 VDLLLRAGAEPSRASSEEETPVFAAIGGGHVAVVKALLRNGAKVNGPQYWTGWTSLHQATWKGHVELLQLLLERGARVEARDDYGI----TPLFLAAQYGQAPCLRILLQHGPDVNAKSKDWATPLFIAAQ 156          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO34862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN63])

HSP 1 Score: 50.447 bits (119), Expect = 2.378e-8
Identity = 28/104 (26.92%), Postives = 49/104 (47.12%), Query Frame = 3
Query:  390 PLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTP 701
            PL      GN  L+ +L+ +  +LN  D  +G +PL  AV  G Y + + LL  GA+    ++        +     ++   ++ LL ++G  VN  N++G  P
Sbjct:    8 PLHLATLKGNRELITELLRMGADLNVEDGNSGRSPLHHAVESGRYHVIEFLLSRGALVNQRTFSGN---TAMHTAAGRQMDEVVSLLASYGADVNIQNREGDIP 108          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO39546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9P8])

HSP 1 Score: 45.8246 bits (107), Expect = 9.136e-7
Identity = 29/89 (32.58%), Postives = 46/89 (51.69%), Query Frame = 3
Query:  459 LNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLL-VCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            +NF   E G TP+ +A  +GN  + +LL + G    T       I N L+ +C    +  +LQ L++HG S    N +G TPL +A+ +
Sbjct:    1 MNFDRDERGRTPMHMAAMRGNVEMLELLYQHGGKLGTVD----LIGNTLMHMC---NHVDVLQFLVDHGLSATERNINGDTPLVLAMRF 82          
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 46.9802 bits (110), Expect = 2.176e-6
Identity = 39/137 (28.47%), Postives = 65/137 (47.45%), Query Frame = 3
Query:  321 FEVVNYLLKIGVDINSEGVHHR-RPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             +V   LL  G +IN E   ++  PL +  W G+  +++ L+  +  +    +E G+TPL  A   G+  +   LLE GA     S     I  PL     + +  +++LL+ +  ++    KDG TPL +A  Y K
Sbjct:   66 VKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKE-GFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDI--PLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAARYVK 199          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 65.4698 bits (158), Expect = 2.900e-12
Identity = 46/142 (32.39%), Postives = 67/142 (47.18%), Query Frame = 3
Query:  303 VCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
             C      +V +LL +GV++N +      PL      G E ++K LI+   +LN  + + G TPL  A SK  Y I  +LLE GA     +   K    PL     + N R++QLL+    S N  +  G TPL +A E  +
Sbjct:   47 ACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVN-QNGCTPLHYAASKDRYEIALMLLENGA---DPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEER 184          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:101174941])

HSP 1 Score: 59.6918 bits (143), Expect = 9.235e-10
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 3
Query:  297 NIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA-IHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            ++ C+     V+  LL  G D+  +G  +   L +  W G+  ++K L+             G T L LA  +G Y + ++L+E GA +H T   L      PL V  +  +T   +LLI H   ++  N  G TPL +A +
Sbjct:  547 HVACQHGQENVIRVLLSRGADVQIKGKDNWTALHFAAWQGHLGIVKLLVKQAGADVDGQTSDGRTSLHLASQRGQYRVARILIELGASVHLTSVGL----NTPLHVAAETGHTSTSRLLIKHKADMHAQNTQGLTPLHLACQ 684          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 57.7658 bits (138), Expect = 4.815e-9
Identity = 45/135 (33.33%), Postives = 71/135 (52.59%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            E+V YLL++G +I+         L    + G E +  +L+N    +N  ++  GYTPL LA    N  +C +LL+  GA     +   K  ++PL +  I  R TR  Q+LI +G  ++ V+K G TPL +A +Y
Sbjct:  220 EIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNK-CGYTPLHLAAVSTNGALCLELLVNNGA---DVNQQSKEGKSPLHMAAIHGRFTRS-QILIQNGGDIDCVDKYGNTPLHVAAKY 349          

HSP 2 Score: 50.8322 bits (120), Expect = 9.183e-7
Identity = 39/130 (30.00%), Postives = 64/130 (49.23%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
            E+V  LL  G ++++     R+P+    + G+  ++K L++ + + +  D+  GYTPL  A + G+  I K LL  GA          F    L +        +   L+NHG +VN  NK G+TPL +A
Sbjct:  154 EMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDK-LGYTPLHAAAASGHIEIVKYLLRMGA---EIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLA 279          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 56.6102 bits (135), Expect = 1.148e-8
Identity = 45/170 (26.47%), Postives = 72/170 (42.35%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSY----LFKFI--------------ENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
             +I  ++N  EV + LL+ G   N E +    PL      G   ++  LI+    +N  ++  G TPL L   +G+ GI   L++ GA            +H  C Y    + KF+                PL    +Q +T I+ LL+ HG   N +  +G +PL +A
Sbjct:  604 LHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNK-NGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIA 772          

HSP 2 Score: 51.9878 bits (123), Expect = 3.826e-7
Identity = 38/134 (28.36%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYN 725
            EV  +LL+    +++     + PL      G++ L+K L++     +      G+TPL +A  +G+    ++LL+AGA     +   K    PL V  K     + +LL+  G + N   K+G TPL +AV +N
Sbjct:  449 EVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDS-ATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMT---KKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHN 578          

HSP 3 Score: 47.7506 bits (112), Expect = 8.977e-6
Identity = 30/101 (29.70%), Postives = 51/101 (50.50%), Query Frame = 3
Query:  417 NEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            N  + + L+N    +NF  +  G TPL +A  +GN  + +LLL+ GA         K    PL    +  + RI+++L+ HG  +    K+G +P+ MA +
Sbjct:  216 NMSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVMMVRLLLDRGA---QIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQ 312          
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 55.4546 bits (132), Expect = 2.309e-8
Identity = 46/161 (28.57%), Postives = 70/161 (43.48%), Query Frame = 3
Query:  321 FEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTCSYLFKFIENPLLVC---IKQRNTR----------------ILQLLINHGFSVNTVNKDGWTPLSM 710
             E+V  LL  G +IN+     RR + W  + G+  ++K L +   E+   D+++ YTPL  A S G   + K LL+ G             +H  C      + N L+ C   + Q N +                 L+LL+ +G  VN  +KDG TPL M
Sbjct:  153 LEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKS-YTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHM 312          

HSP 2 Score: 53.5286 bits (127), Expect = 1.151e-7
Identity = 41/134 (30.60%), Postives = 68/134 (50.75%), Query Frame = 3
Query:  327 VVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGIC-KLLLEAGAIHYTCSYLFKFIENPL-LVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEY 722
            VV +LL +GVDIN    +   PL    +NG + ++ +LI     +N  + E G+ PL    +  +  +C +LL+  GA     +   K  + PL +  I  R +R  Q +I +G  ++  +K+G TPL +A  Y
Sbjct:  221 VVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVN-EKGFAPLHFTAASRHGALCLELLVCNGA---DVNIKSKDGKTPLHMTAIHGRFSRS-QAIIENGAEIDCEDKNGNTPLHIAARY 349          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000065721.1 (SMESG000065721.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.490e-13
Identity = 46/135 (34.07%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E++  LL +  DI  E     RP+ WV   G+  +LK L+  NCE    D   G  P+  A +KG+  I KLLLE       C    K  E P+   I + ++ I++LL+     ++ V KDG +PL +A +YN+
Sbjct:  169 EILKLLLDLNCDIECETKSGERPIHWVSSRGHSEILKLLLEHNCEFECEDN-IGNRPIHCASNKGHSTILKLLLEHNC-EIECEN--KSGERPIHCAIIKGHSEIIKLLLQWKCQIDCVRKDGKSPLDLAKQYNR 299          

HSP 2 Score: 51.6026 bits (122), Expect = 3.736e-7
Identity = 43/145 (29.66%), Postives = 67/145 (46.21%), Query Frame = 3
Query:  285 SHLFNIVCEKNS--FEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
            S + +I C  N    E++  LLK   DI SE     RP+ W    G+  +LK L++ NCE+    + +G  P+  A+  G+  I KLLL+       C    K  E P+     + ++ IL+LL+ H       +  G  P+  A
Sbjct:   88 SGMRSIHCAANEGHLEILKLLLKNHCDIESETKSGWRPIHWASRKGHSKILKLLLDYNCEIECKTK-SGERPIHWAIRNGHSEILKLLLDLNC-DIECET--KSGERPIHWVSSRGHSEILKLLLEHNCEFECEDNIGNRPIHCA 228          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000065721.1 (SMESG000065721.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.490e-13
Identity = 46/135 (34.07%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  324 EVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            E++  LL +  DI  E     RP+ WV   G+  +LK L+  NCE    D   G  P+  A +KG+  I KLLLE       C    K  E P+   I + ++ I++LL+     ++ V KDG +PL +A +YN+
Sbjct:  169 EILKLLLDLNCDIECETKSGERPIHWVSSRGHSEILKLLLEHNCEFECEDN-IGNRPIHCASNKGHSTILKLLLEHNC-EIECEN--KSGERPIHCAIIKGHSEIIKLLLQWKCQIDCVRKDGKSPLDLAKQYNR 299          

HSP 2 Score: 51.6026 bits (122), Expect = 3.736e-7
Identity = 43/145 (29.66%), Postives = 67/145 (46.21%), Query Frame = 3
Query:  285 SHLFNIVCEKNS--FEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
            S + +I C  N    E++  LLK   DI SE     RP+ W    G+  +LK L++ NCE+    + +G  P+  A+  G+  I KLLL+       C    K  E P+     + ++ IL+LL+ H       +  G  P+  A
Sbjct:   88 SGMRSIHCAANEGHLEILKLLLKNHCDIESETKSGWRPIHWASRKGHSKILKLLLDYNCEIECKTK-SGERPIHWAIRNGHSEILKLLLDLNC-DIECET--KSGERPIHWVSSRGHSEILKLLLEHNCEFECEDNIGNRPIHCA 228          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000017098.1 (SMESG000017098.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.748e-11
Identity = 43/165 (26.06%), Postives = 75/165 (45.45%), Query Frame = 3
Query:  243 FEKNFRNKFY---LSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            F K F+ ++    + D+    +  CE+   E+V  L+    DI +    ++RP+ +   NG++  +K L++L+C++N  D E    P+  A   G+ GI  LL++    H       K    PL    K       +LLI+H   +   +K    P+  A EY +
Sbjct:   20 FRKYFKEEYLEREVRDMKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARD-EWDRVPIHRACEHGHSGIVNLLIDH---HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYER 180          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000017098.1 (SMESG000017098.1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.376e-11
Identity = 43/165 (26.06%), Postives = 75/165 (45.45%), Query Frame = 3
Query:  243 FEKNFRNKFY---LSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK 728
            F K F+ ++    + D+    +  CE+   E+V  L+    DI +    ++RP+ +   NG++  +K L++L+C++N  D E    P+  A   G+ GI  LL++    H       K    PL    K       +LLI+H   +   +K    P+  A EY +
Sbjct:   20 FRKYFKEEYLEREVRDMKRPIHHACERGQTEIVKLLIDYNCDIEALDKWNQRPIHYASQNGHKKTVKLLVSLHCDINARD-EWDRVPIHRACEHGHSGIVNLLIDH---HCDIESRDKLGYRPLHYACKAGRAETAKLLIDHHCDIEARDKWDQRPIHCACEYER 180          
BLAST of Palmitoyltransferase vs. Planmine SMEST
Match: SMESG000018225.1 (SMESG000018225.1)

HSP 1 Score: 62.3882 bits (150), Expect = 9.153e-11
Identity = 39/143 (27.27%), Postives = 71/143 (49.65%), Query Frame = 3
Query:  291 LFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVE 719
            L ++ C+    E+V +L+   VDI      ++ PL    W G++  +K LI  NC +N  D E   +P+  A  +G+  I KLL++         +  K   +P+ +   + +  I+++LI+    + T +KDG  P+ +A E
Sbjct:   35 LIHLACDFGHLEIVKFLIDHNVDIEIRDEWNQCPLHLACWEGHKDTVKILIESNCNINACD-EVNRSPIYFACKRGHVEIVKLLIDQRCDIQV--FGGKKKRHPIHMGCSEGHADIVKMLIDENCDIETCDKDGKRPIHLACE 174          

HSP 2 Score: 57.7658 bits (138), Expect = 2.924e-9
Identity = 35/133 (26.32%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  309 EKNSFEVVNYLLKIGVDINSEGVH-HRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPL 704
            + N  E+V  L++   D+N+ G    RRP+ +    G+  ++K LI+ NC++   +R+    P+ +A   G+  I K+LLE      +C    ++   P+ +  +  +T I++ LIN    +  +N + W P+
Sbjct:  392 DNNHREIVKLLIEENCDVNAIGGKWDRRPIHFACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHMACWDGHLEILKVLLEKNCDIESCD---EWKRRPIHLACENGHTEIVKFLINLHCDIEAINDNAWRPI 521          

HSP 3 Score: 57.7658 bits (138), Expect = 3.354e-9
Identity = 38/175 (21.71%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  189 FKFYAPELDFIVKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPLSMA 713
            F     ++D +   ++ N +   RN+ +     H+    C     E++  LL+   DI S     RRP+     NG+  ++K LINL+C++   + +  + P+     KG+    K+L+E       C ++ +    P+ +  ++ +T I+++LI+H   +   +     P+ ++
Sbjct:  423 FACLKGDIDIVKVLIDHNCDIEVRNRKWNQQPIHM---ACWDGHLEILKVLLEKNCDIESCDEWKRRPIHLACENGHTEIVKFLINLHCDIEAIN-DNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGHMKR---RPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHIS 590          

HSP 4 Score: 53.1434 bits (126), Expect = 9.994e-8
Identity = 37/167 (22.16%), Postives = 70/167 (41.92%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGA------------IHYTC------------------SYLFKFIENPLLVCIKQRNTRILQLLINHGFSVNTVNKDGWTPL 704
             ++ CE    E+V +L+ +  DI +   +  RP+ +  W G+   +K L+  NC++          P+ LA  KG+  I K+L++               IH +C                    L  +  +P+ +  +  +T I+++LINH   +  +N   W P+
Sbjct:  488 IHLACENGHTEIVKFLINLHCDIEAINDNAWRPIHFGCWKGHSDTVKVLVEQNCDIEACGH-MKRRPIHLACEKGHTEIVKVLIDHHCDIEAQDDRKRCPIHISCVKGYMEITKILLDQRCDIEALDDWKMSPIHLACENGHTEIVKVLINHHCDIEAINDKAWRPI 653          

HSP 5 Score: 49.2914 bits (116), Expect = 1.920e-6
Identity = 33/122 (27.05%), Postives = 59/122 (48.36%), Query Frame = 3
Query:  294 FNIVCEKNSFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNFFDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCIKQRNTRILQLLINH 659
             ++ CE    E+V  L+    DI +      RP+ +  W G+  ++K L+  NC++   D      P+ LA  KG+  I K+L++       C    +F ++P+ +  K+  T ++QLL  H
Sbjct:  620 IHLACENGHTEIVKVLINHHCDIEAINDKAWRPIHFGCWKGHLDIVKVLVEQNCDIEACDH-MKRRPIHLACEKGHTEIVKVLIDHHCDISACG--GRFNQSPIYLAHKKNFTELIQLLTVH 738          
The following BLAST results are available for this feature:
BLAST of Palmitoyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RIPK42.106e-1127.78receptor interacting serine/threonine kinase 4 [So... [more]
ANKRD442.930e-1028.74ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD443.961e-1028.92ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD446.650e-1030.12ankyrin repeat domain 44 [Source:HGNC Symbol;Acc:H... [more]
ANKRD287.237e-1027.71ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.085e-829.63AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.085e-829.63AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.087e-829.63AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.087e-829.63AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.088e-829.63AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank6.025e-926.86gene:FBgn0011747 transcript:FBtr0089172[more]
Ank6.025e-926.86gene:FBgn0011747 transcript:FBtr0300497[more]
Ank6.025e-926.86gene:FBgn0011747 transcript:FBtr0089171[more]
Ank6.025e-926.86gene:FBgn0011747 transcript:FBtr0089173[more]
Ank23.063e-826.90gene:FBgn0261788 transcript:FBtr0334062[more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd101.052e-1129.58proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
psmd101.052e-1129.58proteasome 26S subunit, non-ATPase 10 [Source:ZFIN... [more]
ank1b2.994e-1027.06ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX640476.13.153e-1027.06ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1b3.156e-1027.06ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd109.161e-1329.58proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
gorasp11.095e-931.62golgi reassembly stacking protein 1 [Source:Xenbas... [more]
rev12.317e-931.34REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev12.320e-931.34REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev12.321e-931.34REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ripk42.606e-1026.21receptor-interacting serine-threonine kinase 4 [So... [more]
Ankrd444.868e-1030.12ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd444.886e-1030.12ankyrin repeat domain 44 [Source:MGI Symbol;Acc:MG... [more]
Ankrd281.165e-927.71ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd281.171e-927.71ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Palmitoyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F478|ANR44_CHICK1.518e-930.72Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q9ERK0|RIPK4_MOUSE1.823e-926.21Receptor-interacting serine/threonine-protein kina... [more]
sp|Q8N8A2|ANR44_HUMAN3.194e-930.12Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|B2RXR6|ANR44_MOUSE3.405e-930.12Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q9J508|V227_FOWPN4.746e-930.00Putative ankyrin repeat protein FPV227 OS=Fowlpox ... [more]
back to top
BLAST of Palmitoyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3D8Q7F71.261e-1534.78ANK_REP_REGION domain-containing protein OS=Coleop... [more]
A7RAG41.064e-1430.30Uncharacterized protein C015L OS=Paramecium bursar... [more]
A0A1S3H0612.336e-1431.76tankyrase OS=Lingula unguis OX=7574 GN=LOC10615085... [more]
A0A356NCJ75.446e-1435.71ANK_REP_REGION domain-containing protein OS=Synech... [more]
A0A382MGI92.893e-1332.39ANK_REP_REGION domain-containing protein OS=marine... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd101.032e-1128.30proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd101.436e-1128.39proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
psmd101.969e-1129.14proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ripk45.397e-1027.08receptor interacting serine/threonine kinase 4 [So... [more]
ripk47.062e-1027.08receptor interacting serine/threonine kinase 4 [So... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003991.19.491e-1429.52pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ankrd1a2.392e-930.37ankyrin repeat domain 1a (cardiac muscle) [Source:... [more]
ENSPMAT00000007449.11.190e-825.35pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.11.237e-825.35pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007071.13.201e-828.24pep scaffold:Pmarinus_7.0:GL486086:7043:13224:-1 g... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Palmitoyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO348622.378e-826.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395469.136e-732.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281782.176e-628.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Palmitoyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd102.900e-1232.39proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ripk49.235e-1028.17receptor interacting serine/threonine kinase 4 [So... [more]
ankrd52a4.815e-933.33serine/threonine-protein phosphatase 6 regulatory ... [more]
ank1b1.148e-826.47ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ankrd28b2.309e-828.57ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Palmitoyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065721.11.490e-1334.07SMESG000065721.1[more]
SMESG000065721.11.490e-1334.07SMESG000065721.1[more]
SMESG000017098.11.748e-1126.06SMESG000017098.1[more]
SMESG000017098.13.376e-1126.06SMESG000017098.1[more]
SMESG000018225.19.153e-1127.27SMESG000018225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017994 ID=SMED30017994|Name=Palmitoyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=822bp
TTGGATCGTAAAAATAGATTTTGATAATTTAAATATTTATGAAGCTTTTA
TATTTAATGAAAATTATTAACTAAAATCATAAATGATATCTAACTTATAT
TTAAAAAACAATTTGTTTTAACGCTTCAAATAATATAACTAAAACTATTG
AAATATTTTGATAATTTATGTCTCTAAAAAAAGATATTTTTAAATTTTAT
GCTCCAGAGCTTGATTTTATTGTTAAAAAGTTAAATTTAAACTTTGAAAA
AAATTTCAGAAACAAATTTTATTTGTCCGATGTTTCTCATTTATTCAATA
TAGTTTGCGAGAAAAATAGTTTCGAAGTCGTGAATTATTTATTGAAAATT
GGCGTTGACATTAATTCAGAAGGAGTTCATCATCGCAGACCCCTATGGTG
GGTCGTGTGGAATGGAAATGAATATTTATTGAAAAAACTAATTAATTTAA
ATTGTGAATTAAATTTTTTCGATAGGGAAACCGGATATACTCCATTGGAT
TTGGCTGTGTCGAAAGGAAATTATGGGATTTGTAAGCTTTTATTGGAAGC
GGGTGCGATCCATTATACCTGCAGTTATTTGTTTAAATTTATTGAAAATC
CTTTATTAGTATGCATCAAACAACGAAATACTCGTATTTTGCAGTTGCTG
ATAAATCATGGTTTTTCTGTGAATACGGTTAATAAAGATGGATGGACACC
TTTATCAATGGCTGTCGAATATAATAAGTAGATTTTTCTATATTAATTTT
TCGCTCGAATATAAGCTTGTATTATTTATTTGTCTGATATTTTAATTTAT
GCTACTACCAAGGAATCACGGT
back to top

protein sequence of SMED30017994-orf-1

>SMED30017994-orf-1 ID=SMED30017994-orf-1|Name=SMED30017994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MSLKKDIFKFYAPELDFIVKKLNLNFEKNFRNKFYLSDVSHLFNIVCEKN
SFEVVNYLLKIGVDINSEGVHHRRPLWWVVWNGNEYLLKKLINLNCELNF
FDRETGYTPLDLAVSKGNYGICKLLLEAGAIHYTCSYLFKFIENPLLVCI
KQRNTRILQLLINHGFSVNTVNKDGWTPLSMAVEYNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0009986cell surface
GO:0014704intercalated disc
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030054cell junction
GO:0030315T-tubule
GO:0030424axon
GO:0030425dendrite
GO:0031594neuromuscular junction
GO:0033268node of Ranvier
GO:0042383sarcolemma
GO:0042995cell projection
GO:0043005neuron projection
GO:0043034costamere
GO:0043194axon initial segment
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: molecular function
TermDefinition
GO:0016409palmitoyltransferase activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0019706protein-cysteine S-palmitoyltransferase activity
GO:0005515protein binding
GO:0008092cytoskeletal protein binding
GO:0030507spectrin binding
GO:0030674protein binding, bridging
GO:0044325ion channel binding
GO:0045296cadherin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007528neuromuscular junction development
GO:0010628positive regulation of gene expression
GO:0010650positive regulation of cell communication by electrical coupling
GO:0010765positive regulation of sodium ion transport
GO:0010960magnesium ion homeostasis
GO:0034112positive regulation of homotypic cell-cell adhesion
GO:0043266regulation of potassium ion transport
GO:0045838positive regulation of membrane potential
GO:0071286cellular response to magnesium ion
GO:0071709membrane assembly
GO:0072659protein localization to plasma membrane
GO:0072661protein targeting to plasma membrane
GO:0090314positive regulation of protein targeting to membrane
GO:1900827positive regulation of membrane depolarization during cardiac muscle cell action potential
GO:1902260negative regulation of delayed rectifier potassium channel activity
GO:2000651positive regulation of sodium ion transmembrane transporter activity
GO:2001259positive regulation of cation channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 141..170
e-value: 9.9
score: 15.1
coord: 71..100
e-value: 7.9
score: 15.4
coord: 105..137
e-value: 0.014
score: 24.6
coord: 38..67
e-value: 32.0
score: 13.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 105..130
score: 10.606
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 23..187
e-value: 1.4E-30
score: 108.1
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 34..186
NoneNo IPR availablePFAMPF13637Ank_4coord: 145..183
e-value: 8.8E-7
score: 29.4
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 46..130
NoneNo IPR availablePANTHERPTHR24134:SF1ANKYRIN REPEAT AND SOCS BOX PROTEIN 8coord: 143..186
NoneNo IPR availablePANTHERPTHR24134FAMILY NOT NAMEDcoord: 143..186
NoneNo IPR availablePANTHERPTHR24134:SF1ANKYRIN REPEAT AND SOCS BOX PROTEIN 8coord: 46..130
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 45..130
e-value: 3.3E-11
score: 43.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 43..187
score: 27.425