Ethanolamine-phosphate phospho-lyase

Overview
NameEthanolamine-phosphate phospho-lyase
Smed IDSMED30017986
Length (bp)1493
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ethanolamine-phosphate phospho-lyase (SMED30017986) t-SNE clustered cells

Violin plots show distribution of expression levels for Ethanolamine-phosphate phospho-lyase (SMED30017986) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ethanolamine-phosphate phospho-lyase (SMED30017986) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ethanolamine-phosphate phospho-lyase (SMED30017986) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017986

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30017986h1SMcG0001142 SmedASXL_012379SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30017986h1SMcG0001142 dd_Smed_v4_6738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30017986h1SMcG0001142 dd_Smed_v6_6738_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Match: ETNPPL (ethanolamine-phosphate phospho-lyase [Source:HGNC Symbol;Acc:HGNC:14404])

HSP 1 Score: 518.464 bits (1334), Expect = 0.000e+0
Identity = 239/439 (54.44%), Postives = 319/439 (72.67%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK  T+ LR+K+IG S ++FF+ DPIKI++   QYM+DEN  +YLDCINNVAHVGH HP +  A ++QM LLNTN R+LHDNIV  A+RL+ TLP+ L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV PTPD YRGKYR++       +  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +H  GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+PVA VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLDI+ENE LQ  A+ +GNYL + L        +IGD+RG GLF+GIDLVK    R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F++D L  +L  +++
Sbjct:    5 YSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPTPDTYRGKYREDHADS---ASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Match: ETNPPL (ethanolamine-phosphate phospho-lyase [Source:HGNC Symbol;Acc:HGNC:14404])

HSP 1 Score: 499.975 bits (1286), Expect = 6.508e-174
Identity = 234/439 (53.30%), Postives = 314/439 (71.53%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRR-GPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK  T+ LR+K+IG S ++FF+ DPIKI++   QYM+DEN  +YLDCINNVAH       +  A ++QM LLNTN R+LHDNIV  A+RL+ TLP+ L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV PTPD YRGKYR++       +  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +H  GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+PVA VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLDI+ENE LQ  A+ +GNYL + L        +IGD+RG GLF+GIDLVK    R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F++D L  +L  +++
Sbjct:    5 YSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAH------GVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPTPDTYRGKYREDHADS---ASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEE 432          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Match: PHYKPL (5-phosphohydroxy-L-lysine phospho-lyase [Source:HGNC Symbol;Acc:HGNC:28249])

HSP 1 Score: 483.797 bits (1244), Expect = 2.963e-168
Identity = 226/438 (51.60%), Postives = 308/438 (70.32%), Query Frame = 3
Query:  120 KEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDE 1430
            K  T+ LRQ+ I SS ++FF EDP+KI++  GQYMYDE    Y+DCI+NVAHVGH HP +  A  +Q  +LNTN RYLHDNIV  A+RL+ TLP+ L + YF+NSGSEANDLA+R+AR+YT  ++ +VL+HAYHG+L S+  ISPYK    + ++    W HV P PD YRG YR++       +  YA +V++V  S +EKG+ +  F+ ES+ S GGQ+I P  Y+ ++ + I + GGV +ADE+Q GFGRVG  FWAFQL   D  PDIVTMGK +GNG+PVA V  T+ ++ AF   G +YFNTFGGSPVSCA+ LAVL+++E E+LQ+ A ++G++L Q L        I+GDVRG GLF+G+DL+K   TR PAT+EA   + RLKE  +++STDGP  NILKFKPPMCFS ++A  ++  L  +L  ++++
Sbjct:    8 KADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHVGHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRLARHYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKE---WVHVAPLPDTYRGPYREDH---PNPAMAYANEVKRVVSSAQEKGRKIAAFFAESLPSVGGQIIPPAGYFSQVAEHIRKAGGVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEK 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Match: ETNPPL (ethanolamine-phosphate phospho-lyase [Source:HGNC Symbol;Acc:HGNC:14404])

HSP 1 Score: 476.478 bits (1225), Expect = 3.434e-165
Identity = 220/403 (54.59%), Postives = 292/403 (72.46%), Query Frame = 3
Query:  222 MYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            M+DEN  +YLDCINNVAHVGH HP +  A ++QM LLNTN R+LHDNIV  A+RL+ TLP+ L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV PTPD YRGKYR++       +  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +H  GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+PVA VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLDI+ENE LQ  A+ +GNYL + L        +IGD+RG GLF+GIDLVK    R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F++D L  +L  +++
Sbjct:    1 MFDENGEQYLDCINNVAHVGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPTPDTYRGKYREDHADS---ASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEE 398          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Match: ETNPPL (ethanolamine-phosphate phospho-lyase [Source:HGNC Symbol;Acc:HGNC:14404])

HSP 1 Score: 444.121 bits (1141), Expect = 1.002e-152
Identity = 205/385 (53.25%), Postives = 276/385 (71.69%), Query Frame = 3
Query:  276 VGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRR-GPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            +GH HP +  A ++QM LLNTN R+LHDNIV  A+RL+ TLP+ L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV PTPD YRGKYR++       +  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +H  GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+PVA VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLDI+ENE LQ  A+ +GNYL + L        +IGD+RG GLF+GIDLVK    R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F++D L  +L  +++
Sbjct:    1 MGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPTPDTYRGKYREDHADS---ASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEE 380          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Match: eppl-1 (Ethanolamine-phosphate phospho-lyase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P91408])

HSP 1 Score: 400.593 bits (1028), Expect = 8.663e-136
Identity = 194/430 (45.12%), Postives = 285/430 (66.28%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYR--DNEYSIE----KLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRL----KEKQIIMSTDGPYDNILKFKPPMCFSEND 1376
            SKE+ ++ R+  IGS  QIF+S+DP  + + S QY+YDE + ++LDCI+NV HVGH HP +  A  +Q++    N R++   +   AE++ +TLP  L+   F NSGSEANDLA+R+AR YTK K+ +V+EHAYHG++ +  ++SPYK +  +   + P W HV P PD +RGK+R  DNE + E         Y++DV+ +   +  +   V  ++ E++QSCGGQVI PK Y++ +   +  +GG++I DEVQTGFGR+G  +WA QL D    PDIVTMGKPMGNG+PV+AV T ++I++A      YFNT+GG+PV+CA  ++V+ ++++E L E ++ +G  L+  L  +      IGD+RG GLF GIDLVK R TREP   + KLA+  +    K   I+++ DGP+ NILK KPP+CF+EN+
Sbjct:   26 SKEEILKRRKDTIGSKCQIFYSDDPFMVSRASMQYLYDEKSNKFLDCISNVQHVGHCHPKVVEAISKQLATSTCNVRFVSTQLTDCAEQILSTLP-GLDTVLFCNSGSEANDLALRLARDYTKHKDAIVIEHAYHGHVTTTMELSPYKFDHGSTV-SQPDWVHVAPCPDVFRGKHRLADNELTNEDKLYAAGKQYSDDVKSILNDVESRQCGVAAYFAEALQSCGGQVIPPKDYFKDVATHVRNHGGLMIIDEVQTGFGRIGRKYWAHQLYDDGFLPDIVTMGKPMGNGFPVSAVATRKEIADALGGEVGYFNTYGGNPVACAAVISVMKVVKDENLLEHSQQMGEKLEVALRDLQKKHECIGDIRGVGLFWGIDLVKDRNTREP---DQKLAIATILALRKSYGILLNADGPHTNILKIKPPLCFNENN 450          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Match: eppl-1 (Ethanolamine-phosphate phospho-lyase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P91408])

HSP 1 Score: 400.593 bits (1028), Expect = 8.663e-136
Identity = 194/430 (45.12%), Postives = 285/430 (66.28%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYR--DNEYSIE----KLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRL----KEKQIIMSTDGPYDNILKFKPPMCFSEND 1376
            SKE+ ++ R+  IGS  QIF+S+DP  + + S QY+YDE + ++LDCI+NV HVGH HP +  A  +Q++    N R++   +   AE++ +TLP  L+   F NSGSEANDLA+R+AR YTK K+ +V+EHAYHG++ +  ++SPYK +  +   + P W HV P PD +RGK+R  DNE + E         Y++DV+ +   +  +   V  ++ E++QSCGGQVI PK Y++ +   +  +GG++I DEVQTGFGR+G  +WA QL D    PDIVTMGKPMGNG+PV+AV T ++I++A      YFNT+GG+PV+CA  ++V+ ++++E L E ++ +G  L+  L  +      IGD+RG GLF GIDLVK R TREP   + KLA+  +    K   I+++ DGP+ NILK KPP+CF+EN+
Sbjct:   26 SKEEILKRRKDTIGSKCQIFYSDDPFMVSRASMQYLYDEKSNKFLDCISNVQHVGHCHPKVVEAISKQLATSTCNVRFVSTQLTDCAEQILSTLP-GLDTVLFCNSGSEANDLALRLARDYTKHKDAIVIEHAYHGHVTTTMELSPYKFDHGSTV-SQPDWVHVAPCPDVFRGKHRLADNELTNEDKLYAAGKQYSDDVKSILNDVESRQCGVAAYFAEALQSCGGQVIPPKDYFKDVATHVRNHGGLMIIDEVQTGFGRIGRKYWAHQLYDDGFLPDIVTMGKPMGNGFPVSAVATRKEIADALGGEVGYFNTYGGNPVACAAVISVMKVVKDENLLEHSQQMGEKLEVALRDLQKKHECIGDIRGVGLFWGIDLVKDRNTREP---DQKLAIATILALRKSYGILLNADGPHTNILKIKPPLCFNENN 450          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Match: T09B4.8 (pep chromosome:WBcel235:I:6164719:6166539:-1 gene:WBGene00020382.1 transcript:T09B4.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T09B4.8)

HSP 1 Score: 267.7 bits (683), Expect = 2.760e-84
Identity = 152/430 (35.35%), Postives = 236/430 (54.88%), Query Frame = 3
Query:  168 QIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQ-MSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPT--PDRYRGKY-----RDNEYSIE-----------KLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLD 1394
             + + +D + I KG  Q+++D N  +YLD    +    VGH HP I +A  +Q   L +T   Y  + I   AE+L +  P  L   +FVNSGSEANDLA+ +AR YT   + + + + YHG    MTQ      N  N +   P   ++  +   D YRG +     RD+   ++           + SD Y E    +             F +ES+Q  GG V +P  Y +K  + + + GG+ IADEVQTGFGR+G+ FW F+  D+   PD+VTM K +GNG+P+ AVVT+++I+++F +   YFNT+GG+P++  +  AVL+++E EKLQE +  +G+Y  +QL  +  D   IGDVRG GL +G++L+   Q +  A  +        K + +++   G + N+L+ KPPMC ++ D DF +D
Sbjct:   15 HVTYYKDQLLITKGEKQFLFDSNGKKYLDFFGGIVTVSVGHCHPKINAALTEQAQKLWHTTSIYHTEPIYEYAEKLLSKFPSKLNSVFFVNSGSEANDLALALARNYTGRFDVISMRNGYHG----MTQTVLGATNLGNWKPVFPHGFNIFKSLNADPYRGIFGGSNCRDSPIQVKNRKCDCKPGSCQASDKYIEQFDDMLLHDFSHSSGPAAFLIESIQGVGGTVQYPHGYLKKSYESVQKRGGLAIADEVQTGFGRLGSHFWGFESQDA--LPDMVTMAKGIGNGFPLGAVVTSKEIADSFNKSL-YFNTYGGNPLASVVGKAVLEVIEEEKLQENSAVVGDYFLKQLAAI--DDATIGDVRGKGLMIGVELI-DEQGKPLAAAKTAAIFEDTKNQGLLIGKGGIHGNVLRIKPPMCITKKDVDFAVD 434          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Match: oatr-1 (Probable ornithine aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q18040])

HSP 1 Score: 135.191 bits (339), Expect = 1.005e-34
Identity = 109/424 (25.71%), Postives = 205/424 (48.35%), Query Frame = 3
Query:  189 PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYT------KSKETLVL--EHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            P+ + KG G +++D    +Y D +   + V  GH HP +     +Q S L    R  ++N++   E     L    ++   +N+G EA + A+++AR +       K  E +V+  E+ + G  ++    S          ++   +   VP        ++   Y+          +++ V +++++K  +V  F +E +Q   G V+    Y + +  +  +Y  + I DEVQ+G GR G     +  N   +RPDIV +GK +  G YPV+AV+    +    + G ++ +T+GG+P++C +A+A L+I++ EKL E +  +G+ L  +L  +  D  I+  VRG GLF  I + K         D  K+ L +LKE  ++      + +I++F PP+C ++   +   D   +++K + D
Sbjct:   40 PVALSKGEGCFVWDVEGKKYFDFLAAYSAVNQGHCHPKLLKVVQEQASTLTLTSRAFYNNVLGEYEEYVTKLFKYDKVLP-MNTGVEACESAVKLARRWAYDVKGVKDNEAVVVFAENNFWGRSIAAISAS-------TDPDSFARFGPFVPG-------FKTVPYN----------NLKAVEDAIKDK--NVAAFMVEPIQGEAGVVLPDPGYLKGVSDLCKKYNVLFITDEVQSGLGRSGKLLAHYHDN---VRPDIVVLGKALSGGFYPVSAVLCDDNVMMNIKPG-EHGSTYGGNPLACKVAIAALEILQEEKLVENSAVMGDLLMSKLKTLPKD--IVSTVRGKGLFCAIVINKKY-------DAWKVCL-KLKENGLLAKNT--HGDIIRFAPPLCINKEQVEQAAD---IIIKTVTD 417          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Match: oatr-1 (Probable ornithine aminotransferase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q18040])

HSP 1 Score: 135.191 bits (339), Expect = 1.005e-34
Identity = 109/424 (25.71%), Postives = 205/424 (48.35%), Query Frame = 3
Query:  189 PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYT------KSKETLVL--EHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            P+ + KG G +++D    +Y D +   + V  GH HP +     +Q S L    R  ++N++   E     L    ++   +N+G EA + A+++AR +       K  E +V+  E+ + G  ++    S          ++   +   VP        ++   Y+          +++ V +++++K  +V  F +E +Q   G V+    Y + +  +  +Y  + I DEVQ+G GR G     +  N   +RPDIV +GK +  G YPV+AV+    +    + G ++ +T+GG+P++C +A+A L+I++ EKL E +  +G+ L  +L  +  D  I+  VRG GLF  I + K         D  K+ L +LKE  ++      + +I++F PP+C ++   +   D   +++K + D
Sbjct:   40 PVALSKGEGCFVWDVEGKKYFDFLAAYSAVNQGHCHPKLLKVVQEQASTLTLTSRAFYNNVLGEYEEYVTKLFKYDKVLP-MNTGVEACESAVKLARRWAYDVKGVKDNEAVVVFAENNFWGRSIAAISAS-------TDPDSFARFGPFVPG-------FKTVPYN----------NLKAVEDAIKDK--NVAAFMVEPIQGEAGVVLPDPGYLKGVSDLCKKYNVLFITDEVQSGLGRSGKLLAHYHDN---VRPDIVVLGKALSGGFYPVSAVLCDDNVMMNIKPG-EHGSTYGGNPLACKVAIAALEILQEEKLVENSAVMGDLLMSKLKTLPKD--IVSTVRGKGLFCAIVINKKY-------DAWKVCL-KLKENGLLAKNT--HGDIIRFAPPLCINKEQVEQAAD---IIIKTVTD 417          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Match: CG8745 (gene:FBgn0036381 transcript:FBtr0075801)

HSP 1 Score: 462.996 bits (1190), Expect = 9.765e-160
Identity = 217/455 (47.69%), Postives = 309/455 (67.91%), Query Frame = 3
Query:   87 LAEESWNVT----YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKE-KQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ 1433
             A E  N+      SK +TI+LR ++IG + Q+F+  DP+KI++G GQYM+DE   RYLDCINNVAHVGH HP +  A   QM+ ++TN R+LHD +V  A  LT+ +P+ L +C+FVNSGSEANDLA+R+AR +TK ++ + L+HAYHG+L S+ ++SPYK N+   E   P + HV P PD Y GK+ D  Y    +  LYA+ + ++C+    KG+ V  F  ES+QSCGGQ++ P  Y++ +   +   GGV IADEVQ GFGRVG+ +WAF+    ++ PDIV + KPMGNG+PV AVVTT +I++AF   G  YFNT+GG+PVSCAIA AV+ ++E E LQ+KA  +G+YL ++   +  +   IGDVRG+GLF+GI+LV+ R+ R P    A   + R+K+  ++++S+DGP DN++K KPPMCF+  +AD  L   R  L  +  E+
Sbjct:    3 FAHEQLNLVASEQLSKTETIKLRNQHIGQACQLFYRSDPLKIVRGQGQYMFDEEGTRYLDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCARTLTSKMPEPLSVCFFVNSGSEANDLALRLARNFTKRQDVITLDHAYHGHLQSVMEVSPYKFNQPGGEAK-PDYVHVAPCPDVYGGKFTDKMYPDADMGALYAQPIEEICQKQLAKGQGVAAFIAESLQSCGGQILPPAGYFQAVYDAVRSAGGVCIADEVQVGFGRVGSHYWAFE--TQNVIPDIVCVAKPMGNGHPVGAVVTTPEIAQAFHATGVAYFNTYGGNPVSCAIANAVMRVIEEEGLQQKALVLGDYLLEECNRLKQEFECIGDVRGAGLFVGIELVQDRKERIPDKKAAHWVVNRMKQLHRVLVSSDGPNDNVIKLKPPMCFNRENADEFLLGFRECLTAVMQER 454          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Match: CG11241 (gene:FBgn0037186 transcript:FBtr0078536)

HSP 1 Score: 283.108 bits (723), Expect = 2.551e-89
Identity = 164/451 (36.36%), Postives = 249/451 (55.21%), Query Frame = 3
Query:  123 EKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKY-----RDNEYSIEK---------LSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVL 1412
            E+ ++ R+ ++  ++   F + P+ I  G  Q++YD    RYLD    +    VGH HP +  A  +Q + L +T   Y+H  I   AERL    P  L+   FVNSGSEANDLAM +AR YT +++ L L + YHG     + +T  S ++         L    HV+  PD Y+G +     RD+     +           D Y  ++ +  +    +GK   MF  ES+Q  GG V FPK Y ++   ++   GG+ +ADEVQTGFGR G  FW F+    D  PDIVTM K +GNG+P+AAVVTT +I+ +  +   +FNT+GG+P++ A+ +AVLD++E E+LQ  +  +G Y  + L  +     IIGDVRG GL +G++LV +R+ R P AT        + K++ +++   G + N+L+ KPPMC +  DA F +D L + +
Sbjct:   59 EQILKTRRNHLTPNLLAHFKK-PLVIHAGHMQWLYDHEGRRYLDMFGGIVTVSVGHCHPKVNQALSEQTAKLWHTTNIYMHPKIHEYAERLVAKFPGDLKSVCFVNSGSEANDLAMLMARLYTGNQDILSLRNCYHGMSPYTMGLTAHSTWRFPLPGVNSGL---VHVM-NPDPYQGIWGGSNCRDSPVQTTRKCQCTVGCQAGDAYYNELEETFKYSLPRGKVAAMF-AESIQGVGGTVQFPKGYLKRAAALVRANGGLFVADEVQTGFGRTGEHFWGFE--SHDYVPDIVTMAKGIGNGFPLAAVVTTPEIAASLSQA-LHFNTYGGNPMASAVGIAVLDVIEEEQLQRNSLEVGTYFLKGLAELQQRFEIIGDVRGKGLMIGVELVGNREKRTPLATPHVLDIWEKCKDQGVLLGRGGLHGNVLRIKPPMCITLADAKFAVDVLALAI 500          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Match: CG11241 (gene:FBgn0037186 transcript:FBtr0347061)

HSP 1 Score: 280.026 bits (715), Expect = 4.769e-88
Identity = 162/452 (35.84%), Postives = 246/452 (54.42%), Query Frame = 3
Query:  123 EKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKY-----RDNEYSIEK---------LSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLK 1415
            E+ ++ R+ ++  ++   F + P+ I  G  Q++YD    RYLD    +    VGH HP +  A  +Q + L +T   Y+H  I   AERL    P  L+   FVNSGSEANDLAM +AR YT +++ L L + YHG     + +T  S ++         L    HV+  PD Y+G +     RD+     +           D Y  ++ +  +    +GK   MF  ES+Q  GG V FPK Y ++   ++   GG+ +ADEVQTGFGR G  FW F+    D  PDIVTM K +GNG+P+AAVVTT +I+ +  +   +FNT+GG+P++ A+ +AVLD++E E+LQ  +  +G Y  + L  +     IIGDVRG GL +G++LV +R+ R P AT        + K++ +++   G + N+L  +PP+C    D +F L+ L    K
Sbjct:   59 EQILKTRRNHLTPNLLAHFKK-PLVIHAGHMQWLYDHEGRRYLDMFGGIVTVSVGHCHPKVNQALSEQTAKLWHTTNIYMHPKIHEYAERLVAKFPGDLKSVCFVNSGSEANDLAMLMARLYTGNQDILSLRNCYHGMSPYTMGLTAHSTWRFPLPGVNSGL---VHVM-NPDPYQGIWGGSNCRDSPVQTTRKCQCTVGCQAGDAYYNELEETFKYSLPRGKVAAMF-AESIQGVGGTVQFPKGYLKRAAALVRANGGLFVADEVQTGFGRTGEHFWGFE--SHDYVPDIVTMAKGIGNGFPLAAVVTTPEIAASLSQA-LHFNTYGGNPMASAVGIAVLDVIEEEQLQRNSLEVGTYFLKGLAELQQRFEIIGDVRGKGLMIGVELVGNREKRTPLATPHVLDIWEKCKDQGVLLGRGGLHGNVLSMRPPLCLCAEDVEFALETLEEAFK 501          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Match: CG11241 (gene:FBgn0037186 transcript:FBtr0113188)

HSP 1 Score: 280.026 bits (715), Expect = 4.769e-88
Identity = 162/452 (35.84%), Postives = 246/452 (54.42%), Query Frame = 3
Query:  123 EKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKY-----RDNEYSIEK---------LSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLK 1415
            E+ ++ R+ ++  ++   F + P+ I  G  Q++YD    RYLD    +    VGH HP +  A  +Q + L +T   Y+H  I   AERL    P  L+   FVNSGSEANDLAM +AR YT +++ L L + YHG     + +T  S ++         L    HV+  PD Y+G +     RD+     +           D Y  ++ +  +    +GK   MF  ES+Q  GG V FPK Y ++   ++   GG+ +ADEVQTGFGR G  FW F+    D  PDIVTM K +GNG+P+AAVVTT +I+ +  +   +FNT+GG+P++ A+ +AVLD++E E+LQ  +  +G Y  + L  +     IIGDVRG GL +G++LV +R+ R P AT        + K++ +++   G + N+L  +PP+C    D +F L+ L    K
Sbjct:   59 EQILKTRRNHLTPNLLAHFKK-PLVIHAGHMQWLYDHEGRRYLDMFGGIVTVSVGHCHPKVNQALSEQTAKLWHTTNIYMHPKIHEYAERLVAKFPGDLKSVCFVNSGSEANDLAMLMARLYTGNQDILSLRNCYHGMSPYTMGLTAHSTWRFPLPGVNSGL---VHVM-NPDPYQGIWGGSNCRDSPVQTTRKCQCTVGCQAGDAYYNELEETFKYSLPRGKVAAMF-AESIQGVGGTVQFPKGYLKRAAALVRANGGLFVADEVQTGFGRTGEHFWGFE--SHDYVPDIVTMAKGIGNGFPLAAVVTTPEIAASLSQA-LHFNTYGGNPMASAVGIAVLDVIEEEQLQRNSLEVGTYFLKGLAELQQRFEIIGDVRGKGLMIGVELVGNREKRTPLATPHVLDIWEKCKDQGVLLGRGGLHGNVLSMRPPLCLCAEDVEFALETLEEAFK 501          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Match: Oat (gene:FBgn0022774 transcript:FBtr0074961)

HSP 1 Score: 130.568 bits (327), Expect = 5.644e-33
Identity = 106/416 (25.48%), Postives = 191/416 (45.91%), Query Frame = 3
Query:  189 PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYY--------TKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLR 1403
            P+ + KG G +++D    RY D ++  + V  GH HP I +A   Q S L    R  + +++   E     L    +    +N+G E  + A ++AR +            + +   + + G  LS    S    N  +  E   P          +   +   EY          ++V  + ESL++   +V  F +E +Q   G V+    Y +K+ ++  +Y  + IADEVQTG  R G       ++   ++PDI+ +GK +  G YPV+AV+   ++    + G ++ +T+GG+P+ C +A+A L++++ EKL E A  +G+ L+ +L  +  D  ++  VRG GL   I + +     E           RLKE  ++      + +I++F PP+  +E      +D +R
Sbjct:   53 PVALTKGEGVFVWDVEGKRYFDYLSAYSAVNQGHCHPKIVAALTAQASKLALTSRAFYSDVLGEYEEYVTKL-FGFDKVLPMNTGVEGGETACKLARKWGYLEKKIPANQAKIIFARNNFWGRTLSAVSAS----NDPSSYEGFGP----------FMPGFELIEY----------DNVSALEESLKDP--NVCAFMVEPIQGEAGVVVPSDGYLKKVRELCTKYNVLWIADEVQTGLARTGK---LLAVDYEQVQPDILILGKALSGGMYPVSAVLCNDQVMLCIKPG-EHGSTYGGNPLGCRVAMAALEVLQEEKLAENAFKMGDLLRNELSTLPKD--VVSVVRGKGLLNAIVINQKFDAWE--------VCLRLKENGLLAKPT--HGDIIRFAPPLVINETQMRESIDIIR 425          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase [Source:ZFIN;Acc:ZDB-GENE-051127-33])

HSP 1 Score: 500.745 bits (1288), Expect = 4.258e-175
Identity = 238/441 (53.97%), Postives = 320/441 (72.56%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ 1433
            + K +T+++R+K I  S ++FFS DP+KI++  GQY+YDEN  +YLDCI+NV HVGHSHP IT     QM LLNTN R+LHDNIV  A+RL  TLP  L + YFVNSGSEANDLA+R+AR YT+ ++ +VL+HAYHG+L S+  ISPYK  K   ++    W HV P PD Y G YR++     +    YA+ V+ + E   +KG+ +  F+ ES+ S GGQ+IFP  Y +++ + +HE GGV +ADE+QTGFGRVG+ FWAFQL   D  PDIVTMGKPMGNG+P+A VVTT +I+ AF   G +YFNTFGG+PVSCAI LAVLD++E E L+  A  +G +LKQ L  +     +IGDVRG GLF+G++LVK R++REPAT+EA   +RRLKE +I+MSTDGP+D+++KFKPPMCFS+ DA+ ++  +  +L  ++D Q
Sbjct:    6 FHKNETLQMRKKLIAQSCRLFFSHDPVKIVRARGQYLYDENGTQYLDCISNVQHVGHSHPSITQVAGAQMDLLNTNTRFLHDNIVQYADRLAATLPKKLSVFYFVNSGSEANDLALRLARQYTRHQDVIVLDHAYHGHLTSLIDISPYKFRKLEGQKE---WVHVAPLPDTYHGIYREDH---PEPGQAYADTVKSLIEEAHKKGRKISSFFAESLPSVGGQIIFPTGYCKRVAEYVHEAGGVYVADEIQTGFGRVGSHFWAFQLEGEDFCPDIVTMGKPMGNGHPIACVVTTEEIAGAFTANGVEYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGGHLKQLLLQLQEKHLLIGDVRGVGLFIGMELVKDRESREPATEEAAHLVRRLKEDRIVMSTDGPWDSVIKFKPPMCFSKEDANRVVTCIDQILTELEDVQ 440          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:393421])

HSP 1 Score: 492.271 bits (1266), Expect = 4.764e-171
Identity = 230/439 (52.39%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  111 TYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            T  K+KTI+LR+K++G S ++FF  DPIKI++  GQYMY+E + +YLDCINNVAHVGH HP + SA  +QM LLNTN R+LHD++V  A+RL  TLP+ L +CYFVNSGSEANDLA+R+A  YT  K+ + L++AYHG++ S+  ISPYK ++    E      HV  +PD YRGKYR++       +  YAE+V++V E   +KG  +  F  ES+QSCGGQVI P  Y++K+ + +   GG+ IADEVQ GFGRVG  FW FQL   D  PDIVTMGKP+GNG+P++ V+T+R+I+E+F   G +YFNTFGG+PVSCAI LAVL+++E E LQ  A  +G YL Q L  +     ++GDVRG GLF+G++LV+++  R PAT EA+  + RLKE++I++S DGP+ N+LKFKPPMCFS  DA+F ++ +  +L  ++
Sbjct:    5 TLDKQKTIDLRKKHVGPSCKVFFDHDPIKIVRAKGQYMYNEKDEKYLDCINNVAHVGHCHPDVVSAGAKQMELLNTNSRFLHDSLVLYAQRLQATLPEKLSVCYFVNSGSEANDLALRLAWQYTGHKDIITLDNAYHGHVSSLIDISPYKFHQMAGAEP-SQHVHVALSPDTYRGKYREDH---PDPATAYAENVKEVIEEAHKKGHEIAAFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGTHFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVITSREIAESFMSSGMEYFNTFGGNPVSCAIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKKRHPLVGDVRGRGLFVGLELVRNQSKRTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFSREDAEFAVEKIDQILTDLE 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-100])

HSP 1 Score: 281.952 bits (720), Expect = 1.257e-88
Identity = 161/445 (36.18%), Postives = 260/445 (58.43%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGS-SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKY-----RDNEY-SIEKLS---------DLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEA-KLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLL 1391
            SKE+ +++R+      ++++ + + P+ I +G  Q+++D +  RYLD    VA   VGH +P +T A  +Q+  L +T   Y++  I   AE+L + LPD L++ YF NSGSEANDLA+ +AR +T + + + L  +YHG     T ++     K     +L    H    PD +RG +     RD+   +I + S         D+Y +++++V ++       +  F+ E +Q  GG V +PK Y ++  +++ E GG+ IADEVQTGFGR G+ FW F+    ++ PD+VTM K + NG P+ AVVTT +I+ +F +G  +FNTFGG+P++CAIA +VLD ++ +K+QE +  +G YL  +L  + +   IIGDVRG GL +G+++VK + +R P   EA        K+  +++   G Y    + KPPMC ++ DADF L
Sbjct:   66 SKERLLDIRKHNCNPMTMKVTYYKKPVFINQGHMQWLWDVDGRRYLDLFAGVATVSVGHCNPKVTEAAEKQLRRLWHTTPIYVYPQIQEYAEKLVSLLPDPLKVVYFTNSGSEANDLAVLMARLHTGNFDVITLRGSYHGGSPQATGLTSNTHYKYPVPSSL--GCHNTMCPDVFRGLWGGSHCRDSPVQTIRECSCSPGHCHANDMYIKELKEVFDTTVPS--RIAAFFTEPIQGVGGAVQYPKNYLKETYQLVREKGGICIADEVQTGFGRTGSHFWGFE--GHNVIPDMVTMAKGIANGIPMGAVVTTAEIARSFAKG-VHFNTFGGNPLACAIASSVLDTIKEDKMQENSAELGTYLLTELAKLRDKYEIIGDVRGKGLQIGVEMVKDKASRTPLPQEAMNEIFEDTKDMGVLIGKGGLYGQTFRIKPPMCITKADADFFL 503          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Match: oat (ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GENE-110411-148])

HSP 1 Score: 125.176 bits (313), Expect = 7.141e-31
Identity = 106/423 (25.06%), Postives = 189/423 (44.68%), Query Frame = 3
Query:  159 SSVQIFFSED----------PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHA----YHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSEND 1376
            +S ++F  ED          P+ + +G G +M+D    RY D ++  + V  GH HP I +A   Q S L    R  +++I+   E+    L    +    +N+G E  + A ++AR +  S + +    A      GN    T  +       +  +   P+      P      Y D     + L D +                 V  F +E +Q   G V+    Y +K+ ++  +Y  + IADEVQTG  R G       ++   +RPD+V +GK +  G YPV+AV+   ++    + G ++ +T+GG+P++C +A+A L+++E E L   A  +G  L+ +L  +  +  I+  VRG GL   I + +++       D  ++ LR      +   T G   +I++  PP+  +E +
Sbjct:   44 TSEEVFAREDRYGAHNYHPLPVALERGEGVHMWDVEGRRYFDFLSAYSAVNQGHCHPKIIAALTAQASRLTLTSRAFYNDILGAYEQYITGL-FGYDKVLPMNTGVEGGETACKLARKWAYSVKGIPKYEAKIVFAAGNFWGRTMAAISSSTDPSSYDGFGPF-----MPGFELVPYNDIPALEKALQDPH-----------------VAAFMVEPIQGEAGVVVPDAGYLQKVRELCTKYNVLFIADEVQTGLCRTGRRL---AVDHEAVRPDLVILGKALSGGVYPVSAVLCDDEVMLTIKPG-EHGSTYGGNPLACRVAIAALEVLEEENLAANAERMGQILRAELNKLPRE--IVSGVRGKGLLNAIIIKETKD-----YDAWQVCLRLRDNGLLAKPTHG---DIIRLAPPLTINEQE 429          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Match: oat (ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GENE-110411-148])

HSP 1 Score: 122.479 bits (306), Expect = 5.241e-30
Identity = 100/397 (25.19%), Postives = 180/397 (45.34%), Query Frame = 3
Query:  159 SSVQIFFSED----------PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHA----YHGNLLSMTQISPYKLNKKNCEETLPPWA---HVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRL 1289
            +S ++F  ED          P+ + +G G +M+D    RY D ++  + V  GH HP I +A   Q S L    R  +++I+   E+    L    +    +N+G E  + A ++AR +  S + +    A      GN    T  +       +  +   P+     +VP        Y D     + L D +                 V  F +E +Q   G V+    Y +K+ ++  +Y  + IADEVQTG  R G       ++   +RPD+V +GK +  G YPV+AV+   ++    + G ++ +T+GG+P++C +A+A L+++E E L   A  +G  L+ +L  +  +  I+  VRG GL   I + +++  ++ +T    L  + +
Sbjct:   44 TSEEVFAREDRYGAHNYHPLPVALERGEGVHMWDVEGRRYFDFLSAYSAVNQGHCHPKIIAALTAQASRLTLTSRAFYNDILGAYEQYITGL-FGYDKVLPMNTGVEGGETACKLARKWAYSVKGIPKYEAKIVFAAGNFWGRTMAAISSSTDPSSYDGFGPFMPGFELVP--------YNDIPALEKALQDPH-----------------VAAFMVEPIQGEAGVVVPDAGYLQKVRELCTKYNVLFIADEVQTGLCRTGRRL---AVDHEAVRPDLVILGKALSGGVYPVSAVLCDDEVMLTIKPG-EHGSTYGGNPLACRVAIAALEVLEEENLAANAERMGQILRAELNKLPRE--IVSGVRGKGLLNAIIIKETKGQKQSSTKPPTLNFKSV 408          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Match: mycl (MYCL proto-oncogene, bHLH transcription factor [Source:Xenbase;Acc:XB-GENE-6453835])

HSP 1 Score: 507.679 bits (1306), Expect = 6.525e-177
Identity = 236/430 (54.88%), Postives = 319/430 (74.19%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNL 1400
            Y KEK IE+R+K+IG S ++FF+ DPIKI++  GQYM+DE   +YLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE LT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L++AYHG++ S+  ISPYK  +   ++    + HV P+PD YRGKYR+ +++   L+  YA+DV  + + + +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI++ E L+  A  +GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D +
Sbjct:    6 YCKEKIIEMRKKHIGPSCKVFFANDPIKIVRAKGQYMFDEKGEKYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTATLPEKLSVCYFVNSGSEANDLALRLARQYSGHQDVITLDNAYHGHVTSLIDISPYKFQQLG-KDAQKEFVHVAPSPDTYRGKYRE-DHTDPALA--YAKDVEDIIKEVHKNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIKKEDLRGNATRVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLLRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFTKEDAKLVVDEI 431          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Match: mycl (MYCL proto-oncogene, bHLH transcription factor [Source:Xenbase;Acc:XB-GENE-6453835])

HSP 1 Score: 507.679 bits (1306), Expect = 9.238e-177
Identity = 236/430 (54.88%), Postives = 319/430 (74.19%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNL 1400
            Y KEK IE+R+K+IG S ++FF+ DPIKI++  GQYM+DE   +YLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE LT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L++AYHG++ S+  ISPYK  +   ++    + HV P+PD YRGKYR+ +++   L+  YA+DV  + + + +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI++ E L+  A  +GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D +
Sbjct:    6 YCKEKIIEMRKKHIGPSCKVFFANDPIKIVRAKGQYMFDEKGEKYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTATLPEKLSVCYFVNSGSEANDLALRLARQYSGHQDVITLDNAYHGHVTSLIDISPYKFQQLG-KDAQKEFVHVAPSPDTYRGKYRE-DHTDPALA--YAKDVEDIIKEVHKNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIKKEDLRGNATRVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLLRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFTKEDAKLVVDEI 431          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Match: mycl (MYCL proto-oncogene, bHLH transcription factor [Source:Xenbase;Acc:XB-GENE-6453835])

HSP 1 Score: 490.73 bits (1262), Expect = 8.426e-171
Identity = 228/424 (53.77%), Postives = 311/424 (73.35%), Query Frame = 3
Query:  132 IELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNL 1400
            + +R   +G S ++FF+ DPIKI++  GQYM+DE   +YLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE LT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L++AYHG++ S+  ISPYK  +   ++    + HV P+PD YRGKYR+ +++   L+  YA+DV  + + + +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI++ E L+  A  +GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D +
Sbjct:    6 LNIRNWILGPSCKVFFANDPIKIVRAKGQYMFDEKGEKYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTATLPEKLSVCYFVNSGSEANDLALRLARQYSGHQDVITLDNAYHGHVTSLIDISPYKFQQLG-KDAQKEFVHVAPSPDTYRGKYRE-DHTDPALA--YAKDVEDIIKEVHKNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIKKEDLRGNATRVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLLRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFTKEDAKLVVDEI 425          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Match: mycl (MYCL proto-oncogene, bHLH transcription factor [Source:Xenbase;Acc:XB-GENE-6453835])

HSP 1 Score: 486.878 bits (1252), Expect = 2.558e-169
Identity = 230/428 (53.74%), Postives = 312/428 (72.90%), Query Frame = 3
Query:  162 SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDN----LRVVLKGIQDE 1430
            S ++FF+ DPIKI++  GQYM+DE   +YLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE LT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L++AYHG++ S+  ISPYK  +   ++    + HV P+PD YRGKYR+ +++   L+  YA+DV  + + + +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI++ E L+  A  +GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D     L V+ K I+ +
Sbjct:   17 SCKVFFANDPIKIVRAKGQYMFDEKGEKYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTATLPEKLSVCYFVNSGSEANDLALRLARQYSGHQDVITLDNAYHGHVTSLIDISPYKFQQLG-KDAQKEFVHVAPSPDTYRGKYRE-DHTDPALA--YAKDVEDIIKEVHKNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIKKEDLRGNATRVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLLRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFTKEDAKLVVDEIDKCLTVLEKAIEGQ 440          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Match: mycl (MYCL proto-oncogene, bHLH transcription factor [Source:Xenbase;Acc:XB-GENE-6453835])

HSP 1 Score: 486.108 bits (1250), Expect = 3.708e-169
Identity = 225/411 (54.74%), Postives = 304/411 (73.97%), Query Frame = 3
Query:  171 IFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNL 1400
            +FF+ DPIKI++  GQYM+DE   +YLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE LT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L++AYHG++ S+  ISPYK  +   ++    + HV P+PD YRGKYR+ +++   L+  YA+DV  + + + +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI++ E L+  A  +GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D +
Sbjct:    8 LFFANDPIKIVRAKGQYMFDEKGEKYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLTATLPEKLSVCYFVNSGSEANDLALRLARQYSGHQDVITLDNAYHGHVTSLIDISPYKFQQLG-KDAQKEFVHVAPSPDTYRGKYRE-DHTDPALA--YAKDVEDIIKEVHKNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIKKEDLRGNATRVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLLRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFTKEDAKLVVDEI 414          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Match: Etnppl (ethanolamine phosphate phospholyase [Source:MGI Symbol;Acc:MGI:1919010])

HSP 1 Score: 513.457 bits (1321), Expect = 2.302e-179
Identity = 238/439 (54.21%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK+ T+ LR+++IG S +IFF+ DPIKI++  GQYM+DE   RYLDCINNVAHVGH HP +  A  +QM LLNTN R+LHDNI+  A+RLT TLP  L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++      HV P PD YRGKYR++    E  S  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + IH+ GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+P++ VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLD++E E LQ  A  +G YL + L        +IGD+RG GLF+GIDLVK R+ R PAT EA+  +  +K K +++S DGP+ N+LK KPPMCF+E+DA FL+D+L  +L  +++
Sbjct:    5 YSKQDTLALRERHIGPSCKIFFAADPIKIMRAQGQYMFDEKGERYLDCINNVAHVGHCHPEVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKRETVHVAPAPDTYRGKYREDH---EDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMGNGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Match: Etnppl (ethanolamine phosphate phospholyase [Source:MGI Symbol;Acc:MGI:1919010])

HSP 1 Score: 513.457 bits (1321), Expect = 2.302e-179
Identity = 238/439 (54.21%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK+ T+ LR+++IG S +IFF+ DPIKI++  GQYM+DE   RYLDCINNVAHVGH HP +  A  +QM LLNTN R+LHDNI+  A+RLT TLP  L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++      HV P PD YRGKYR++    E  S  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + IH+ GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+P++ VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLD++E E LQ  A  +G YL + L        +IGD+RG GLF+GIDLVK R+ R PAT EA+  +  +K K +++S DGP+ N+LK KPPMCF+E+DA FL+D+L  +L  +++
Sbjct:    5 YSKQDTLALRERHIGPSCKIFFAADPIKIMRAQGQYMFDEKGERYLDCINNVAHVGHCHPEVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKRETVHVAPAPDTYRGKYREDH---EDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMGNGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Match: Etnppl (ethanolamine phosphate phospholyase [Source:MGI Symbol;Acc:MGI:1919010])

HSP 1 Score: 494.967 bits (1273), Expect = 4.067e-172
Identity = 233/439 (53.08%), Postives = 311/439 (70.84%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRR-GPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK+ T+ LR+++IG S +IFF+ DPIKI++  GQYM+DE   RYLDCINNVAH       +  A  +QM LLNTN R+LHDNI+  A+RLT TLP  L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++      HV P PD YRGKYR++    E  S  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + IH+ GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+P++ VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLD++E E LQ  A  +G YL + L        +IGD+RG GLF+GIDLVK R+ R PAT EA+  +  +K K +++S DGP+ N+LK KPPMCF+E+DA FL+D+L  +L  +++
Sbjct:    5 YSKQDTLALRERHIGPSCKIFFAADPIKIMRAQGQYMFDEKGERYLDCINNVAH------EVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKRETVHVAPAPDTYRGKYREDH---EDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMGNGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEE 432          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Match: Phykpl (5-phosphohydroxy-L-lysine phospholyase [Source:MGI Symbol;Acc:MGI:1920197])

HSP 1 Score: 480.33 bits (1235), Expect = 1.093e-166
Identity = 223/441 (50.57%), Postives = 308/441 (69.84%), Query Frame = 3
Query:  111 TYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDE 1430
            T +K  T++LR++ + SS ++FF EDP+KII+G GQY+YDE    YLDCINNVAHVGH HP +  A  +Q  +LNTN RYLHDNIV  A+RL+ TLP+ L + YF+NSGSEANDLA+R+AR YT  ++ +VL+HAYHG+L S+  ISPYK      ++    W HV P PD YRG YR++       ++ YA +V+ V  S ++KG+ +  F+ ES+ S  GQ+I P  Y+ ++ + IH  GG+ +ADE+Q GFGR+G  FWAFQL   D  PDIVTMGK +GNG+PVA + TT+ +S AF   G +YFNTFGG+PVSCA+ LAVLD+++ E+LQ  A  +G++L + L        IIGDVRG+GLF+G+DL+K    R PAT+EA+  + RLKE  I++S DGP  NILKFKPPMCF+ ++A  ++  L  +L  ++++
Sbjct:    5 TRAKAVTLDLRRRLLSSSCRLFFPEDPVKIIRGQGQYLYDEQGREYLDCINNVAHVGHCHPTVVQAAHEQNLVLNTNSRYLHDNIVDYAQRLSETLPEQLSVFYFLNSGSEANDLALRLARQYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLGGQKE---WVHVAPLPDTYRGPYREDH---PNPAEAYANEVKHVISSAQQKGRKIAAFFAESLPSVSGQIIPPAGYFSQVAEHIHRAGGLFVADEIQVGFGRIGKHFWAFQLEGEDFVPDIVTMGKSIGNGHPVACMATTQAVSRAFEATGVEYFNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLLEHLTQQKAKHPIIGDVRGTGLFIGVDLIKDETLRTPATEEAEYLVSRLKENYILLSIDGPGKNILKFKPPMCFNVDNAQHVVAKLDDILTDMEEK 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Match: Phykpl (5-phosphohydroxy-L-lysine phospholyase [Source:MGI Symbol;Acc:MGI:1920197])

HSP 1 Score: 479.174 bits (1232), Expect = 3.327e-166
Identity = 223/441 (50.57%), Postives = 308/441 (69.84%), Query Frame = 3
Query:  111 TYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDE 1430
            T +K  T++LR++ + SS ++FF EDP+KII+G GQY+YDE    YLDCINNVAHVGH HP +  A  +Q  +LNTN RYLHDNIV  A+RL+ TLP+ L + YF+NSGSEANDLA+R+AR YT  ++ +VL+HAYHG+L S+  ISPYK      ++    W HV P PD YRG YR++       ++ YA +V+ V  S ++KG+ +  F+ ES+ S  GQ+I P  Y+ ++ + IH  GG+ +ADE+Q GFGR+G  FWAFQL   D  PDIVTMGK +GNG+PVA + TT+ +S AF   G +YFNTFGG+PVSCA+ LAVLD+++ E+LQ  A  +G++L + L        IIGDVRG+GLF+G+DL+K    R PAT+EA+  + RLKE  I++S DGP  NILKFKPPMCF+ ++A  ++  L  +L  ++++
Sbjct:    5 TRAKAVTLDLRRRLLSSSCRLFFPEDPVKIIRGQGQYLYDEQGREYLDCINNVAHVGHCHPTVVQAAHEQNLVLNTNSRYLHDNIVDYAQRLSETLPEQLSVFYFLNSGSEANDLALRLARQYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLGGQKE---WVHVAPLPDTYRGPYREDH---PNPAEAYANEVKHVISSAQQKGRKIAAFFAESLPSVSGQIIPPAGYFSQVAEHIHRAGGLFVADEIQVGFGRIGKHFWAFQLEGEDFVPDIVTMGKSIGNGHPVACMATTQAVSRAFEATGVEYFNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLLEHLTQQKAKHPIIGDVRGTGLFIGVDLIKDETLRTPATEEAEYLVSRLKENYILLSIDGPGKNILKFKPPMCFNVDNAQHVVAKLDDILTDMEEK 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Match: sp|Q8TBG4|AT2L1_HUMAN (Ethanolamine-phosphate phospho-lyase OS=Homo sapiens OX=9606 GN=ETNPPL PE=1 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 2.268e-180
Identity = 239/439 (54.44%), Postives = 319/439 (72.67%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK  T+ LR+K+IG S ++FF+ DPIKI++   QYM+DEN  +YLDCINNVAHVGH HP +  A ++QM LLNTN R+LHDNIV  A+RL+ TLP+ L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV PTPD YRGKYR++       +  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +H  GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+PVA VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLDI+ENE LQ  A+ +GNYL + L        +IGD+RG GLF+GIDLVK    R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F++D L  +L  +++
Sbjct:    5 YSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPTPDTYRGKYREDHADS---ASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Match: sp|Q6DEB1|AT2L1_XENLA (Ethanolamine-phosphate phospho-lyase OS=Xenopus laevis OX=8355 GN=etnppl PE=2 SV=1)

HSP 1 Score: 516.153 bits (1328), Expect = 2.678e-179
Identity = 239/438 (54.57%), Postives = 320/438 (73.06%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            Y+KEK +E+R+K+IG S ++FF+ DPIKI+   GQYM+DE   RYLDCINNVAHVGHSHP +T A ++QM LLNTN R+LHDN+V  AE L +TLP+ L +CYFVNSGSEANDLA+R+AR YT  ++ + L+HAYHG++ S+  ISPYK ++   ++    + HV P+PD YRGKYR++       +  YA+DV  + +   +  + +  F  ESMQSCGGQ+I P  Y++K+ + +H+ GGV IADEVQ GFGRVG  FW+FQL   D  PDIVTMGKP+GNG+P++ VVTT++I+EAF   G +YFNTFGG+PVSCAI LAVLDI+E E L+  A T+GNYL + L        +IGD+RG GLF+G+DLVK R  R PAT EA+  + +LKEK+I++S DGPY N+LKFKPPMCF++ DA  ++D +   L  ++
Sbjct:    5 YTKEKIMEIRKKHIGPSCKVFFANDPIKIVHAKGQYMFDEKGERYLDCINNVAHVGHSHPEVTKAALKQMELLNTNSRFLHDNLVRYAECLISTLPEKLSVCYFVNSGSEANDLALRLARQYTGHQDVITLDHAYHGHVTSLIDISPYKFHQLG-KDAQKEYIHVAPSPDTYRGKYREDH---PDPASAYAKDVEDIIQKAHQNKRQIAAFIAESMQSCGGQIIPPAGYFQKVSEFVHKAGGVFIADEVQVGFGRVGKHFWSFQLQGEDFLPDIVTMGKPIGNGHPMSCVVTTKEIAEAFGATGMEYFNTFGGNPVSCAIGLAVLDIIEKEDLRGNATTVGNYLTELLNEQKQKHPLIGDIRGVGLFVGVDLVKDRLFRTPATAEAQHIIYKLKEKRILLSADGPYRNVLKFKPPMCFNKEDAKLVVDEIDQCLTALE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Match: sp|Q8BWU8|AT2L1_MOUSE (Ethanolamine-phosphate phospho-lyase OS=Mus musculus OX=10090 GN=Etnppl PE=2 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 1.610e-178
Identity = 238/439 (54.21%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK+ T+ LR+++IG S +IFF+ DPIKI++  GQYM+DE   RYLDCINNVAHVGH HP +  A  +QM LLNTN R+LHDNI+  A+RLT TLP  L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++      HV P PD YRGKYR++    E  S  YA++V+K+ E     G+ +  F  ESMQSCGGQ+I P  Y++K+ + IH+ GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+P++ VVTT++I+EAF   G +YFNT+GG+PVSCA+ LAVLD++E E LQ  A  +G YL + L        +IGD+RG GLF+GIDLVK R+ R PAT EA+  +  +K K +++S DGP+ N+LK KPPMCF+E+DA FL+D+L  +L  +++
Sbjct:    5 YSKQDTLALRERHIGPSCKIFFAADPIKIMRAQGQYMFDEKGERYLDCINNVAHVGHCHPEVVKAAAKQMELLNTNSRFLHDNIIEFAKRLTATLPQELSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKRETVHVAPAPDTYRGKYREDH---EDPSTAYADEVKKIIEEAHSSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEHIHKAGGVFIADEVQVGFGRVGRYFWSFQMYGEDFVPDIVTMGKPMGNGHPISCVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDVIEKENLQGNAVRVGTYLMELLSEQKAKHPLIGDIRGVGLFIGIDLVKDREKRTPATAEAQHIIYEMKGKGVLLSADGPHRNVLKIKPPMCFTEDDAKFLVDHLDGILTVLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Match: sp|Q5E9S4|AT2L1_BOVIN (Ethanolamine-phosphate phospho-lyase OS=Bos taurus OX=9913 GN=ETNPPL PE=2 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 1.761e-176
Identity = 233/439 (53.08%), Postives = 317/439 (72.21%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK++T+ LR+K+IG S ++FF+ DPIKI++   QYM+DE   +YLDCINNVAHVGH HP +  A  +QM LLNTN R+LHDNIV  A+RL+ TLPD L +CYF NSGSEANDLA+R+AR +   ++ + L+HAYHG+L S+ +ISPYK  K   ++    + HV P PD YRGKYR++       +  YA++V+K+ +     G+ +  F  ESMQSCGGQ+I P  Y++K+ + +   GGV IADEVQ GFGRVG  FW+FQ+   D  PDIVTMGKPMGNG+P+A VVTT++I+EAF   G +YFNT+GG+PVS A+ LAVLD+++NE LQ  A  +GNYL + L        +IGD+RG GLF+GIDLVK  Q R PAT EA+  + ++KEK++++S DGP+ N+LK KPPMCF+E DA F+++ L  +L G+++
Sbjct:    5 YSKQETLALRRKHIGPSCKVFFAADPIKIVRAQRQYMFDEKGDQYLDCINNVAHVGHCHPEVVKAAQKQMELLNTNSRFLHDNIVEYAKRLSATLPDRLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKG--KDVKKEFVHVAPAPDTYRGKYREDHVDP---ASAYADEVKKIIDEAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVRGAGGVFIADEVQVGFGRVGKHFWSFQMFGEDFVPDIVTMGKPMGNGHPMACVVTTKEIAEAFSASGMEYFNTYGGNPVSSAVGLAVLDVIKNEDLQGNATRVGNYLTELLNKQKTKHTLIGDIRGVGLFIGIDLVKDHQQRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVEQLDGILTGLEE 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Match: sp|Q7SY54|AT2L1_DANRE (Ethanolamine-phosphate phospho-lyase OS=Danio rerio OX=7955 GN=etnppl PE=2 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 3.597e-170
Identity = 230/439 (52.39%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  111 TYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            T  K+KTI+LR+K++G S ++FF  DPIKI++  GQYMY+E + +YLDCINNVAHVGH HP + SA  +QM LLNTN R+LHD++V  A+RL  TLP+ L +CYFVNSGSEANDLA+R+A  YT  K+ + L++AYHG++ S+  ISPYK ++    E      HV  +PD YRGKYR++       +  YAE+V++V E   +KG  +  F  ES+QSCGGQVI P  Y++K+ + +   GG+ IADEVQ GFGRVG  FW FQL   D  PDIVTMGKP+GNG+P++ V+T+R+I+E+F   G +YFNTFGG+PVSCAI LAVL+++E E LQ  A  +G YL Q L  +     ++GDVRG GLF+G++LV+++  R PAT EA+  + RLKE++I++S DGP+ N+LKFKPPMCFS  DA+F ++ +  +L  ++
Sbjct:    5 TLDKQKTIDLRKKHVGPSCKVFFDHDPIKIVRAKGQYMYNEKDEKYLDCINNVAHVGHCHPDVVSAGAKQMELLNTNSRFLHDSLVLYAQRLQATLPEKLSVCYFVNSGSEANDLALRLAWQYTGHKDIITLDNAYHGHVSSLIDISPYKFHQMAGAEP-SQHVHVALSPDTYRGKYREDH---PDPATAYAENVKEVIEEAHKKGHEIAAFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGTHFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVITSREIAESFMSSGMEYFNTFGGNPVSCAIGLAVLNVIEKEDLQGNALHVGGYLTQLLEDLKKRHPLVGDVRGRGLFVGLELVRNQSKRTPATAEAQEVIYRLKEQRILLSADGPHRNVLKFKPPMCFSREDAEFAVEKIDQILTDLE 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Match: A0A267DUR5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028662g1 PE=4 SV=1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 255/452 (56.42%), Postives = 334/452 (73.89%), Query Frame = 3
Query:   69 NADKKCLAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            N+ K    + +W+    K +T  +R KYI SS Q+FF  DP+K+++GS QYMY+++   YLDCINNVAHVGH HP++  A  +QM  L TN RYLHD+IV LAERL +TLP  L +C+FVNSGSEANDLA R+A YYTK+++ + L+HAYHG+++S   ISPYK      EE  P   HVVPTPDRYRGKYRD++ S+ +L+D Y  +V+  C+S+   G+ V  F  ESMQSCGGQVIFP  Y  ++  I+   GGV IADEVQTGFGRVG+ +WAFQL+D  + PDIVT+GKPMGNG+P++AV+TT  I+EAFRRGPDYFNT+GG+PVSCAIALAVLD++E +KL+E A  +G +LK++L  M     ++GDVRG+G+FLGID+V  R+TR+PA   A+  L RL+ + IIMS DGP++NILKFKPPMCFS  +AD L D L  +   ++
Sbjct:   61 NSAKGRKGKCAWDFLRQKHETKSMRDKYIASSCQLFFRRDPLKMVRGSMQYMYEQDGTEYLDCINNVAHVGHCHPHVVQAGFKQMRTLQTNNRYLHDHIVTLAERLCSTLPSQLCVCFFVNSGSEANDLAQRLALYYTKNRDGICLDHAYHGHVMSCIGISPYKFMHGGSEEKKPDHIHVVPTPDRYRGKYRDDQISMSELTDAYVGEVQSACDSVAAAGRGVSFFISESMQSCGGQVIFPPGYLRRVYDIVRRSGGVCIADEVQTGFGRVGSKWWAFQLDDDQLVPDIVTIGKPMGNGHPISAVITTPAIAEAFRRGPDYFNTYGGNPVSCAIALAVLDVIEQDKLRENAVRVGEHLKRRLQEMQPRHPMMGDVRGAGMFLGIDMVLCRRTRQPAGQAAETVLWRLRSEHIIMSLDGPHENILKFKPPMCFSLANADQLCDTLDRIFTEVE 512          
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Match: A0A267G1A5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017311g1 PE=4 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 0.000e+0
Identity = 254/452 (56.19%), Postives = 334/452 (73.89%), Query Frame = 3
Query:   69 NADKKCLAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            N+ K    + +W+    K +T  +R KYI SS Q+FF  DP+K+++GS QYMY+++   YLDCINNVAHVGH HP++  A  +QM  L TN RYLHD+IV LAERL +TLP  L +C+FVNSGSEANDLA R+A YYTK+++ + L+HAYHG+++S   ISPYK      EE  P   HVVPTPDRYRGKYRD++ S+ +L+D Y  +V+  C+S+   G+ V  F  ESMQSCGGQVIFP  Y  ++  I+   GGV IADEVQTGFGRVG+ +WAFQL+D  + PDIVT+GKPMGNG+P++AV+TT  I+EAFRRGPDYFNT+GG+PVSCAIALAVLD++E +KL+E A  +G +LK++L  M     ++GDVRG+G+FLGID+V  R+TR+PA   A+  L RL+ + IIMS DGP++NILKFKPPMCFS  +A+ L D L  +   ++
Sbjct:   61 NSAKGRKGKCAWDFLRQKHETKSMRDKYIASSCQLFFRRDPLKMVRGSMQYMYEQDGTEYLDCINNVAHVGHCHPHVVQAGFKQMRTLQTNNRYLHDHIVTLAERLCSTLPSQLCVCFFVNSGSEANDLAQRLALYYTKNRDGICLDHAYHGHVMSCIGISPYKFMHGGSEEKKPDHIHVVPTPDRYRGKYRDDQMSMSELTDAYVGEVQSACDSVAAAGRGVSFFISESMQSCGGQVIFPPGYLRRVYDIVRRSGGVCIADEVQTGFGRVGSKWWAFQLDDDQLVPDIVTIGKPMGNGHPISAVITTPAIAEAFRRGPDYFNTYGGNPVSCAIALAVLDVIEQDKLRENAVRVGEHLKRRLQEMQPRHPMMGDVRGAGMFLGIDMVLCRRTRQPAGQAAETVLWRLRSEHIIMSLDGPHENILKFKPPMCFSLANANQLCDTLDRIFTEVE 512          
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Match: A0A1S3H3Y7 (5-phosphohydroxy-L-lysine phospho-lyase-like OS=Lingula unguis OX=7574 GN=LOC106151457 PE=3 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 247/438 (56.39%), Postives = 329/438 (75.11%), Query Frame = 3
Query:  120 KEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDE 1430
            KE+TIELR+++IG S ++FF   P+KI++ +GQYMYDEN  RYLDCINNVAHVGH HP +  A  +QM++LNTN R+LHDNIVHLAERLT T+P  L +CY VNSGSEANDLA+R+A+ +TK  + +V++HAYHG+L+S+  ISPYK N    E  +  W HV P PD YRGKY D  +  E +  LYA +V+ + +   ++G+ +  F+ ES+QSCGGQ+I P  Y   + K +HE GG+ +ADEVQ GFGRVG+ +WAFQL   DI PDIVTMGKPMGNG+PVAAV+TT++++++F   G +YFNT+GG+PVSCAIA AV+D++E E L + AR +GNYL+ +L  +     IIGDVRG GLF+G+DLVKSR+TREPAT EA+  + RLKE  I++S+DGPY N+LKFKPPM FS+ D DF++  L  V   ++D+
Sbjct:   42 KEETIELRRRHIGESCKLFFKTSPLKILRAAGQYMYDENGTRYLDCINNVAHVGHCHPDVVKAGTEQMAVLNTNSRFLHDNIVHLAERLTKTMPSKLSVCYLVNSGSEANDLALRLAKAHTKGTDVIVMDHAYHGHLVSLIDISPYKFNMPGGEGKM-DWVHVAPCPDVYRGKYTDKTHPGEDMGLLYANEVKALIDGAHKQGRKISAFFAESLQSCGGQIILPPNYLRNVYKYVHEAGGICVADEVQVGFGRVGDPYWAFQLQGDDIVPDIVTMGKPMGNGHPVAAVLTTKEVAQSFTDTGIEYFNTYGGNPVSCAIASAVMDVIEKEGLVQHAREVGNYLQDRLGELQKKHQIIGDVRGVGLFVGVDLVKSRETREPATSEAQHVIYRLKESHILLSSDGPYRNVLKFKPPMVFSKEDVDFVIKCLDSVFSEMEDD 478          
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Match: A0A402E8N6 (Uncharacterized protein (Fragment) OS=Paroedura picta OX=143630 GN=parPi_0000822 PE=3 SV=1)

HSP 1 Score: 531.561 bits (1368), Expect = 0.000e+0
Identity = 247/439 (56.26%), Postives = 327/439 (74.49%), Query Frame = 3
Query:  114 YSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            YSK +T+ELR+K+IG S ++FF++DPIKI+   GQYM++EN  +YLDCINNVAHVGHSHP +T A V QM LLNTN R+LHDN+V  A+RLT TLP+ L +CYFVNSGSEANDLA+R+AR Y+  ++ + L+HAYHG++ S+  ISPYK N+   +E    + HV P+PD YRGKYR++    +  +  YA+DV+K+ E  ++ G+ +  F  ESMQSCGGQVI P  Y++++ + +H+ GGV IADEVQ GFGRVG  FW FQL   D  PDIVTMGKP+GNG+P++ VVTTR I+EAF   G +YFNTFGG+PVSCAI LAVLDI+E E L+  A  +GNYL   L        ++GDVRG GLF+G+DLVK RQ R PAT EA+  + +LKE++I++S DGP+ NILKFKPPMCFS+ DA F++D +  +L  +++
Sbjct:   34 YSKAETVELRKKHIGPSCKVFFAKDPIKILSARGQYMFNENGEKYLDCINNVAHVGHSHPQVTKAAVAQMELLNTNSRFLHDNLVEYAKRLTATLPEELSVCYFVNSGSEANDLALRLARQYSGHQDVITLDHAYHGHVTSLIDISPYKFNQLG-KEGKKEFIHVAPSPDIYRGKYREDH---QDPASAYADDVKKIIEEAQKNGRKIAAFIAESMQSCGGQVIPPAGYFQQVAETVHKAGGVFIADEVQVGFGRVGKHFWGFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTRPIAEAFGASGLEYFNTFGGNPVSCAIGLAVLDIIEKEDLRRNATDVGNYLTGLLQEQKEKHPLVGDVRGVGLFIGVDLVKDRQKRTPATAEAQHIIYKLKERKILLSADGPHRNILKFKPPMCFSKEDAKFVVDQIDELLTDLEE 468          
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Match: A0A210QVE4 (Alanine--glyoxylate aminotransferase 2-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06302 PE=3 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 243/435 (55.86%), Postives = 330/435 (75.86%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHV--VPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVL 1412
            +KE+T++LR +++G + ++FF+ DP+KI++ SGQYMYDE   +YLDCINNV HVGH HP +  A  +QM +LNTN RYLHD +V LA+RLT T+P  L + YFVNSGSEANDLA+R+A+++T+  E L L+HAYHG+++S  ++SPYKL ++  +++ PP  HV  V  PD YRGKYRD +Y  + +  LYA DVR V   +++ GK+V  F  ESMQSCGGQ+I P+ Y + + K + E GGV IADEVQ GFGRVG+ FWAFQ     + PDIVT+GKPMGNG+PVAAVVTT+ IS++FR  G +YFNT+GG+PVSC+IA+AVLD++E E L++ A  +G Y K ++  +M+  +IIG VRG GLFLGIDLVK R+TREPAT+EA   + R+KE+ I++STDGPY N++K KPPMCFS+N+ D  ++ L V+L
Sbjct:    5 AKEETLQLRNRHVGGACKLFFASDPLKIVRASGQYMYDEQGQQYLDCINNVCHVGHCHPDVVEAGYKQMQVLNTNSRYLHDTLVLLAKRLTETMPGKLSVVYFVNSGSEANDLAIRLAKHHTRGTEMLTLDHAYHGHVVSALEVSPYKL-RQQVDDSHPPPDHVHWVSCPDVYRGKYRDRDYPGQDIGQLYANDVRDVIHKIKQDGKNVSFFIAESMQSCGGQIILPQGYLQSVYKYVREAGGVCIADEVQVGFGRVGSHFWAFQ--PQGVEPDIVTLGKPMGNGHPVAAVVTTQAISDSFRDSGMEYFNTYGGNPVSCSIAMAVLDVIEKEHLRQNALDVGQYWKAKVTELMSQFDIIGQVRGQGLFLGIDLVKDRETREPATEEANTVITRMKEEHILLSTDGPYSNVIKTKPPMCFSKNNVDHFMEKLTVIL 436          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:103024688])

HSP 1 Score: 507.294 bits (1305), Expect = 3.484e-177
Identity = 235/439 (53.53%), Postives = 316/439 (71.98%), Query Frame = 3
Query:  111 TYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
             + K+KTIELR+K+IG S ++FF  DPIKI++  GQYMY+E + +YLDCINNVAHVGHSHP +  A  +QM LLNTN R+LHDN+V  A+RL  TLP+ L +CYFVNSGSEANDLA+R+A  YT  ++ + L++AYHG++ S+  ISPYK ++           HV P+PD YRGKYR++       +  YA+DV+ + E    KG  + +F  ES+QSCGGQVI P  Y++K+ + + E GG+ IADEVQ GFGRVG+ FWAFQL   D  PDIVTMGKP+GNG+P++ VVTTR+++E F   G +YFNTFGG+PVSCAI LAVLD++E E LQ  A  +G YL   L  +     +IGD+RG GLF+G++LVK+R  R PATDEA+  + RLK+++I++S DGP+ N+LKFKPPMCF+  DAD  +D +  +L  ++
Sbjct:    5 VFKKQKTIELRKKHIGPSCKVFFGHDPIKIVRARGQYMYNEKDEQYLDCINNVAHVGHSHPDVVRAGAKQMELLNTNSRFLHDNLVQYAQRLQATLPEKLSVCYFVNSGSEANDLALRLAWQYTGHRDIITLDNAYHGHVSSLIDISPYKFHQL-AHPQQSQHVHVAPSPDIYRGKYREDH---PDPATAYADDVKDIIEKAHAKGHKIAVFIAESLQSCGGQVIPPVGYFQKVAQHVREAGGLFIADEVQVGFGRVGSHFWAFQLQGEDFVPDIVTMGKPIGNGHPISCVVTTREVAEGFMSSGMEYFNTFGGNPVSCAIGLAVLDVIEKEALQSNALRVGGYLTDLLEKLKQKHPLIGDIRGRGLFVGVELVKNRIERTPATDEAQTVIYRLKDQRILLSADGPHRNVLKFKPPMCFTTEDADLAVDKIDQILTDLE 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase-like [Source:NCBI gene;Acc:103047782])

HSP 1 Score: 501.901 bits (1291), Expect = 1.270e-175
Identity = 237/448 (52.90%), Postives = 320/448 (71.43%), Query Frame = 3
Query:   87 LAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            +AEE     + K++T+ +R++ IG S ++FFS+DP+KI++  GQY+YDEN ++YLDCI+NV HVGH HP +T A   QM LLN N R+LHDNIV  A+RL  TLP  L + YFVNSGSEANDLA+R+AR YT +K+ +VL+HAYHG+L S+  ISPYK  K   ++    W HV P  D YRG YR +       +  YA+ V+ + + +  KG+ +  F++ES+ S GGQ+IFP+ Y+ K+ + +   GGV +ADE+QTGFGRVG+ +WAFQL   D  PDIVTMGKPMGNG+P+A VVTT +I+ AF   G +YFNTFGG+PVSCAI LAVLD++E E L+  A  +GN+LK  L  +     IIGDVRG+GLF+G +LVK R    PAT+EA L +RR+KEK I +STDGP++N++KFKPPMCF   DA+ + + + +VL+ IQD
Sbjct:    1 MAEE----MFQKDETLRMRKRLIGQSCRLFFSDDPVKIVRARGQYLYDENGVQYLDCISNVQHVGHCHPAVTQAAAAQMDLLNANTRFLHDNIVRYADRLAATLPKKLSVFYFVNSGSEANDLALRLARQYTGNKDVIVLDHAYHGHLSSLIDISPYKFRKLEGQKD---WVHVAPLADTYRGLYRHDH---PDPAQAYADTVKNLIDDMHSKGRKISSFFVESLPSVGGQIIFPRGYFTKVAEYVRAAGGVFVADEIQTGFGRVGSHYWAFQLQGEDFCPDIVTMGKPMGNGHPLACVVTTEEIAGAFTANGVEYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGNHLKDLLKQLQIKHPIIGDVRGAGLFVGFELVKDRVDLTPATEEAALLIRRMKEKYICLSTDGPWENVVKFKPPMCFRMEDAERVTEEIDLVLREIQD 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase-like [Source:NCBI gene;Acc:103047782])

HSP 1 Score: 453.366 bits (1165), Expect = 5.259e-157
Identity = 221/448 (49.33%), Postives = 298/448 (66.52%), Query Frame = 3
Query:   87 LAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            +AEE     + K++T+ +R++ IG S ++FFS+DP+KI++  GQY+YDEN ++YLDCI+NV HVGH HP +T A   QM LLN N R+LHDNIV  A+RL  TLP  L + YFVNSG                         AYHG+L S+  ISPYK  K   ++    W HV P  D YRG YR +       +  YA+ V+ + + +  KG+ +  F++ES+ S GGQ+IFP+ Y+ K+ + +   GGV +ADE+QTGFGRVG+ +WAFQL   D  PDIVTMGKPMGNG+P+A VVTT +I+ AF   G +YFNTFGG+PVSCAI LAVLD++E E L+  A  +GN+LK  L  +     IIGDVRG+GLF+G +LVK R    PAT+EA L +RR+KEK I +STDGP++N++KFKPPMCF   DA+ + + + +VL+ IQD
Sbjct:    1 MAEE----MFQKDETLRMRKRLIGQSCRLFFSDDPVKIVRARGQYLYDENGVQYLDCISNVQHVGHCHPAVTQAAAAQMDLLNANTRFLHDNIVRYADRLAATLPKKLSVFYFVNSG-------------------------AYHGHLSSLIDISPYKFRKLEGQKD---WVHVAPLADTYRGLYRHDH---PDPAQAYADTVKNLIDDMHSKGRKISSFFVESLPSVGGQIIFPRGYFTKVAEYVRAAGGVFVADEIQTGFGRVGSHYWAFQLQGEDFCPDIVTMGKPMGNGHPLACVVTTEEIAGAFTANGVEYFNTFGGNPVSCAIGLAVLDVIEKEDLRGNAVRVGNHLKDLLKQLQIKHPIIGDVRGAGLFVGFELVKDRVDLTPATEEAALLIRRMKEKYICLSTDGPWENVVKFKPPMCFRMEDAERVTEEIDLVLREIQD 413          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:ZFIN;Acc:ZDB-GENE-050913-100])

HSP 1 Score: 292.738 bits (748), Expect = 1.135e-92
Identity = 161/449 (35.86%), Postives = 258/449 (57.46%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGS-SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYK---LNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDL--------YAEDVRKVCESLREKGKS-----VGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLAL-RRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLL 1391
            SK++ +E+R++     ++++ + ++P+ I +G  Q+++D +  RYLD    VA   VGH +P +T A V+Q+  L +T   Y+H  I   AE+L + LP+ L++ Y  NSGSEANDLAM +AR +T + + + L  +YHG     + +T  + YK    +   C  T+         PD +RG +  N+     +  +        + +   +  E ++E   +     +  F+ E +Q  GG V +PK + +   K++ E GG+ IADEVQTGFGR G+ FW FQ +D  + PDIVTM K +GNG+P+ AVVTT +I+ +F +G  +FNTFGG+PV+CAI  +VLD +  + LQE    +G YL  +L  + +   I+GDVRG GL +G+++V  + +R P   EA   +   +K+  +++ T G Y    + KPPMC ++ D DF L
Sbjct:   92 SKQRLLEIRKQICNPMTMKVTYYKEPVFIHQGHMQWLWDMDGKRYLDLFAGVATVSVGHCNPRVTEAAVKQLEHLWHTTAIYIHPQIQEYAEKLASLLPEPLKVVYLTNSGSEANDLAMLMARVHTGNHDVITLRGSYHGGSPLAIGLTSNAAYKYPVASGFGCHNTM--------CPDVFRGVWGGNQCRDSPVQTIRECSCSPGHCQANGRYIEQMKEMFATTVPNRIAAFFGEPIQGVGGAVQYPKSFLKDTYKLVREKGGICIADEVQTGFGRTGSHFWGFQAHD--VMPDIVTMAKGIGNGFPMGAVVTTEEIAGSFAKGV-HFNTFGGNPVACAIGSSVLDTIAEDGLQENCAVVGTYLLTELAKLRDKHEIVGDVRGKGLMIGVEMVTDKVSRVPLPKEAMAEIFEDVKDMGVLIGTGGLYGQTFRIKPPMCITKEDVDFFL 529          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Match: oat (ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GENE-110411-148])

HSP 1 Score: 127.102 bits (318), Expect = 1.970e-31
Identity = 104/407 (25.55%), Postives = 187/407 (45.95%), Query Frame = 3
Query:  189 PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAER-LTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHA----YHGNLLSMTQISPYKLNKKNCEETLPPWA---HVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSEND 1376
            P+ + +G G YM+D    RY D ++  + V  GH HP I +A   Q S L    R  +++++   E  +TN      +    +N+G E  + A ++AR +  + + +    A      GN    T  +       +  +   P+     +VP        Y D     + L D                  +V  F +E +Q   G ++    Y  K+ ++  ++  + IADEVQTG  R G       ++   +RPD+V +GK +  G YPV+AV+   ++    + G ++ +TFGG+P++C++A+A L ++E EKL E A  +G  L+ +L  +  +  I+  VRG GL   I + +++       D  ++ LR      +   T G   +I++  PP+  +E++
Sbjct:   64 PVALERGEGIYMWDVEGRRYYDFLSAYSAVNQGHCHPKIIAALNAQASKLTLTSRAFYNDMLGAYEEYITNLF--GYDKVLPMNTGVEGGETACKLARKWAYTVKGVPKYQAKIIFAEGNFWGRTMAAISSSTDPSSYDGFGPFMPGFELVP--------YNDLSALEKALQD-----------------PNVAAFMVEPIQGEAGVMVPDPGYLTKVRELCTKHNVLFIADEVQTGLARTGRRL---AVDHEAVRPDLVVLGKALSGGVYPVSAVLCDDEVMLTIKPG-EHGSTFGGNPLACSVAMAALQVLEEEKLAENAEKMGQILRSELNKLPKE--IVTTVRGKGLLNAIVIKETKD-----YDAWRVCLRLRDNGLLAKPTHG---DIIRLAPPLVINEDE 429          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Sea Lamprey
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:393421])

HSP 1 Score: 491.5 bits (1264), Expect = 4.128e-172
Identity = 226/420 (53.81%), Postives = 307/420 (73.10%), Query Frame = 3
Query:  162 SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKG 1418
            S ++FFS DP+KI++  GQYMY+E + RYLDCINNVAHVGH HP +  A  +QM LLNTN R+LHD++V  A+RLT+TLP+ L +CYFVNSGSEANDLA+R+AR +T  ++ + L+HAYHG++ S+  ISPYK N+    +    W HV  +PD YRGKYR++          YA DV+++ E   +KG+ +  F  ESMQSCGGQ+I P  Y++++   +   GG+ IADEVQ GFGRVG+ FWAFQL   D  PDIVTMGKP+GNG+P++ VVTTR+++++FR  G +YFNTFGG+PVSCAIAL+VLDI+E E ++E A + G YL + L  +     IIGD+RG GLF+G+DLVK R++R  AT EA+  + RLKE+ +++S DGPY N+LKFKPPMCF+ +DA F ++ +  +L G
Sbjct:   24 SCKLFFSSDPLKIVRAQGQYMYNEKDERYLDCINNVAHVGHCHPDVVQAAHKQMLLLNTNSRFLHDHMVCYAKRLTDTLPEKLSVCYFVNSGSEANDLALRLARQHTGHEDVITLDHAYHGHVTSLIDISPYKFNRMG-PDAKKEWVHVASSPDTYRGKYRED---TADPGTAYANDVKEMLEQAHKKGRKIAAFVAESMQSCGGQIIPPPGYFKQVADHVRRAGGIFIADEVQVGFGRVGSHFWAFQLQGEDFVPDIVTMGKPIGNGHPISCVVTTREVADSFRASGVEYFNTFGGNPVSCAIALSVLDIIEKENMRENAVSTGRYLVELLNELKTRHEIIGDIRGQGLFVGVDLVKDRKSRAAATAEAEHIIYRLKEEHVLLSADGPYSNVLKFKPPMCFNRDDAKFAVNKIDQILMG 439          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003245.1 (pep scaffold:Pmarinus_7.0:GL492368:93:2350:-1 gene:ENSPMAG00000002964.1 transcript:ENSPMAT00000003245.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 3.216e-22
Identity = 51/126 (40.48%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  216 QYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYKLNKKN 575
            Q+++DE+  RYLD    +    VGH HP +T A   Q+S L ++   YLH  +   AE+L   LP+ L++ YF NSGSEANDLAM +AR YT + + L     YHG     + +T +  YK +  N
Sbjct:    2 QWLWDEHGRRYLDFFAGIVTVSVGHCHPTVTRAAKAQLSRLWHSTNIYLHPPVHEYAEKLAALLPEPLKVIYFTNSGSEANDLAMFMARAYTGNFDILSFRGGYHGASPYTMGLTNVGSYKYSVPN 127          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Sea Lamprey
Match: abat (4-aminobutyrate aminotransferase [Source:ZFIN;Acc:ZDB-GENE-031006-4])

HSP 1 Score: 81.6481 bits (200), Expect = 6.962e-17
Identity = 102/443 (23.02%), Postives = 177/443 (39.95%), Query Frame = 3
Query:  213 GQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYL------HDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKE--------------------------TLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLY--AEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDY--FNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDL-NIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            G Y+ D +  R LD    ++ +  G++HP +        +L     R        HD    L + L +  P  L     +  GS +N+ A +    + ++K+                           L    ++HG  +     +  K   K    +L  W  + P P   R +Y   E+S E  S+      +V  + +    KG+ V    +E +Q+ GG       ++ K+  +  ++G   + DEVQTG G  G  FWA +    +  PD+VT  K M  G             +  R    Y  +NT+ G P    +   VL ++  E+L +  +  G+ L + L  + N+  NI+   RG G F  ID ++   TR  A   A       + K +++   G  D  ++F+P + F+E  A+  L+  R V+  ++
Sbjct:   43 GNYLVDVDGNRMLDLYMQISSLPLGYNHPALLRTLQDPANLATFANRPALGALPPHDLPQLLHKSLVSVAPTGLRQVQTMACGSCSNENAFKAIFIWYRNKQRGGAKPTTEELRTSMINQSPGCPELSILSFMGSFHGRTIGCLATTHSKAIHKLDIPSLD-WP-IAPFP---RLQYPLEEHSRENASEEARCLAEVEDLIQKFARKGRPVAGVVVEPIQAEGGDNHASDDFFRKLRALTAKHGAAFLCDEVQTGAGTTG-LFWAHEHWGLENPPDVVTFSKKMLTG--------GFYYKDELRTELPYRIYNTWMGEPSKTLMLAEVLKVVRAERLLDNVQHAGSVLLRGLTDLQNEFPNILSRARGRGTFCAID-IRDEDTRNKAVLLA-------RNKGVVLGGCG--DMSIRFRPSLIFTEIHANIFLNIFRDVVSTLK 461          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Yeast
Match: CAR2 (L-ornithine transaminase (OTAse); catalyzes the second step of arginine degradation, expression is dually-regulated by allophanate induction and a specific arginine induction process; not nitrogen catabolite repression sensitive; protein abundance increases in response to DNA replication stress; human homolog OAT complements yeast null mutant [Source:SGD;Acc:S000004430])

HSP 1 Score: 158.303 bits (399), Expect = 6.897e-44
Identity = 120/437 (27.46%), Postives = 213/437 (48.74%), Query Frame = 3
Query:  108 VTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNI-VHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHA--------YHGNLLSMTQISP-YKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLN-IIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSEND 1376
             T S ++TIE   KY   +    +   P+   K  G +++D     YLD ++  + V  GH HP+I  A  +Q   L  + R  H+++    A+ +T       E    +N+G+EA + A+++AR +   K+ +  + A        +HG       +S  Y+ +K +    +P  A               + +S+ K+   +AED   + ES   +GK+V    LE +Q   G V+ P  Y+ K+  +  ++  ++I DE+QTG GR G     +    ++ +PDIV +GK +  G  PV+ V+++  I   F  G  + +TFGG+P++  +A+A L+++ +EKL ++A  +G+    QL  +    N II +VRG GL   I +  S+   + A D   L    +K+  ++      +D+I++  PP+  SE D
Sbjct:    4 ATLSSKQTIEWENKYSAHN----YHPLPVVFHKAKGAHVWDPEGKLYLDFLSAYSAVNQGHCHPHIIKALTEQAQTLTLSSRAFHNDVYAQFAKFVTEFF--GFETVLPMNTGAEAVETALKLARRWGYMKKNIPQDKAIILGAEGNFHGRTFGAISLSTDYEDSKLHFGPFVPNVA---------------SGHSVHKIRYGHAEDFVPILES--PEGKNVAAIILEPIQGEAGIVVPPADYFPKVSALCRKHNVLLIVDEIQTGIGRTGE-LLCYDHYKAEAKPDIVLLGKALSGGVLPVSCVLSSHDIMSCFTPG-SHGSTFGGNPLASRVAIAALEVIRDEKLCQRAAQLGSSFIAQLKALQAKSNGIISEVRGMGLLTAIVIDPSKANGKTAWDLCLL----MKDHGLLAKPT--HDHIIRLAPPLVISEED 409          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Yeast
Match: ARG8 (Acetylornithine aminotransferase; catalyzes the fourth step in the biosynthesis of the arginine precursor ornithine [Source:SGD;Acc:S000005500])

HSP 1 Score: 125.561 bits (314), Expect = 4.987e-32
Identity = 109/413 (26.39%), Postives = 198/413 (47.94%), Query Frame = 3
Query:  198 IIKGSGQYMYDE-NNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLP------DSLEICYFVNSGSEANDLAMRIARYY----TKSKETLV-LEHAYHG---NLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKIC---KIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDL-NIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSE 1370
            I +G    +YD+ N   Y+D    +A   +GH++P +      Q + L++++  Y     + L+E++           D+  + +  NSG+EAN+ A++ A+ +      SK+ +V  E+++HG     LS+T  S Y+           P+  +VP              S   L+D    ++ K+   +  K   +    +E +Q  GG  +FP    EK+    KI  +   ++I DE+Q G GR G   WA     S+  PDI T  K +GNG+P+AA +   K++ A R G D+  T+GG+P++C+++  VLD + +E   ++     + L+++L  +     N I  +RG GL LG + V      EP T+     +++ +E  +++ T G   + ++F P +   +
Sbjct:   36 ITRGKNAKLYDDVNGKEYIDFTAGIAVTALGHANPKVAEILHHQANKLVHSSNLYFTKECLDLSEKIVEKTKQFGGQHDASRV-FLCNSGTEANEAALKFAKKHGIMKNPSKQGIVAFENSFHGRTMGALSVTWNSKYR----------TPFGDLVP------------HVSFLNLND----EMTKLQSYIETKKDEIAGLIVEPIQGEGG--VFP-VEVEKLTGLKKICQDNDVIVIHDEIQCGLGRSGK-LWAHAYLPSEAHPDIFTSAKALGNGFPIAATIVNEKVNNALRVG-DHGTTYGGNPLACSVSNYVLDTIADEAFLKQVSKKSDILQKRLREIQAKYPNQIKTIRGKGLMLGAEFV------EPPTE----VIKKARELGLLIITAG--KSTVRFVPALTIED 404          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Yeast
Match: BIO3 (7,8-diamino-pelargonic acid aminotransferase (DAPA); catalyzes the second step in the biotin biosynthesis pathway; BIO3 is in a cluster of 3 genes (BIO3, BIO4, and BIO5) that mediate biotin synthesis; BIO3 and BIO4 were acquired by horizontal gene transfer (HGT) from bacteria [Source:SGD;Acc:S000005341])

HSP 1 Score: 79.7221 bits (195), Expect = 1.842e-16
Identity = 83/351 (23.65%), Postives = 162/351 (46.15%), Query Frame = 3
Query:  279 GHSHPYITSACVQQMSLLNTNCR--YLHDNIVHLAERLTNTLPD-SLEICYFVNSGSEANDLAMRIARYYTKSKET-------LVLEHAYHGNLL-SMTQISP-----YKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDL---YAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQ----------LNDSD---IRPDIVTMGKPMGNGY-PVAAVVTTRKISE-----------AFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMN--DLNIIGDV 1193
            G+++P +  A  +QM   +      + H   V+L ++L   + + SL+ C+  +SGS A ++A+++A     S E        L +++ YHG+   +M+   P     +  N +  E        +V      +  + D+ ++ E+++DL   +     K+C  + E            +Q  GG   +   +  ++ K+ ++Y  + I DE+ TGFGR G  F AF+          ++ SD   + PDI+ +GK + +GY  ++AVV   K++             F  GP    TF G+ ++C++A   +DI+   + +++   I N + ++L+  +   D  +IG V
Sbjct:   71 GYNNPELNEALTKQMLKFSHVLLGGFTHKGAVNLVQKLLKVIDEPSLQYCFLADSGSVAVEVALKMALQSNMSGEATKNRTKFLTIKNGYHGDTFGAMSVCDPENSMHHIYNDRLSENIFAQAPSIVDGLPTSQNGFEDH-WNAEEVTDLKKQFELHSDKICAVILEP----------ILQGAGGLRPYHPQFLIEVQKLCNQYDVLFIMDEIATGFGRTGEIF-AFKHCQKYQDQHGISPSDQIKVVPDILCVGKGLTSGYMTMSAVVVNDKVASRISSPNSPTGGCFMHGP----TFMGNALACSVAEKSMDILLRGEWRKQVSAIENQIYRELYQYIKNPDNGLIGTV 405          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Yeast
Match: UGA1 (Gamma-aminobutyrate (GABA) transaminase; also known as 4-aminobutyrate aminotransferase; involved in the 4-aminobutyrate and glutamate degradation pathways; required for normal oxidative stress tolerance and nitrogen utilization; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003251])

HSP 1 Score: 69.707 bits (169), Expect = 3.316e-13
Identity = 95/400 (23.75%), Postives = 163/400 (40.75%), Query Frame = 3
Query:  204 KGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSAC---------VQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKE---------------------------TLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPP--WAHVVPTPDRYRGKYRDNEYSIEKLSDLYAED----VRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEA--FRRGPDY--------FNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMM-----NDLNIIGDVRGSGLFLGIDL 1226
            K  G Y+ D +   YLD    ++ +  G+++P +  A          V + +L N   + L D I+   +++  + P   +  +   SG++AN+LA + A  Y ++K+                            L  + A+HG L +    +    +K   +   P   W H          +Y   +Y +++ SD   ++    +  V E ++     V    +E +QS GG     K + +K+  I  +Y  V I DEVQTG G  G   W  +   +DI+P             PV  V  ++K   A  F   P +        FNT+ G P    IA A+   + ++KL E+   +G+YL ++L  +      N  N+ G  +G G F+  DL
Sbjct:   51 KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDRPALGNFPSKDL-DKIL---KQILKSAPKGQDHVWSGLSGADANELAFKAAFIYYRAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT---CSKPIHKLDFPAFHWPHA---------EYPSYQYPLDENSDANRKEDDHCLAIVEELIKTWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTGVGATGK-LWCHEY--ADIQP-------------PVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENFQNLRG--KGRGTFIAWDL 416          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Nematostella
Match: EDO40982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I9])

HSP 1 Score: 431.795 bits (1109), Expect = 5.293e-148
Identity = 208/443 (46.95%), Postives = 297/443 (67.04%), Query Frame = 3
Query:  102 WNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            WN   + E+ +  R+++IG S ++ F ++PIK+    GQY YD+   + LDC+NNV HVGH HP++  AC  QM++LNTN R+L+ N+V    RL    P SL +CY+V SGSEANDLA+R+AR +TK  + ++L+ AYHG+  ++  ISPYK N    E     + HV P PD YRG+++   Y  E     YA +V+++ E + + G+ +  F  ESMQ CGGQ+++P+ + ++  K +   GGV IADEVQ GFGRVGN FWAF+    D+ PDIVT+GKP+GNG+P+A VVTT +ISE+F   G  YFNT+GG+PVSCA+  AVLD++E E LQ+ A  +G  L  +L  +     +IGDVRG GLF+G++LVK + T EPAT EA   + + KE  I++S DG + N+LK KPPMCFS +DAD L++ L ++L  +++
Sbjct:   42 WN-DLTSEEIMAARKRHIGKSCKVHFPQNPIKLAYSKGQYFYDDKGRQLLDCMNNVTHVGHCHPHVVKACSDQMAVLNTNSRFLYSNMVQYTRRLLAKFPPSLSVCYYVCSGSEANDLALRLARTHTKQHDMVILDRAYHGHTSALIDISPYKFNAPGGEGK-KDFIHVAPCPDPYRGRHKG--YGPET-GIKYANEVKQLIEEVEKDGRKIAGFICESMQGCGGQIVYPQNFMKEAFKHVRAAGGVCIADEVQVGFGRVGNHFWAFETQ--DVVPDIVTLGKPIGNGHPLACVVTTPEISESFAATGMAYFNTYGGNPVSCAVGNAVLDVIEEEGLQQHALKVGTQLIDKLKGLQQKHPLIGDVRGMGLFVGVELVKDQDTLEPATSEASHVVYQAKENHILISADGIHSNVLKIKPPMCFSHSDADNLVNTLDIILTEMEE 477          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Nematostella
Match: EDO34914 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ4])

HSP 1 Score: 269.24 bits (687), Expect = 7.274e-85
Identity = 167/476 (35.08%), Postives = 261/476 (54.83%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYKLNKKNCEETLPPWAHVVPT---------PDRYRGKY-----RDNEYSIE----------KLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTT-----RKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDL-NIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ 1433
            S +K  ++RQ Y+  ++  ++ +DPI I  G  Q+++D NN RYLD    +    VGH HP++  A   Q+  L +T   Y H  I   AE + + LP +L++CYFVNSGSEAND+A+ +AR +T + + + L ++YHG+   ++ +T  S +KLN              VPT         PD YRG +     RD+    +          K SDLYAE +  +   +   GK V  F  E +Q  GG V  PK + +K  ++I + GG+ I+DEVQ GFGR+G+ +W F+     + PDIVTM K +GNG+P+ AV+TT     +K + A      +FNT+GG+P++ A+  AV++ ++NE LQE   T+G    + L  + ++  + +GDVRG GL  G++LV  R  R P   D+        KE  +++   G + N+ + KPPMC ++ DADF +  +R   +   D++
Sbjct:   15 SFDKAKQIRQTYLNPALLAYY-KDPIFIWAGHMQWLWDINNKRYLDMFAGIVTVGVGHCHPHVNKALKAQVDRLWHTTNIYYHPQIHEYAELMASKLPGNLKVCYFVNSGSEANDMALMMARAHTGNFDIVNLRNSYHGSGQGVVGITSQSTWKLN--------------VPTNIGFYSTMNPDVYRGPWGGANCRDSISQTDRACNCGPDECKASDLYAEQLEDLL--IHSAGKKVAGFIAEPIQGVGGTVQLPKGFLKKAYELIRKRGGLCISDEVQCGFGRLGSHYWGFE--SHGVMPDIVTMAKGIGNGFPMGAVITTPGENRKKFANAL-----HFNTYGGNPMASAVGKAVIETIDNEGLQENCSTVGTRFLRGLRKLQDEFPDFVGDVRGKGLMTGMELVTDRVKRTPMPADQFVPIWEDCKEMGLLLGKGGLHGNVFRIKPPMCITQEDADFAISVMRAAFQHHVDKR 466          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Nematostella
Match: EDO48680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC3])

HSP 1 Score: 118.627 bits (296), Expect = 4.543e-29
Identity = 106/434 (24.42%), Postives = 193/434 (44.47%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYT--------KSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFL-MMNDL--NIIGDVRGSGLFLGIDLVKSRQTREPATD-EAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSEN 1373
            S E+  E  +KY   +    +S  P+ + K  G YM+D    RY+D +   + V  GH HP I  A   Q  +L+   R  +++++   +     L    +    +N+G E  + A ++AR +            + +  E+ + G  L+    S    +  +C     P+      P      Y D     + +SD                  +   F +E +Q   G V+    Y + +  +  +Y  + IADEVQTG GR G       ++  ++RPD+V +GK +  G YPV+ V+   ++    + G ++ +T+GG+P+   +A+  L ++E EKL E++  +G     ++FL  M  L  N++   RG GL   I +       +P+ D  A     RL++  ++      +D+I++F PP+  +E+
Sbjct:   30 SPEQVFEREEKYGAHN----YSPLPVALAKAEGIYMWDVTGKRYIDFLAAYSAVNQGHCHPRIVKALQDQAGILSLTSRAFYNDVLGEFQEFVTKL-FGYDKVLPMNTGVEGGETACKLARKWAYKVKGVPQNQAKIVFAENNFWGRTLAACSSS----SDPSCYTDYGPF-----MPGFELVPYNDLAALEKSISD-----------------PNTAAFMVEPIQGEAGVVVPDAGYLKGVRDLCDKYNVLFIADEVQTGLGRTGRRLC---VDHDNVRPDMVVLGKAISGGLYPVSCVLADDQVMLTIKPG-EHGSTYGGNPLGAKVAMEALRVLEEEKLSERSAELG-----KVFLSAMQKLNPNVVELARGKGLMNAIVI-------KPSDDCNAWKVCLRLRDNGLLAKPT--HDHIIRFTPPLVITED 414          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Nematostella
Match: EDO34279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT6])

HSP 1 Score: 84.3445 bits (207), Expect = 1.574e-17
Identity = 109/479 (22.76%), Postives = 185/479 (38.62%), Query Frame = 3
Query:  138 LRQKYIGSSVQIFFSE-DPIKIIKG----------SGQYMYDENNIRYLDCINNVAHV--GHSHPY---------ITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKE--------------------------TLVLEHAYHGNLL-SMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQL-FLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            +R    G   Q  F E D I+  KG           G Y+ D +    LD    +A +  G++HP          I S+ + + +L     + L  N   L E + +  P  L     +  G+ AN+ A++ A  + +++E                           L     +HG  L S+T      ++K +    +P +   V T  + +    +++           ++V+++  +  + GK V     E +Q+ GG       +++ +  I  E+G   I DEVQTG G  G  FWA +    D  PD VT  K M  G          + S  FR     FNT+ G P    +   VL ++  + L E    +G  L + L ++       +   RG G F GIDL        P  +     L +++   + M  DG     ++F+P + F     D  ++ +  VL G++
Sbjct:    1 MRTSVPGPKSQELFKELDEIQSSKGMKYFVDFEKSKGNYVVDADGNVMLDVYQQIASIPLGYNHPALLKAMQDPEILSSIINRSALGLLPPKTLPKN---LKESVLSVSPKGLTEVTTMACGTCANENAIKAACIWYRNRERGSETPTEEDMITCMKGQAPGSPPYTVLSFTGGFHGRTLGSLTLTRSKAIHKVD----IPSFDWPVATFPKLKYPLEEHQRENAAEEQRCLDEVKEIISTWNKAGKPVAALITEPIQAEGGDNHASPNFFKGLQAICKEFGTAFIVDEVQTGVGSTGK-FWAHEHWGLDEAPDFVTFSKKMAIGG--FYYKHEFRPSAPFR----IFNTWMGDPNKMILLREVLKVIRKDNLIEYTADVGKELLKGLQYIEERHPEFVSRARGLGTFCGIDL--------PDLETRTKFLGQMRNNGVDM--DGCGVKTVRFRPALIFGHKHLDLAVNTMDSVLNGMK 455          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Match: etnppl (ethanolamine-phosphate phospho-lyase [Source:NCBI gene;Acc:101168404])

HSP 1 Score: 500.745 bits (1288), Expect = 1.326e-174
Identity = 234/437 (53.55%), Postives = 318/437 (72.77%), Query Frame = 3
Query:  120 KEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAF-RRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQD 1427
            K  TI+LR+K+IG S +IFFS DP+KI++  GQYM++E   RYLDCINNVAHVGH HP +  A  QQM LLNTN R+LHDN+V  A++L  TLPD L +CYFVNSGSEANDLA+R+A  +T  K+ + LE+AYHG++ S+  ISPYK  + +  E    + HV P+PD YRGKYR +     +    YA++V+ + E + +KG  +  F  ES+QSCGGQVI P  Y++++ + + + GGV IADEVQ GFGRVG+ FWAFQL   D  PDIVTMGKP+GNG+P++ VVTTR ++EAF   G +YFNTFGG+PVSCAI LAVLD++E E LQEKA  +G YL   L+ + ++  +IGD+RG GLF+G++LV  R T  PAT EA+  + RLKE+ I++S DGP+ N+LKFKPP+CF+  DAD +++ + ++L  +++
Sbjct:    8 KNSTIDLRKKHIGPSCKIFFSHDPLKIVRAKGQYMFNEKGQRYLDCINNVAHVGHCHPEVVKAASQQMELLNTNTRFLHDNLVLYAKKLQATLPDKLSVCYFVNSGSEANDLALRLAWQHTGHKDIITLENAYHGHVSSLINISPYKFQQLSGTEQ-SQFVHVAPSPDVYRGKYRADHADPAR---AYADEVKDIIEQVHKKGGKIAAFIAESLQSCGGQVIPPVGYFQQVAEHVRKAGGVFIADEVQVGFGRVGSHFWAFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTRAVAEAFMSSGMEYFNTFGGNPVSCAIGLAVLDVIEKENLQEKALRVGQYLCNLLWKLKDEHPLIGDIRGHGLFIGVELVTDRLTLSPATAEAQEVIYRLKEQFILLSADGPHRNVLKFKPPLCFTTEDADLVVEKMDLILTELEN 440          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase [Source:NCBI gene;Acc:101162691])

HSP 1 Score: 483.797 bits (1244), Expect = 1.484e-168
Identity = 234/448 (52.23%), Postives = 315/448 (70.31%), Query Frame = 3
Query:   87 LAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEK-QIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQ 1424
            +AEE+    ++KE+T+ +R + IG S ++F+ EDP+KI++  GQY++DEN  RYLDCI+NV HVGH HP +T+A   QM LLN N R+L+D IV  A RL  TLPD L + YFVNSGSEANDLA+R+A+ YT++++ +VL+HAYHG+L+S+  ISPYK  K   ++    W HV P PD YRG YR++          YA+ V+ + E +  KG+ +  F+ ES+ S GGQ++ P+ Y  K+ + +H  GGV +ADEVQTGFGRVG+ FWAFQL   +  PDIVTMGKPMGNG+PVA V TT +I++AF   G +YFNTFGG+PVSCAI LAVLD++E E L+  A  +G +LK  L  +     +IGDVR  GLF G++LV  R+ R PAT+ A L ++RLKE+ +I MSTDGP+DNILK KPPMCFS  DAD ++  L  +L  I+
Sbjct:    1 MAEEN----FTKEETLAMRLRLIGQSCRLFYKEDPVKIVRARGQYLFDENGNRYLDCISNVQHVGHCHPAVTTAAAAQMDLLNVNTRFLNDKIVLYAARLGATLPDKLCVFYFVNSGSEANDLALRLAQQYTQNQDVIVLDHAYHGHLMSLIDISPYKFRKLAGQKD---WVHVAPLPDTYRGMYREDH---PNPGQAYADKVKDLIEEIHRKGRKISAFFAESLPSVGGQILLPQGYSSKVAEYVHSAGGVFVADEVQTGFGRVGSHFWAFQLQGENFCPDIVTMGKPMGNGHPVACVATTVEIAQAFTANGVEYFNTFGGNPVSCAIGLAVLDVIEEEDLRGNAIRVGEHLKGLLKKLQARHEVIGDVRCVGLFAGVELVTDREKRTPATNLAALVVKRLKEEDRICMSTDGPWDNILKLKPPMCFSVEDADLVVACLERILSDIK 438          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Match: phykpl (5-phosphohydroxy-L-lysine phospho-lyase [Source:NCBI gene;Acc:101162691])

HSP 1 Score: 484.952 bits (1247), Expect = 1.517e-168
Identity = 234/447 (52.35%), Postives = 315/447 (70.47%), Query Frame = 3
Query:   87 LAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFR-RGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEK-QIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGI 1421
            +AEE+    ++KE+T+ +R + IG S ++F+ EDP+KI++  GQY++DEN  RYLDCI+NV HVGH HP +T+A   QM LLN N R+L+D IV  A RL  TLPD L + YFVNSGSEANDLA+R+A+ YT++++ +VL+HAYHG+L+S+  ISPYK  K   ++    W HV P PD YRG YR++          YA+ V+ + E +  KG+ +  F+ ES+ S GGQ++ P+ Y  K+ + +H  GGV +ADEVQTGFGRVG+ FWAFQL   +  PDIVTMGKPMGNG+PVA V TT +I++AF   G +YFNTFGG+PVSCAI LAVLD++E E L+  A  +G +LK  L  +     +IGDVR  GLF G++LV  R+ R PAT+ A L ++RLKE+ +I MSTDGP+DNILK KPPMCFS  DAD ++  L  +L G+
Sbjct:    1 MAEEN----FTKEETLAMRLRLIGQSCRLFYKEDPVKIVRARGQYLFDENGNRYLDCISNVQHVGHCHPAVTTAAAAQMDLLNVNTRFLNDKIVLYAARLGATLPDKLCVFYFVNSGSEANDLALRLAQQYTQNQDVIVLDHAYHGHLMSLIDISPYKFRKLAGQKD---WVHVAPLPDTYRGMYREDH---PNPGQAYADKVKDLIEEIHRKGRKISAFFAESLPSVGGQILLPQGYSSKVAEYVHSAGGVFVADEVQTGFGRVGSHFWAFQLQGENFCPDIVTMGKPMGNGHPVACVATTVEIAQAFTANGVEYFNTFGGNPVSCAIGLAVLDVIEEEDLRGNAIRVGEHLKGLLKKLQARHEVIGDVRCVGLFAGVELVTDREKRTPATNLAALVVKRLKEEDRICMSTDGPWDNILKLKPPMCFSVEDADLVVACLERILSGL 437          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:NCBI gene;Acc:111948298])

HSP 1 Score: 283.108 bits (723), Expect = 2.727e-89
Identity = 162/451 (35.92%), Postives = 254/451 (56.32%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGS-SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYK---LNKKNCEETL------PPWA---------HVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLL 1391
            SKE+ +++R++     ++++ + + P+ I +G  Q+++D +  RYLD    VA   VGH HP + +A  QQ+  L +T   Y++  +    E+L + LPD L++ Y  NSGSEANDLAM +AR +T + + +    +YHG     L +T  + YK    +   C  T+       PW            +      +G  + NE+ IE+L +  A  V             +  F+ E +Q  GG V +PK + ++  +++ E GG+ IADEVQTGFGR G+ FW FQ    DI PD+VTM K +GNG+P+ AVVTT +I+ +F RG  +FNTFGG+PV+CA+A +VLD ++ +K Q+ +  +G YL ++L  + +   IIGDVRG GL +G+++V  + +R P    E       +K+  +++   G Y  I + KPPMC +  DADF L
Sbjct:   64 SKERMLDIRRQNCNPMTLKVTYYKKPVFIHQGYMQWLWDVDGSRYLDLFAGVATVSVGHCHPKVLTAAEQQLKKLWHTTNIYIYPTLHEYCEKLASYLPDPLKVIYLTNSGSEANDLAMLMARLHTGNYDIITFRGSYHGGGPQTLGLTSNAAYKYPVASGLGCTNTMCPDVFRGPWGGSNCRDSPVQTIRDCSCAQGHCKANEHYIEQLRETLATSVPT----------RIAGFFAEPIQGVGGAVQYPKDFLKEAYRLVRERGGICIADEVQTGFGRTGSHFWGFQ--GHDIIPDMVTMAKGIGNGFPMGAVVTTPEIAASFARGV-HFNTFGGNPVACAMASSVLDTIQEDKTQKVSLDVGTYLLKELAKLRDKYEIIGDVRGKGLMIGVEMVTDKTSRTPLPLGEMAEIFEDVKDMGVLIGKGGLYGQIFRIKPPMCITMEDADFFL 501          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:NCBI gene;Acc:111948298])

HSP 1 Score: 262.692 bits (670), Expect = 2.620e-82
Identity = 157/450 (34.89%), Postives = 242/450 (53.78%), Query Frame = 3
Query:  117 SKEKTIELRQKYIGS-SVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQMS-LLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGN---LLSMTQISPYK---LNKKNCEETL------PPWA---------HVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLL 1391
            SKE+ +++R++     ++++ + + P+ I +G  Q+++D +  RYLD    VA   VGH HP + +A  QQ+  L +T   Y++  +    E+L + LPD L++ Y  NSGSEANDLAM +AR +T + + +    +YHG     L +T  + YK    +   C  T+       PW            +      +G  + NE+ IE+L +  A  V             +  F+ E +Q  GG V +PK + ++  +++ E GG+ IADEVQTGFGR G+ FW FQ    DI PD+VTM K +GNG+P+ AVVTT +I+ +F RG  +FNTFGG+PV+CA+A +VLD ++ +K Q+ +  +G YL ++L  + +   IIGDVRG GL +G+++V                                 D I + KPPMC +  DADF L
Sbjct:   25 SKERMLDIRRQNCNPMTLKVTYYKKPVFIHQGYMQWLWDVDGSRYLDLFAGVATVSVGHCHPKVLTAAEQQLKKLWHTTNIYIYPTLHEYCEKLASYLPDPLKVIYLTNSGSEANDLAMLMARLHTGNYDIITFRGSYHGGGPQTLGLTSNAAYKYPVASGLGCTNTMCPDVFRGPWGGSNCRDSPVQTIRDCSCAQGHCKANEHYIEQLRETLATSVPT----------RIAGFFAEPIQGVGGAVQYPKDFLKEAYRLVRERGGICIADEVQTGFGRTGSHFWGFQ--GHDIIPDMVTMAKGIGNGFPMGAVVTTPEIAASFARGV-HFNTFGGNPVACAMASSVLDTIQEDKTQKVSLDVGTYLLKELAKLRDKYEIIGDVRGKGLMIGVEMVT--------------------------------DKIFRIKPPMCITMEDADFFL 429          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Match: SMESG000012656.1 (SMESG000012656.1)

HSP 1 Score: 954.51 bits (2466), Expect = 0.000e+0
Identity = 455/457 (99.56%), Postives = 456/457 (99.78%), Query Frame = 3
Query:   63 MQNADKKCLAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ 1433
            MQNA+KKCL EESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ
Sbjct:    1 MQNAEKKCLTEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGSGQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLKGIQDEQ 457          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Match: SMESG000041460.1 (SMESG000041460.1)

HSP 1 Score: 285.419 bits (729), Expect = 1.073e-90
Identity = 165/431 (38.28%), Postives = 235/431 (54.52%), Query Frame = 3
Query:  177 FSEDPIKIIKGSGQYMYDENNIRYLDCINNVA--HVGHSHPYITSACVQQM-SLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPT---------PDRYRGKY-----RDNEYSIEK----------LSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADF 1385
            + ++P+ I +G  Q+++D NN RYLD    +    VGH HP +  A  +Q+  L +T   YLH  I   AE LT   P  L++ YF NSGSEANDLA  +A+ YT+  E + L ++YHG       +S + +   N    L  W H   T         PD YRG +     RD+    ++           S+ Y E +  V      K    G F  E++Q  GG V FPK +  K+  II   GGV IADEVQTGFGR+G  FW FQ  D  + PDIVTM K +GNG+P+AAVVTT++I+ +   G   FNT+GG+P++CA+   VL ++E+E L    + +G Y   +L  + +   IIGDVRG GL +G+++V S+ T+ P   D+       LK+  +++   G Y N+ + KPPMC S+ D DF
Sbjct:   50 YYKEPLIIHQGYKQWLFDHNNKRYLDLFGGIVTVSVGHCHPKVNEALKRQVDKLWHTTNIYLHPEIHEYAEMLTKKFPSPLKVVYFTNSGSEANDLAFLMAKLYTQRNEIITLRNSYHG-------MSSFSMGATN----LSTWRHNAVTNHGFISTMNPDPYRGPWGGSHCRDSPVQTDRKCDCSPGSCGASEKYVEQLEDVLRFSTPKSGIAG-FVAETIQGVGGTVQFPKNFLAKVYPIIKNSGGVCIADEVQTGFGRLGEHFWGFQ--DHGVIPDIVTMAKGIGNGFPLAAVVTTKEIANSLT-GALTFNTYGGNPLACAVGKEVLKVIESENLMNNCKDVGTYFLLKLNSLKDKYEIIGDVRGKGLMIGLEMVDSKTTKIPLKIDKMAKLFEDLKDMGVLVGKGGFYGNVFRIKPPMCLSKQDVDF 465          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Match: SMESG000041460.1 (SMESG000041460.1)

HSP 1 Score: 243.432 bits (620), Expect = 4.975e-76
Identity = 139/359 (38.72%), Postives = 196/359 (54.60%), Query Frame = 3
Query:  384 LTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPT---------PDRYRGKY-----RDNEYSIEK----------LSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREP-ATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADF 1385
            LT   P  L++ YF NSGSEANDLA  +A+ YT+  E + L ++YHG       +S + +   N    L  W H   T         PD YRG +     RD+    ++           S+ Y E +  V      K    G F  E++Q  GG V FPK +  K+  II   GGV IADEVQTGFGR+G  FW FQ  D  + PDIVTM K +GNG+P+AAVVTT++I+ +   G   FNT+GG+P++CA+   VL ++E+E L    + +G Y   +L  + +   IIGDVRG GL +G+++V S+ T+ P   D+       LK+  +++   G Y N+ + KPPMC S+ D DF
Sbjct:    2 LTKKFPSPLKVVYFTNSGSEANDLAFLMAKLYTQRNEIITLRNSYHG-------MSSFSMGATN----LSTWRHNAVTNHGFISTMNPDPYRGPWGGSHCRDSPVQTDRKCDCSPGSCGASEKYVEQLEDVLRFSTPKSGIAG-FVAETIQGVGGTVQFPKNFLAKVYPIIKNSGGVCIADEVQTGFGRLGEHFWGFQ--DHGVIPDIVTMAKGIGNGFPLAAVVTTKEIANSLT-GALTFNTYGGNPLACAVGKEVLKVIESENLMNNCKDVGTYFLLKLNSLKDKYEIIGDVRGKGLMIGLEMVDSKTTKIPLKIDKMAKLFEDLKDMGVLVGKGGFYGNVFRIKPPMCLSKQDVDF 345          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Match: SMESG000055175.1 (SMESG000055175.1)

HSP 1 Score: 112.849 bits (281), Expect = 7.921e-27
Identity = 103/409 (25.18%), Postives = 179/409 (43.77%), Query Frame = 3
Query:  189 PIKIIKGSGQYMYDENNIRYLDCINNVAHV--GHSHPYITSACVQQMSLLNTNCRYLHDNIVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYY--------TKSKETLVLEHAYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSIEKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNG-YPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDAD 1382
            P+ I KG G Y++D     Y D ++  + V  GH HP I    ++Q   +    R  ++ I+   E     +    ++C  +N+G E  D A ++AR +            + +   + + G  L+    S    +       +P +  +VP  D  R +        EKL D +       C            F +E +Q   G V+    Y + +  +  +Y  + IADEVQTG GR G       ++  +IRPDIV +GK +  G YPV+AV+   +I      G ++ +TFGG+P+ C +A+  L++++ E L E +  +G  L+  L  +  ++  +  VRG GL   I + K         D  K+ L     + I +     + +I++  PP+  +  + D
Sbjct:   52 PVAIEKGKGVYVWDVEGNMYFDYLSAYSAVNQGHCHPEILKTLIEQSQKVTLTSRAFYNTILGDYEEYITKMFGYDKVCP-MNTGVEGGDTACKLARKWGYKVKKIPNNKAKIIFANNNFWGRSLAAISSSTDPSSYDGFGPYMPGF-ELVPYDDLARLE--------EKLKDPH------TCA-----------FMVEPIQGEAGVVLPSPGYLKGVRDLCTKYKVLFIADEVQTGLGRTGK---LLCVDYDNIRPDIVVLGKALSGGVYPVSAVLANDEIMLTILPG-EHGSTFGGNPLGCKVAMTALEVLKKENLTENSEKMGQRLRAGLEKLPKEM--VSIVRGKGLLNAIVVQKKY-------DAWKICLAM---RDIGILAKPTHGDIIRLAPPLTITAAEID 417          
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Match: SMESG000037567.1 (SMESG000037567.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.494e-9
Identity = 66/249 (26.51%), Postives = 106/249 (42.57%), Query Frame = 3
Query:  675 DLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKICKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGNGYPVAAVVTTRKISEAFRRGP-DYFNTFGGSPVSCAIALAVLDIMENEKLQEKARTIGNYLKQQLFLMMN-DLNIIGDVRGSGLFLGIDLVKSRQTREPATDEAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVLK 1415
            ++  E +RK  E        V    +E + + GG +     ++  + +I  +     I DEVQTG G  G +FWA +  +    PDIVT  K M  G       TT+   +     P   FNT+ G P    +  AVL  ++ E L  + +  GN+L + L  +     N + + RGSG F  ID      T   A D+    L  L+ +  ++   G  D  ++F+P +       D  L+    ++K
Sbjct:  256 EMVEETIRKCAEI-----SPVCGVIVEPVLAEGGDIHGSNNFFYSLREICRKKKIAFIVDEVQTGCGPTG-TFWAHEKWNLCYPPDIVTFSKKMLLG----GYFTTK---DYIPIAPYQIFNTWLGEPSKVLLLEAVLKTIKTEDLINETKETGNHLLKGLKNVQKLSKNKLSNARGSGTFCAIDC-----TTSAARDK---MLEELRNRGFLLGGCG--DVSIRFRPALTLKIRHVDLFLECFEDLIK 481          
The following BLAST results are available for this feature:
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ETNPPL0.000e+054.44ethanolamine-phosphate phospho-lyase [Source:HGNC ... [more]
ETNPPL6.508e-17453.30ethanolamine-phosphate phospho-lyase [Source:HGNC ... [more]
PHYKPL2.963e-16851.605-phosphohydroxy-L-lysine phospho-lyase [Source:HG... [more]
ETNPPL3.434e-16554.59ethanolamine-phosphate phospho-lyase [Source:HGNC ... [more]
ETNPPL1.002e-15253.25ethanolamine-phosphate phospho-lyase [Source:HGNC ... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eppl-18.663e-13645.12Ethanolamine-phosphate phospho-lyase homolog 1 [S... [more]
eppl-18.663e-13645.12Ethanolamine-phosphate phospho-lyase homolog 1 [S... [more]
T09B4.82.760e-8435.35pep chromosome:WBcel235:I:6164719:6166539:-1 gene:... [more]
oatr-11.005e-3425.71Probable ornithine aminotransferase, mitochondrial... [more]
oatr-11.005e-3425.71Probable ornithine aminotransferase, mitochondrial... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG87459.765e-16047.69gene:FBgn0036381 transcript:FBtr0075801[more]
CG112412.551e-8936.36gene:FBgn0037186 transcript:FBtr0078536[more]
CG112414.769e-8835.84gene:FBgn0037186 transcript:FBtr0347061[more]
CG112414.769e-8835.84gene:FBgn0037186 transcript:FBtr0113188[more]
Oat5.644e-3325.48gene:FBgn0022774 transcript:FBtr0074961[more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phykpl4.258e-17553.975-phosphohydroxy-L-lysine phospho-lyase [Source:ZF... [more]
etnppl4.764e-17152.39ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
agxt21.257e-8836.18alanine--glyoxylate aminotransferase 2 [Source:ZFI... [more]
oat7.141e-3125.06ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GE... [more]
oat5.241e-3025.19ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mycl6.525e-17754.88MYCL proto-oncogene, bHLH transcription factor [So... [more]
mycl9.238e-17754.88MYCL proto-oncogene, bHLH transcription factor [So... [more]
mycl8.426e-17153.77MYCL proto-oncogene, bHLH transcription factor [So... [more]
mycl2.558e-16953.74MYCL proto-oncogene, bHLH transcription factor [So... [more]
mycl3.708e-16954.74MYCL proto-oncogene, bHLH transcription factor [So... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Etnppl2.302e-17954.21ethanolamine phosphate phospholyase [Source:MGI Sy... [more]
Etnppl2.302e-17954.21ethanolamine phosphate phospholyase [Source:MGI Sy... [more]
Etnppl4.067e-17253.08ethanolamine phosphate phospholyase [Source:MGI Sy... [more]
Phykpl1.093e-16650.575-phosphohydroxy-L-lysine phospholyase [Source:MGI... [more]
Phykpl3.327e-16650.575-phosphohydroxy-L-lysine phospholyase [Source:MGI... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TBG4|AT2L1_HUMAN2.268e-18054.44Ethanolamine-phosphate phospho-lyase OS=Homo sapie... [more]
sp|Q6DEB1|AT2L1_XENLA2.678e-17954.57Ethanolamine-phosphate phospho-lyase OS=Xenopus la... [more]
sp|Q8BWU8|AT2L1_MOUSE1.610e-17854.21Ethanolamine-phosphate phospho-lyase OS=Mus muscul... [more]
sp|Q5E9S4|AT2L1_BOVIN1.761e-17653.08Ethanolamine-phosphate phospho-lyase OS=Bos taurus... [more]
sp|Q7SY54|AT2L1_DANRE3.597e-17052.39Ethanolamine-phosphate phospho-lyase OS=Danio reri... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DUR50.000e+056.42Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G1A50.000e+056.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3H3Y70.000e+056.395-phosphohydroxy-L-lysine phospho-lyase-like OS=Li... [more]
A0A402E8N60.000e+056.26Uncharacterized protein (Fragment) OS=Paroedura pi... [more]
A0A210QVE40.000e+055.86Alanine--glyoxylate aminotransferase 2-like OS=Miz... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etnppl3.484e-17753.53ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
phykpl1.270e-17552.905-phosphohydroxy-L-lysine phospho-lyase-like [Sour... [more]
phykpl5.259e-15749.335-phosphohydroxy-L-lysine phospho-lyase-like [Sour... [more]
agxt21.135e-9235.86alanine--glyoxylate aminotransferase 2 [Source:ZFI... [more]
oat1.970e-3125.55ornithine aminotransferase [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
etnppl4.128e-17253.81ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
ENSPMAT00000003245.13.216e-2240.48pep scaffold:Pmarinus_7.0:GL492368:93:2350:-1 gene... [more]
abat6.962e-1723.024-aminobutyrate aminotransferase [Source:ZFIN;Acc:... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
CAR26.897e-4427.46L-ornithine transaminase (OTAse); catalyzes the se... [more]
ARG84.987e-3226.39Acetylornithine aminotransferase; catalyzes the fo... [more]
BIO31.842e-1623.657,8-diamino-pelargonic acid aminotransferase (DAPA... [more]
UGA13.316e-1323.75Gamma-aminobutyrate (GABA) transaminase; also know... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO409825.293e-14846.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349147.274e-8535.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486804.543e-2924.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342791.574e-1722.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
etnppl1.326e-17453.55ethanolamine-phosphate phospho-lyase [Source:NCBI ... [more]
phykpl1.484e-16852.235-phosphohydroxy-L-lysine phospho-lyase [Source:NC... [more]
phykpl1.517e-16852.355-phosphohydroxy-L-lysine phospho-lyase [Source:NC... [more]
agxt22.727e-8935.92alanine--glyoxylate aminotransferase 2 [Source:NCB... [more]
agxt22.620e-8234.89alanine--glyoxylate aminotransferase 2 [Source:NCB... [more]
back to top
BLAST of Ethanolamine-phosphate phospho-lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012656.10.000e+099.56SMESG000012656.1[more]
SMESG000041460.11.073e-9038.28SMESG000041460.1[more]
SMESG000041460.14.975e-7638.72SMESG000041460.1[more]
SMESG000055175.17.921e-2725.18SMESG000055175.1[more]
SMESG000037567.11.494e-926.51SMESG000037567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017986 ID=SMED30017986|Name=Ethanolamine-phosphate phospho-lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=1493bp
ATTGGTCACTTTAAATATTATATAAATTGTGGATTTCAATAAAAATTAAT
AATTTTTATAAAATGCAAAATGCTGACAAGAAATGCTTGGCAGAGGAATC
ATGGAATGTGACTTATTCCAAAGAGAAAACAATAGAATTAAGACAAAAAT
ACATTGGATCATCCGTTCAAATATTTTTCTCCGAAGATCCTATTAAAATA
ATTAAAGGCAGTGGTCAATATATGTATGACGAAAACAATATCCGATATTT
GGATTGCATCAACAATGTTGCTCATGTTGGGCACAGTCATCCATATATCA
CGTCAGCGTGCGTACAACAGATGTCATTATTGAACACGAATTGCCGATAT
TTGCATGACAATATTGTTCACTTAGCCGAACGACTGACAAATACTTTACC
AGACTCTTTGGAAATTTGTTATTTCGTTAATTCAGGATCCGAAGCAAATG
ATCTTGCTATGCGTATTGCTCGATATTATACAAAAAGCAAAGAAACTCTT
GTTCTTGAGCATGCATATCATGGTAATTTATTATCCATGACTCAAATAAG
TCCGTATAAGTTAAACAAAAAAAATTGTGAAGAAACCTTACCTCCATGGG
CTCATGTTGTTCCGACTCCTGATAGATACAGAGGAAAATACAGAGATAAC
GAATATTCTATTGAAAAACTATCAGATTTATATGCTGAAGATGTTAGAAA
AGTTTGTGAATCTTTACGAGAGAAAGGCAAAAGTGTTGGTATGTTTTACT
TAGAATCAATGCAAAGTTGTGGTGGTCAGGTTATTTTTCCAAAATGTTAT
TGGGAAAAAATTTGCAAAATTATTCATGAATACGGAGGAGTGATAATTGC
TGATGAAGTTCAAACTGGCTTCGGAAGGGTTGGCAATTCCTTTTGGGCAT
TCCAGCTAAACGATAGTGATATTCGCCCCGATATTGTCACAATGGGTAAA
CCAATGGGTAATGGCTATCCTGTGGCCGCTGTCGTTACAACTAGAAAAAT
ATCAGAAGCTTTTCGTAGAGGTCCTGACTACTTTAATACGTTTGGCGGTA
GTCCAGTATCTTGTGCCATTGCTCTTGCGGTTTTAGACATAATGGAAAAT
GAAAAGCTGCAAGAAAAGGCTCGAACAATTGGCAACTATTTAAAACAACA
GCTCTTTTTAATGATGAATGATTTGAATATAATTGGCGATGTGAGAGGTT
CTGGATTATTTCTTGGGATTGATTTAGTGAAAAGCAGACAAACAAGGGAA
CCTGCAACCGATGAGGCAAAATTGGCTTTGCGACGATTAAAGGAAAAACA
AATAATAATGAGCACAGATGGACCTTACGACAATATTCTAAAGTTCAAGC
CGCCAATGTGCTTCAGCGAAAATGATGCCGACTTTTTATTGGATAATTTA
CGCGTTGTGCTAAAAGGAATTCAGGATGAACAATAATAATTAGCGATATT
TCAATCTCTGAATTTCATTTCTGATTTTTATATTTTATAAAAT
back to top

protein sequence of SMED30017986-orf-1

>SMED30017986-orf-1 ID=SMED30017986-orf-1|Name=SMED30017986-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=458bp
MQNADKKCLAEESWNVTYSKEKTIELRQKYIGSSVQIFFSEDPIKIIKGS
GQYMYDENNIRYLDCINNVAHVGHSHPYITSACVQQMSLLNTNCRYLHDN
IVHLAERLTNTLPDSLEICYFVNSGSEANDLAMRIARYYTKSKETLVLEH
AYHGNLLSMTQISPYKLNKKNCEETLPPWAHVVPTPDRYRGKYRDNEYSI
EKLSDLYAEDVRKVCESLREKGKSVGMFYLESMQSCGGQVIFPKCYWEKI
CKIIHEYGGVIIADEVQTGFGRVGNSFWAFQLNDSDIRPDIVTMGKPMGN
GYPVAAVVTTRKISEAFRRGPDYFNTFGGSPVSCAIALAVLDIMENEKLQ
EKARTIGNYLKQQLFLMMNDLNIIGDVRGSGLFLGIDLVKSRQTREPATD
EAKLALRRLKEKQIIMSTDGPYDNILKFKPPMCFSENDADFLLDNLRVVL
KGIQDEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: molecular function
TermDefinition
GO:0016829lyase activity
GO:0050459ethanolamine-phosphate phospho-lyase activity
GO:0008483transaminase activity
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR005814Aminotrans_3
IPR015421PyrdxlP-dep_Trfase_major
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015424PyrdxlP-dep_Trfase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 76..348
e-value: 2.1E-135
score: 453.4
IPR005814Aminotransferase class-IIIPIRSFPIRSF000521Transaminase_4ab_Lys_Orncoord: 145..453
e-value: 1.4E-29
score: 100.5
coord: 1..170
e-value: 2.1E-5
score: 20.7
IPR005814Aminotransferase class-IIIPFAMPF00202Aminotran_3coord: 44..447
e-value: 7.3E-77
score: 258.7
IPR005814Aminotransferase class-IIIPROSITEPS00600AA_TRANSFER_CLASS_3coord: 261..301
IPR005814Aminotransferase class-IIICDDcd00610OAT_likecoord: 42..450
e-value: 2.80146E-132
score: 386.154
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 43..446
e-value: 2.1E-135
score: 453.4
NoneNo IPR availablePANTHERPTHR45688:SF2ALANINE--GLYOXYLATE AMINOTRANSFERASE 2-LIKEcoord: 17..456
NoneNo IPR availablePANTHERPTHR45688FAMILY NOT NAMEDcoord: 17..456
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 42..451