ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30017971
Length (bp)3893
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30017971) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30017971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30017971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30017971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017971SMESG000026132.1 dd_Smed_v4_6201_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 355.525 bits (911), Expect = 4.634e-103
Identity = 288/1019 (28.26%), Postives = 496/1019 (48.68%), Query Frame = 1
Query:  700 YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLN-----GSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEF-DSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS------IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLT 3690
            +L+S+GANPN+++     P+H A    N    + L++   ID+ L+     T + +AC  N+ E  ++LL          + GC P H A   G+ + ++++++  E+     ++ +  +N    TPLH AV+NG  +  K+CL+ GA ++ V     +A+H AA QG+ E+VKL++S  +      N T+   +T LH A+  +H ++  YLI  GADI   D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  +  K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V LLL HNADI +     +         L  A+ N  ++  L I++S +W+  L+  + +  G    P+ ++I  +P+  + +   C + +++     DY I YNF++L+           +E  KK       + +  VI + ++                             L  MV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   ++  +P   +   N T  +N       I       L+K         C  ++ + ++ G  KEA Q+   + NYF  + N++E ++Y    + V+ +      + +    QWQ GA++ +   MN +L++++    GIF+VM   +L T +R   +F   + AF  +FYILL  Q  F+S L SIIQT  M +G++ + +S              L F  +V++TIF      + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   +   VYPN+  S      I+  LF  G E+R+++   D+  +ME LK  QK   + LT
Sbjct:  116 FLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASF--------LHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGN-KCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCP---------LEFTKK-------TPTQDVIYEPLT----------------------------ALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAF---NSTGIINETSDHSEILDTTNSYLIK--------TCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLF-----VEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIF------VPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTG-EIRQEIPNADKSLEMEILK--QKYRLKDLT 1055          

HSP 2 Score: 174.096 bits (440), Expect = 2.965e-43
Identity = 141/534 (26.40%), Postives = 245/534 (45.88%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAE-----KNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG +E +  + + +   + + ++ +D    +PLH A   N +E VK L+    AN N+ N   + P+H A +    +  K+   H+    N  G   N A +                     T N+  +  L+ KGA P   + +GC P+H AA  G++   E +++  E       + I   +N   TPLHLA  +   E+ KM L +   +   E+  C   H A  +G  ++V ++I       ++   +   +  ++T LH A    H + A   +  GA +N +   GRS L LA    S  +V LL+S  A  ++ +   +  LH   +     KN       + +    +   D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DED NT LH AA+ G+ K + LLL++ AD
Sbjct:   67 LHYAAAEGQIELMEKITRDS---SLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRG-ANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACT-----------------TNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDI---VNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEDGNTALHFAAREGHAKAVALLLSHNAD 573          

HSP 3 Score: 99.3673 bits (246), Expect = 2.971e-20
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 1
Query: 1177 LHLAAHQGSIEMVKLLVSFEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHC-DINVTEKGNKSALYLAVEHSYSDATKTII--------SDENGKKLLHIPDFKG-----------------------NF-------PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDS--NTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKN--GHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNG 2127
            LH AA +G IE+++  ++ +++  V +++     TPLH A EKN ++ V++L+ +GA+   R+ +   PL IA    + E +K+L+++   D+N+  +   +A+ +A   + S+A + ++        S++ G   +H   F G                       NF       PLH+A ++G+ +++++ +D GA  D   +   T +H AA  G T IVK+++     S+ I    D    T LH A+   + ++   L++ GAD N  +    S L  A    +     +LL  GAQVD  D      L+L  +   G   L    ++    I   V  + ND   GC PL  A   G
Sbjct:   67 LHYAAAEGQIELMEK-ITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQ-QIKELVMDEDND---GCTPLHYACRQG 424          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 334.339 bits (856), Expect = 3.241e-97
Identity = 273/970 (28.14%), Postives = 476/970 (49.07%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEF-DSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS------IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATT 3678
            ID+ L+     T + +AC  N+ E  ++LL          + GC P H A   G+ + ++++++  E+     ++ +  +N    TPLH AV+NG  +  K+CL+ GA ++ V     +A+H AA QG+ E+VKL++S  +      N T+   +T LH A+  +H ++  YLI  GADI   D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  +  K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA   + + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V LLL HNADI +     +         L  A+ N  ++  L I++S +W+  L+  + +  G    P+ ++I  +P+  + +   C + +++     DY I YNF++L+           +E  KK       + +  VI + ++                             L  MV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   ++  +P   +   N T  +N +  +   +IL      +  + C  ++ + ++ G  KEA Q+   + NYF  + N++E ++Y    + V+ +      + +    QWQ GA++ +   MN +L++++    GIF+VM   +L T +R   +F   + AF  +FYILL  Q  F+S L SIIQT  M +G++ + +S              L F  +V++TIF      + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   +   VYPN+  S      I+  LF  G E+R+++   D+  +ME LK   + TT
Sbjct:    8 IDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDH-NGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASF--------LHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGN-KCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCP---------LEFTKK-------TPTQDVIYEPLT----------------------------ALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAF---NSTGIINET--SDHSEILDTTN-SYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLF-----VEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIF------VPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTG-EIRQEIPNADKSLEMEILKQKYRKTT 905          

HSP 2 Score: 156.377 bits (394), Expect = 6.265e-38
Identity = 113/405 (27.90%), Postives = 195/405 (48.15%), Query Frame = 1
Query:  676 TKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAE-----KNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            T N+  +  L+ KGA P   + +GC P+H AA  G++   E +++  E       + I   +N   TPLHLA  +   E+ KM L +   +   E+  C   H A  +G  ++V ++I       ++   +   +  ++T LH A    H + A   +  GA +N +   GRS L LA    S  +V LL+S  A  ++ +   +  LH   +     KN       + +    +   D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DED NT LH AA+ G+ K + LLL++ AD
Sbjct:   27 TNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDI---VNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEDGNTALHFAAREGHAKAVALLLSHNAD 425          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 234.958 bits (598), Expect = 8.068e-62
Identity = 186/623 (29.86%), Postives = 295/623 (47.35%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            +H  AR  D    + L++ +P       ++L     +PLH AA + +L   ++L+    A+VN   +  +TP+H A+R R     +        Q E+ TK  L     L+ A      R+ E   +   P    TKN    +++ ++G            +  I D      TP+H AA  G+   A+ L+     D   K N       TPLH+AC  NH  + ++LL +  ++    E+G  P H+A   G++ +V  L+++    +         N   +TPLH A + GH + AK  L+  A VNA     ++ LH AA  G   MVKLL+   AN N+      TPLH AA + HV+ V  L+EK A         +TPL +AA YG     +LL++     N   K   + L++AV H+  D  K ++         H P + G  PLHIA +    ++ + L+  G   + ++ +  TP+HLAA+ G   +V +L+  SKQ+     ++   TPLHL A+ G+  V  +L+ +G   +A      + L  A+  GN+K  + LLQ+ A V++  K   +PL+ A + GH  +VTLLLK+ A  +  V+ D   PL
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENLNVAQLLLNRG-ASVNFTPQNGITPLHIASR-RGNVIMVRLLLDRGAQIETKTKDELT---PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLL-----DKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPN-------VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP---HSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLL--SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN-EVSSDGTTPL 804          

HSP 2 Score: 233.417 bits (594), Expect = 2.376e-61
Identity = 174/615 (28.29%), Postives = 298/615 (48.46%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK---ARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT----------------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       +PL+ AA+ NHLE VK L+E   AN NV  E+  TP+  A +   +   A  I++  K         +L    +   N  T      L++ +  P                 +N  V   L+++GA+ N     G TP+H A+ RGN +    L+ +  +I+ K KD   +TPLH A  + H  I+++LL     +  + + G  P H+A    ++  V +L++   + D+++        D+ TPLH A   GH   AKV L+KGA  N+    G + LH+A  +  + +++LL+   A+ +   +   TPLH A+   H+ +V+ L+++GA     ++   TPL +AA  GH E  K L++N   +N   K +++ L+ A    +++  K ++ +     L       G+ PLHIA R+G+ + V  L++  A      ++  TP+H+AAK+G+  + ++L+ER          ++  TPLH+A       +++LLL  G   ++   N  + L  AA +  ++ A+ LLQ G   ++     +TPL+LA + GH  +V LLL   A+ ++   G+     +G  PL      GH   A  ++K
Sbjct:  137 VNAQSQKGFTPLYMAAQENHLEVVKFLLENG-ANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGK------VRLPALHIAARNDDT-RTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDE--LTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATT---AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAA--GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNK----SGLTPLHLVAQEGHVPVADVLIK 722          

HSP 3 Score: 192.2 bits (487), Expect = 1.585e-48
Identity = 162/564 (28.72%), Postives = 263/564 (46.63%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA------DVGTLNSATEEMQKRLIEEEKTP------TKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V     L+        K  N      +SP+H AA+ +HL+CV++L++   A ++    + +TP+H AA    +R     +D   K NSR     T L++A       V  L   T      + E   TP        +  ++  L+ +GA+PN+ +    TP+H AA  G+ EVA   L    +++ K KD++  TPLH A    H  + K+LL ++ N       G  P HIA  EG+++ V  L++K   Q  ++K      + + TPLH A K G    A++ LE+ A  NA    G + LH+A H  ++++VKLL+    + +       TPLH AA++N V+V + L++ G    +  +   TPL +AA  GH E + LL+    + N+   GNKS L                                  PLH+  ++G+  +  +LI  G + D       TP+H+A+ +G   +VK L++   Q+ +  + +   +PLH AA+ G+  ++ LLL  GA  N  + +  + L  A   G +    VL
Sbjct:  309 LHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ--TPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTK------KGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNKSGLT---------------------------------PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH--QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 819          

HSP 4 Score: 168.703 bits (426), Expect = 2.352e-41
Identity = 133/507 (26.23%), Postives = 239/507 (47.14%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHF---------------------------------EIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQ-----DELSKMLQAVNR----------DYKT-------PLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSD 2163
            +DI   +   +  LHLA    H                                  E+ + L+    N+  Q + G  P ++A  E ++++V  L++   +Q     D  + +  A+ +          +Y T        LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  A+ N T +   TPLH A+ + +V +V+ L+++GA IE++  D  TPL  AA  GH    ++L+ +   I    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++ ++L+D GA  + +     TP+H+A K     ++++L+   K    ID   +S  TPLH+A+  G+  +++ LL  GA  N  N    + L  AA  G+ + A+ LLQN A+V++  K   TPL+ A + GH  +V LLL++NA+ ++           G  PL  A   GH +  LA+L+ +
Sbjct:   69 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHL------TPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL---KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTA-------GHTPLHIAAREGHVETVLALLEKE 559          

HSP 5 Score: 162.925 bits (411), Expect = 1.404e-39
Identity = 116/392 (29.59%), Postives = 192/392 (48.98%), Query Frame = 1
Query: 1063 DYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----LHI-------------------PDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKS 2160
            D  T    A ++G+ D A   L  G  +N     G + LHLA+ +G ++MV  L+  E     T K   T LH AA     +VV+ L+  GA++ ++    +TPL +AA   H E +K L++N  + NV  +   + L +A++  + +    +I+     K+    LHI                   PD     G  PLHIA    N  + Q+L++ GA  +   +   TP+H+A++ G   +V++L++R  Q  I  + +D  TPLH AA++G+ ++ ++LL++GA   A+  N LS +  AA   +L   ++LLQ  A++D +    +TPL++A   GH R+  +LL   A  + R        L G  PL  A    H +    +LK+
Sbjct:   44 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQ--IETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-------LNGFTPLHIACKKNHVRVMELLLKT 426          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 234.572 bits (597), Expect = 9.661e-62
Identity = 186/623 (29.86%), Postives = 295/623 (47.35%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            +H  AR  D    + L++ +P       ++L     +PLH AA + +L   ++L+    A+VN   +  +TP+H A+R R     +        Q E+ TK  L     L+ A      R+ E   +   P    TKN    +++ ++G            +  I D      TP+H AA  G+   A+ L+     D   K N       TPLH+AC  NH  + ++LL +  ++    E+G  P H+A   G++ +V  L+++    +         N   +TPLH A + GH + AK  L+  A VNA     ++ LH AA  G   MVKLL+   AN N+      TPLH AA + HV+ V  L+EK A         +TPL +AA YG     +LL++     N   K   + L++AV H+  D  K ++         H P + G  PLHIA +    ++ + L+  G   + ++ +  TP+HLAA+ G   +V +L+  SKQ+     ++   TPLHL A+ G+  V  +L+ +G   +A      + L  A+  GN+K  + LLQ+ A V++  K   +PL+ A + GH  +VTLLLK+ A  +  V+ D   PL
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENLNVAQLLLNRG-ASVNFTPQNGITPLHIASR-RGNVIMVRLLLDRGAQIETKTKDELT---PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLL-----DKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPN-------VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP---HSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLL--SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN-EVSSDGTTPL 771          

HSP 2 Score: 233.417 bits (594), Expect = 2.702e-61
Identity = 174/615 (28.29%), Postives = 298/615 (48.46%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK---ARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT----------------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       +PL+ AA+ NHLE VK L+E   AN NV  E+  TP+  A +   +   A  I++  K         +L    +   N  T      L++ +  P                 +N  V   L+++GA+ N     G TP+H A+ RGN +    L+ +  +I+ K KD   +TPLH A  + H  I+++LL     +  + + G  P H+A    ++  V +L++   + D+++        D+ TPLH A   GH   AKV L+KGA  N+    G + LH+A  +  + +++LL+   A+ +   +   TPLH A+   H+ +V+ L+++GA     ++   TPL +AA  GH E  K L++N   +N   K +++ L+ A    +++  K ++ +     L       G+ PLHIA R+G+ + V  L++  A      ++  TP+H+AAK+G+  + ++L+ER          ++  TPLH+A       +++LLL  G   ++   N  + L  AA +  ++ A+ LLQ G   ++     +TPL+LA + GH  +V LLL   A+ ++   G+     +G  PL      GH   A  ++K
Sbjct:  104 VNAQSQKGFTPLYMAAQENHLEVVKFLLENG-ANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGK------VRLPALHIAARNDDT-RTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDE--LTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATT---AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAA--GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNK----SGLTPLHLVAQEGHVPVADVLIK 689          

HSP 3 Score: 191.815 bits (486), Expect = 1.670e-48
Identity = 162/564 (28.72%), Postives = 263/564 (46.63%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA------DVGTLNSATEEMQKRLIEEEKTP------TKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V     L+        K  N      +SP+H AA+ +HL+CV++L++   A ++    + +TP+H AA    +R     +D   K NSR     T L++A       V  L   T      + E   TP        +  ++  L+ +GA+PN+ +    TP+H AA  G+ EVA   L    +++ K KD++  TPLH A    H  + K+LL ++ N       G  P HIA  EG+++ V  L++K   Q  ++K      + + TPLH A K G    A++ LE+ A  NA    G + LH+A H  ++++VKLL+    + +       TPLH AA++N V+V + L++ G    +  +   TPL +AA  GH E + LL+    + N+   GNKS L                                  PLH+  ++G+  +  +LI  G + D       TP+H+A+ +G   +VK L++   Q+ +  + +   +PLH AA+ G+  ++ LLL  GA  N  + +  + L  A   G +    VL
Sbjct:  276 LHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ--TPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTK------KGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNKSGLT---------------------------------PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH--QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 168.703 bits (426), Expect = 2.568e-41
Identity = 133/507 (26.23%), Postives = 239/507 (47.14%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHF---------------------------------EIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQ-----DELSKMLQAVNR----------DYKT-------PLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSD 2163
            +DI   +   +  LHLA    H                                  E+ + L+    N+  Q + G  P ++A  E ++++V  L++   +Q     D  + +  A+ +          +Y T        LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  A+ N T +   TPLH A+ + +V +V+ L+++GA IE++  D  TPL  AA  GH    ++L+ +   I    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++ ++L+D GA  + +     TP+H+A K     ++++L+   K    ID   +S  TPLH+A+  G+  +++ LL  GA  N  N    + L  AA  G+ + A+ LLQN A+V++  K   TPL+ A + GH  +V LLL++NA+ ++           G  PL  A   GH +  LA+L+ +
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHL------TPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL---KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTA-------GHTPLHIAAREGHVETVLALLEKE 526          

HSP 5 Score: 162.54 bits (410), Expect = 1.698e-39
Identity = 116/392 (29.59%), Postives = 192/392 (48.98%), Query Frame = 1
Query: 1063 DYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----LHI-------------------PDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKS 2160
            D  T    A ++G+ D A   L  G  +N     G + LHLA+ +G ++MV  L+  E     T K   T LH AA     +VV+ L+  GA++ ++    +TPL +AA   H E +K L++N  + NV  +   + L +A++  + +    +I+     K+    LHI                   PD     G  PLHIA    N  + Q+L++ GA  +   +   TP+H+A++ G   +V++L++R  Q  I  + +D  TPLH AA++G+ ++ ++LL++GA   A+  N LS +  AA   +L   ++LLQ  A++D +    +TPL++A   GH R+  +LL   A  + R        L G  PL  A    H +    +LK+
Sbjct:   11 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQ--IETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-------LNGFTPLHIACKKNHVRVMELLLKT 393          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 234.572 bits (597), Expect = 1.082e-61
Identity = 186/623 (29.86%), Postives = 295/623 (47.35%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            +H  AR  D    + L++ +P       ++L     +PLH AA + +L   ++L+    A+VN   +  +TP+H A+R R     +        Q E+ TK  L     L+ A      R+ E   +   P    TKN    +++ ++G            +  I D      TP+H AA  G+   A+ L+     D   K N       TPLH+AC  NH  + ++LL +  ++    E+G  P H+A   G++ +V  L+++    +         N   +TPLH A + GH + AK  L+  A VNA     ++ LH AA  G   MVKLL+   AN N+      TPLH AA + HV+ V  L+EK A         +TPL +AA YG     +LL++     N   K   + L++AV H+  D  K ++         H P + G  PLHIA +    ++ + L+  G   + ++ +  TP+HLAA+ G   +V +L+  SKQ+     ++   TPLHL A+ G+  V  +L+ +G   +A      + L  A+  GN+K  + LLQ+ A V++  K   +PL+ A + GH  +VTLLLK+ A  +  V+ D   PL
Sbjct:  177 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENLNVAQLLLNRG-ASVNFTPQNGITPLHIASR-RGNVIMVRLLLDRGAQIETKTKDELT---PLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLL-----DKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPN-------VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP---HSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLL--SKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN-EVSSDGTTPL 771          

HSP 2 Score: 233.032 bits (593), Expect = 3.025e-61
Identity = 174/615 (28.29%), Postives = 298/615 (48.46%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK---ARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT----------------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       +PL+ AA+ NHLE VK L+E   AN NV  E+  TP+  A +   +   A  I++  K         +L    +   N  T      L++ +  P                 +N  V   L+++GA+ N     G TP+H A+ RGN +    L+ +  +I+ K KD   +TPLH A  + H  I+++LL     +  + + G  P H+A    ++  V +L++   + D+++        D+ TPLH A   GH   AKV L+KGA  N+    G + LH+A  +  + +++LL+   A+ +   +   TPLH A+   H+ +V+ L+++GA     ++   TPL +AA  GH E  K L++N   +N   K +++ L+ A    +++  K ++ +     L       G+ PLHIA R+G+ + V  L++  A      ++  TP+H+AAK+G+  + ++L+ER          ++  TPLH+A       +++LLL  G   ++   N  + L  AA +  ++ A+ LLQ G   ++     +TPL+LA + GH  +V LLL   A+ ++   G+     +G  PL      GH   A  ++K
Sbjct:  104 VNAQSQKGFTPLYMAAQENHLEVVKFLLENG-ANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGK------VRLPALHIAARNDDT-RTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDE--LTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATT---AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAA--GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNK----SGLTPLHLVAQEGHVPVADVLIK 689          

HSP 3 Score: 191.815 bits (486), Expect = 1.999e-48
Identity = 162/564 (28.72%), Postives = 263/564 (46.63%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA------DVGTLNSATEEMQKRLIEEEKTP------TKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V     L+        K  N      +SP+H AA+ +HL+CV++L++   A ++    + +TP+H AA    +R     +D   K NSR     T L++A       V  L   T      + E   TP        +  ++  L+ +GA+PN+ +    TP+H AA  G+ EVA   L    +++ K KD++  TPLH A    H  + K+LL ++ N       G  P HIA  EG+++ V  L++K   Q  ++K      + + TPLH A K G    A++ LE+ A  NA    G + LH+A H  ++++VKLL+    + +       TPLH AA++N V+V + L++ G    +  +   TPL +AA  GH E + LL+    + N+   GNKS L                                  PLH+  ++G+  +  +LI  G + D       TP+H+A+ +G   +VK L++   Q+ +  + +   +PLH AA+ G+  ++ LLL  GA  N  + +  + L  A   G +    VL
Sbjct:  276 LHCAARNGHVRISEILLDHGAPIQAKTKN-----GLSPIHMAAQGDHLDCVRLLLQ-YDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ--TPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTK------KGF-TPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNL---GNKSGLT---------------------------------PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH--QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 168.318 bits (425), Expect = 2.750e-41
Identity = 133/507 (26.23%), Postives = 239/507 (47.14%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHF---------------------------------EIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQ-----DELSKMLQAVNR----------DYKT-------PLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSD 2163
            +DI   +   +  LHLA    H                                  E+ + L+    N+  Q + G  P ++A  E ++++V  L++   +Q     D  + +  A+ +          +Y T        LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  A+ N T +   TPLH A+ + +V +V+ L+++GA IE++  D  TPL  AA  GH    ++L+ +   I    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++ ++L+D GA  + +     TP+H+A K     ++++L+   K    ID   +S  TPLH+A+  G+  +++ LL  GA  N  N    + L  AA  G+ + A+ LLQN A+V++  K   TPL+ A + GH  +V LLL++NA+ ++           G  PL  A   GH +  LA+L+ +
Sbjct:   36 VDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHL------TPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL---KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTA-------GHTPLHIAAREGHVETVLALLEKE 526          

HSP 5 Score: 162.54 bits (410), Expect = 1.670e-39
Identity = 116/392 (29.59%), Postives = 192/392 (48.98%), Query Frame = 1
Query: 1063 DYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----LHI-------------------PDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKS 2160
            D  T    A ++G+ D A   L  G  +N     G + LHLA+ +G ++MV  L+  E     T K   T LH AA     +VV+ L+  GA++ ++    +TPL +AA   H E +K L++N  + NV  +   + L +A++  + +    +I+     K+    LHI                   PD     G  PLHIA    N  + Q+L++ GA  +   +   TP+H+A++ G   +V++L++R  Q  I  + +D  TPLH AA++G+ ++ ++LL++GA   A+  N LS +  AA   +L   ++LLQ  A++D +    +TPL++A   GH R+  +LL   A  + R        L G  PL  A    H +    +LK+
Sbjct:   11 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQ--IETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-------LNGFTPLHIACKKNHVRVMELLLKT 393          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 468.003 bits (1203), Expect = 1.445e-143
Identity = 386/1213 (31.82%), Postives = 602/1213 (49.63%), Query Frame = 1
Query:  271 NHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSA--LHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGAD-IESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYL--------AVEH------------------SYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE--------IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPY-----------LYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRR--RYIIRKLTVYPNRESSIYKTLF-GIGREVRRQ----MCKDDQLDDM-ERLKLHQKATTEQLTEMKFKLRNLHSQNHLM 3738
            N RSI  +H+ AREG+V  L    ++   KA   VN  D D M+PLHYAAR+ + + VK+L+ + +A  N  N E  TP+H A++Y                        +     + S  +E Q     +  T TK   +I  LVS+ A  +  + Y  TP+HYAAM+ N  A   L+KL + D+  +D+  MTPL LAC H   EI + L+ +++N+  +++     FHI    G  + ++M++    D  E  K L   N + KTPL  AV+  H +  K  L+     N+  +  R    +H AA +G +E++K LV    N N  N++   PLH AA+ N ++VV YLIE+  D I+  D    TPL++A ++   + ++ L+    ++ +T+K  ++ +++        +VE+                  S +  T  I+S++  + ++++ D   N P+HI   +G  +++Q+L   GA     NE+E T +H AA  G+T  V+ L+E   + L++ +DE  N+ LHLAA+SG+    ++LL+ GADK A+N  + + L  A   G L+  Q L+  GAQ++S    K T L+ A   G++ +V   +     I  R          G    D A +N H+  A A L++D+W+        I L      +     TP R L+ K P++A  V   C +  SK       ++ YNFEFL+D+Y                 V D+     +I        YDE+ KL   A+ Y  +   + K HPL +M    +  LL+H +   LL+ KWN  G  +YY  L +YL +++SL  Y+   + PY            YF  N+T       C Q+              + K II  + V  ++ E  QL   +  Y  + EN ++  +Y  A +TV D S C    GVR+ WQW   A+  F   +NL+  IRK+P FGIFVVMF D++ TF RF P+F LFI AF+ +FY++L N+  F+++  S ++TTVM IGE EF  IF+     +        +  V   +F  F ++M+I+ MNLLVGLAVDDIK VQEKA L+R+ MQV L L++E  +  FI+R  +Y   +   +P     ++KT F G     RR+    +  D ++D+M ER        T++L     KL+N+     +M
Sbjct:   49 NLRSI--IHQSAREGNVNAL----QEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSK-NALPNTKNREGDTPLHIASKY------------------------IYGYSDICSIIDEDQADSARKYNTATKK--IINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKL-KADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMM--DHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKK-NSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLM-KDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDE-------EGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNC-IEKSKEETDSTQSVAYNFEFLDDTYMMRC-------------VSDDGTGEQLI---GCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENET-------CPQINTT-------KPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPY--GKLHKTGFAGWWSNFRRRFGLSVSTDPEIDEMYEREAEFTSEMTQKLQNQAAKLKNIQENIDVM 1182          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 467.233 bits (1201), Expect = 2.486e-143
Identity = 386/1213 (31.82%), Postives = 602/1213 (49.63%), Query Frame = 1
Query:  271 NHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSA--LHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGAD-IESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYL--------AVEH------------------SYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE--------IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPY-----------LYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRR--RYIIRKLTVYPNRESSIYKTLF-GIGREVRRQ----MCKDDQLDDM-ERLKLHQKATTEQLTEMKFKLRNLHSQNHLM 3738
            N RSI  +H+ AREG+V  L    ++   KA   VN  D D M+PLHYAAR+ + + VK+L+ + +A  N  N E  TP+H A++Y                        +     + S  +E Q     +  T TK   +I  LVS+ A  +  + Y  TP+HYAAM+ N  A   L+KL + D+  +D+  MTPL LAC H   EI + L+ +++N+  +++     FHI    G  + ++M++    D  E  K L   N + KTPL  AV+  H +  K  L+     N+  +  R    +H AA +G +E++K LV    N N  N++   PLH AA+ N ++VV YLIE+  D I+  D    TPL++A ++   + ++ L+    ++ +T+K  ++ +++        +VE+                  S +  T  I+S++  + ++++ D   N P+HI   +G  +++Q+L   GA     NE+E T +H AA  G+T  V+ L+E   + L++ +DE  N+ LHLAA+SG+    ++LL+ GADK A+N  + + L  A   G L+  Q L+  GAQ++S    K T L+ A   G++ +V   +     I  R          G    D A +N H+  A A L++D+W+        I L      +     TP R L+ K P++A  V   C +  SK       ++ YNFEFL+D+Y                 V D+     +I        YDE+ KL   A+ Y  +   + K HPL +M    +  LL+H +   LL+ KWN  G  +YY  L +YL +++SL  Y+   + PY            YF  N+T       C Q+              + K II  + V  ++ E  QL   +  Y  + EN ++  +Y  A +TV D S C    GVR+ WQW   A+  F   +NL+  IRK+P FGIFVVMF D++ TF RF P+F LFI AF+ +FY++L N+  F+++  S ++TTVM IGE EF  IF+     +        +  V   +F  F ++M+I+ MNLLVGLAVDDIK VQEKA L+R+ MQV L L++E  +  FI+R  +Y   +   +P     ++KT F G     RR+    +  D ++D+M ER        T++L     KL+N+     +M
Sbjct:   48 NLRSI--IHQSAREGNVNAL----QEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSK-NALPNTKNREGDTPLHIASKY------------------------IYGYSDICSIIDEDQADSARKYNTATKK--IINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKL-KADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMM--DHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKK-NSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLM-KDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDE-------EGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNC-IEKSKEETDSTQSVAYNFEFLDDTYMMRC-------------VSDDGTGEQLI---GCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENET-------CPQINTT-------KPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPY--GKLHKTGFAGWWSNFRRRFGLSVSTDPEIDEMYEREAEFTSEMTQKLQNQAAKLKNIQENIDVM 1181          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 226.868 bits (577), Expect = 1.060e-59
Identity = 178/632 (28.16%), Postives = 304/632 (48.10%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIK--QNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN---TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            +H  A++ D    + L++   NP    K          +PLH AA + H E V  L+ E  ANVN      ++P+H A ++ R       N  N         L L+    ++S T+++   L    ++   ++ V+  LV +GA  + +   G  P+H AA   +  AA  L+  + P  D+ +   + +TPLH+A    H  +AK+LL  S +   +   G  P HIAC +  IK+V++L+K           ++A      TPLH A   G  +     L++GA+ +  T  G + LHLAA     ++V++L+   A  +   + +QTPLH A+   +  +V  L++ GA+  +   D+Y+PL IAA  G  E   +L+ ++ D  +  K   + L+LA ++   +  + ++  E G  +    D +G     PLH+A    N+K+  +L++ GA      +   TP+H+AAK  +  I   L++        D +  S    TPLHL+A+ G+ ++  LL+  G+D  A+  N L+A+   A + ++  AQ+L  NGA+++S   A  TPL++AC  G   +V  L+++ AD+  +             PL  A   GH  C   +L+
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKS-------GFTPLHIAAHYGH-ENVGQLLLEKGANVNYQARHNISPLHVATKWGRT------NMAN---------LLLSRGAIIDSRTKDLLTPLHCAARS--GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTV---DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-------YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL--ERGTPV----DIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ-----FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-------YTPLHQAAQQGHNNCVRYLLE 776          

HSP 2 Score: 212.231 bits (539), Expect = 3.446e-55
Identity = 178/669 (26.61%), Postives = 297/669 (44.39%), Query Frame = 1
Query:  235 ESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--------KLPEIDIKLKDNES--------------------MTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            E  R    I+ +N   ++++H  ++EG  E +  LIK   R+A+  V+       + LH A+       V ILVE   ANVNV +    TP++ AA+          NH+                                          V+ YL+  GAN  +    G TP+  A  +G++     L+        +LP + I  K +++                     TPLH+A  + H  + ++LL    N+  Q      P H+A   G   M ++L+ +         ++ +  +D  TPLH A ++GH     + + +GA ++A T  G + LH+AA    ++  + L+   A  +       TPLH AA   HV+V + L+++ AD  SR ++ +TPL IA      + ++LL+K    I  T +   + L++A   ++  A   +I          +   +G  PLH+A R     +V++LI  GA  D +  E +TP+H+A++ G T IV +L++    S     D  S  PLH+AAK G  +V  +LL++ ADK        + L  A+  GNL+  ++LL+ G  VD   K ++TPL++A    +D++  LLL++ A  S + A        G  PL  A      + A  +L+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK---RQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENG-ANVNVQSVNGFTPLYMAAQE---------NHEE-----------------------------------------VVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR-------GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVA---AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGA--SAKAAAK-----NGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 184.111 bits (466), Expect = 1.735e-46
Identity = 129/393 (32.82%), Postives = 205/393 (52.16%), Query Frame = 1
Query:  946 GCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            G   F  A   G+++ V  L++   D       +   N +    LH A K GH +  +  +++ A V+A T  G +ALH+A+  G   +V +LV   AN NV +    TPL+ AA++NH +VV+YL++ GA+      D +TPL +A   GH   + +L++N     V       AL++A +   + A   ++ +E      H PD     G  PLHIA   G+E + Q+L++ GA  + +     +P+H+A K+GRT +  +L+ R   ++I    +D  TPLH AA+SG+ +V+ LL+  GA  +A+  N L+ L  AA   ++ AA+ LL + A VD +    +TPL++A   GH R+  LLL  +AD + R        L G  PL  A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTD-------INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV----RLPALHIAAKKDDTTAATLLLQNE------HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRG--AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-------LNGFTPLHIA 399          

HSP 4 Score: 173.326 bits (438), Expect = 3.646e-43
Identity = 141/528 (26.70%), Postives = 240/528 (45.45%), Query Frame = 1
Query:  364 KKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR-KARKIDFNHKNSRQ--NESG-TKLNLAD-VGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +  V+ + +D ++PLH AA   H+   K+L++  SA+ N       TP+H A +  R K  ++   ++ + +   ESG T L++A  +G +N                      +++YL+ +GANP+++   G                                   TPLHLA   N  ++ ++L+ +   +  Q      P HIA   GN  +V +L++   + +       A  RD  +PLH A K G  + A + L+  A    +T  G + LHLA+  G++E+V+LL+      ++  K   TPLH AA  N+ KV   L+E GA  ++   + YTPL IAA     E    L++   D N   +   + L+L+ +  + + +  +I  ENG  +    +  G   +H+  ++ +  + QIL + GA  + K     TP+H+A  FG+  +VK LVE      + ++   S TPLH AA+ G+   ++ LL  GA  N +     + L  A   G +   + L
Sbjct:  349 RAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAIN----------------------IVIYLLQQGANPDVETVRG----------------------------------ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-------ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--ENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGAD--VGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 226.868 bits (577), Expect = 1.060e-59
Identity = 178/632 (28.16%), Postives = 304/632 (48.10%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIK--QNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN---TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            +H  A++ D    + L++   NP    K          +PLH AA + H E V  L+ E  ANVN      ++P+H A ++ R       N  N         L L+    ++S T+++   L    ++   ++ V+  LV +GA  + +   G  P+H AA   +  AA  L+  + P  D+ +   + +TPLH+A    H  +AK+LL  S +   +   G  P HIAC +  IK+V++L+K           ++A      TPLH A   G  +     L++GA+ +  T  G + LHLAA     ++V++L+   A  +   + +QTPLH A+   +  +V  L++ GA+  +   D+Y+PL IAA  G  E   +L+ ++ D  +  K   + L+LA ++   +  + ++  E G  +    D +G     PLH+A    N+K+  +L++ GA      +   TP+H+AAK  +  I   L++        D +  S    TPLHL+A+ G+ ++  LL+  G+D  A+  N L+A+   A + ++  AQ+L  NGA+++S   A  TPL++AC  G   +V  L+++ AD+  +             PL  A   GH  C   +L+
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKS-------GFTPLHIAAHYGH-ENVGQLLLEKGANVNYQARHNISPLHVATKWGRT------NMAN---------LLLSRGAIIDSRTKDLLTPLHCAARS--GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTV---DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-------YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL--ERGTPV----DIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ-----FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-------YTPLHQAAQQGHNNCVRYLLE 776          

HSP 2 Score: 212.231 bits (539), Expect = 3.446e-55
Identity = 178/669 (26.61%), Postives = 297/669 (44.39%), Query Frame = 1
Query:  235 ESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--------KLPEIDIKLKDNES--------------------MTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            E  R    I+ +N   ++++H  ++EG  E +  LIK   R+A+  V+       + LH A+       V ILVE   ANVNV +    TP++ AA+          NH+                                          V+ YL+  GAN  +    G TP+  A  +G++     L+        +LP + I  K +++                     TPLH+A  + H  + ++LL    N+  Q      P H+A   G   M ++L+ +         ++ +  +D  TPLH A ++GH     + + +GA ++A T  G + LH+AA    ++  + L+   A  +       TPLH AA   HV+V + L+++ AD  SR ++ +TPL IA      + ++LL+K    I  T +   + L++A   ++  A   +I          +   +G  PLH+A R     +V++LI  GA  D +  E +TP+H+A++ G T IV +L++    S     D  S  PLH+AAK G  +V  +LL++ ADK        + L  A+  GNL+  ++LL+ G  VD   K ++TPL++A    +D++  LLL++ A  S + A        G  PL  A      + A  +L+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK---RQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENG-ANVNVQSVNGFTPLYMAAQE---------NHEE-----------------------------------------VVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR-------GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVA---AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGA--SAKAAAK-----NGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 184.111 bits (466), Expect = 1.735e-46
Identity = 129/393 (32.82%), Postives = 205/393 (52.16%), Query Frame = 1
Query:  946 GCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            G   F  A   G+++ V  L++   D       +   N +    LH A K GH +  +  +++ A V+A T  G +ALH+A+  G   +V +LV   AN NV +    TPL+ AA++NH +VV+YL++ GA+      D +TPL +A   GH   + +L++N     V       AL++A +   + A   ++ +E      H PD     G  PLHIA   G+E + Q+L++ GA  + +     +P+H+A K+GRT +  +L+ R   ++I    +D  TPLH AA+SG+ +V+ LL+  GA  +A+  N L+ L  AA   ++ AA+ LL + A VD +    +TPL++A   GH R+  LLL  +AD + R        L G  PL  A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTD-------INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV----RLPALHIAAKKDDTTAATLLLQNE------HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRG--AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-------LNGFTPLHIA 399          

HSP 4 Score: 173.326 bits (438), Expect = 3.646e-43
Identity = 141/528 (26.70%), Postives = 240/528 (45.45%), Query Frame = 1
Query:  364 KKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR-KARKIDFNHKNSRQ--NESG-TKLNLAD-VGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +  V+ + +D ++PLH AA   H+   K+L++  SA+ N       TP+H A +  R K  ++   ++ + +   ESG T L++A  +G +N                      +++YL+ +GANP+++   G                                   TPLHLA   N  ++ ++L+ +   +  Q      P HIA   GN  +V +L++   + +       A  RD  +PLH A K G  + A + L+  A    +T  G + LHLA+  G++E+V+LL+      ++  K   TPLH AA  N+ KV   L+E GA  ++   + YTPL IAA     E    L++   D N   +   + L+L+ +  + + +  +I  ENG  +    +  G   +H+  ++ +  + QIL + GA  + K     TP+H+A  FG+  +VK LVE      + ++   S TPLH AA+ G+   ++ LL  GA  N +     + L  A   G +   + L
Sbjct:  349 RAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAIN----------------------IVIYLLQQGANPDVETVRG----------------------------------ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-------ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--ENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGAD--VGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 226.483 bits (576), Expect = 1.120e-59
Identity = 178/632 (28.16%), Postives = 304/632 (48.10%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIK--QNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN---TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            +H  A++ D    + L++   NP    K          +PLH AA + H E V  L+ E  ANVN      ++P+H A ++ R       N  N         L L+    ++S T+++   L    ++   ++ V+  LV +GA  + +   G  P+H AA   +  AA  L+  + P  D+ +   + +TPLH+A    H  +AK+LL  S +   +   G  P HIAC +  IK+V++L+K           ++A      TPLH A   G  +     L++GA+ +  T  G + LHLAA     ++V++L+   A  +   + +QTPLH A+   +  +V  L++ GA+  +   D+Y+PL IAA  G  E   +L+ ++ D  +  K   + L+LA ++   +  + ++  E G  +    D +G     PLH+A    N+K+  +L++ GA      +   TP+H+AAK  +  I   L++        D +  S    TPLHL+A+ G+ ++  LL+  G+D  A+  N L+A+   A + ++  AQ+L  NGA+++S   A  TPL++AC  G   +V  L+++ AD+  +             PL  A   GH  C   +L+
Sbjct:  198 LHIAAKKDDTTAATLLLQNEHNPDVTSKS-------GFTPLHIAAHYGH-ENVGQLLLEKGANVNYQARHNISPLHVATKWGRT------NMAN---------LLLSRGAIIDSRTKDLLTPLHCAARS--GHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTV---DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK-------YRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL--ERGTPV----DIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQ-----FKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS-------YTPLHQAAQQGHNNCVRYLLE 776          

HSP 2 Score: 211.846 bits (538), Expect = 3.976e-55
Identity = 178/669 (26.61%), Postives = 297/669 (44.39%), Query Frame = 1
Query:  235 ESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--------KLPEIDIKLKDNES--------------------MTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            E  R    I+ +N   ++++H  ++EG  E +  LIK   R+A+  V+       + LH A+       V ILVE   ANVNV +    TP++ AA+          NH+                                          V+ YL+  GAN  +    G TP+  A  +G++     L+        +LP + I  K +++                     TPLH+A  + H  + ++LL    N+  Q      P H+A   G   M ++L+ +         ++ +  +D  TPLH A ++GH     + + +GA ++A T  G + LH+AA    ++  + L+   A  +       TPLH AA   HV+V + L+++ AD  SR ++ +TPL IA      + ++LL+K    I  T +   + L++A   ++  A   +I          +   +G  PLH+A R     +V++LI  GA  D +  E +TP+H+A++ G T IV +L++    S     D  S  PLH+AAK G  +V  +LL++ ADK        + L  A+  GNL+  ++LL+ G  VD   K ++TPL++A    +D++  LLL++ A  S + A        G  PL  A      + A  +L+
Sbjct:   51 ELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIK---RQAQ--VDAATRKGNTALHIASLAGQSLIVTILVENG-ANVNVQSVNGFTPLYMAAQE---------NHEE-----------------------------------------VVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSR-------GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVA---AFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYS--PLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGA--SAKAAAK-----NGYTPLHIAAKKNQMEIASTLLQ 644          

HSP 3 Score: 183.726 bits (465), Expect = 1.978e-46
Identity = 129/393 (32.82%), Postives = 205/393 (52.16%), Query Frame = 1
Query:  946 GCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            G   F  A   G+++ V  L++   D       +   N +    LH A K GH +  +  +++ A V+A T  G +ALH+A+  G   +V +LV   AN NV +    TPL+ AA++NH +VV+YL++ GA+      D +TPL +A   GH   + +L++N     V       AL++A +   + A   ++ +E      H PD     G  PLHIA   G+E + Q+L++ GA  + +     +P+H+A K+GRT +  +L+ R   ++I    +D  TPLH AA+SG+ +V+ LL+  GA  +A+  N L+ L  AA   ++ AA+ LL + A VD +    +TPL++A   GH R+  LLL  +AD + R        L G  PL  A
Sbjct:   33 GSASFLRAARAGDLEKVLELLRAGTD-------INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKV----RLPALHIAAKKDDTTAATLLLQNE------HNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRG--AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRA-------LNGFTPLHIA 399          

HSP 4 Score: 172.94 bits (437), Expect = 4.573e-43
Identity = 141/528 (26.70%), Postives = 240/528 (45.45%), Query Frame = 1
Query:  364 KKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR-KARKIDFNHKNSRQ--NESG-TKLNLAD-VGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +  V+ + +D ++PLH AA   H+   K+L++  SA+ N       TP+H A +  R K  ++   ++ + +   ESG T L++A  +G +N                      +++YL+ +GANP+++   G                                   TPLHLA   N  ++ ++L+ +   +  Q      P HIA   GN  +V +L++   + +       A  RD  +PLH A K G  + A + L+  A    +T  G + LHLA+  G++E+V+LL+      ++  K   TPLH AA  N+ KV   L+E GA  ++   + YTPL IAA     E    L++   D N   +   + L+L+ +  + + +  +I  ENG  +    +  G   +H+  ++ +  + QIL + GA  + K     TP+H+A  FG+  +VK LVE      + ++   S TPLH AA+ G+   ++ LL  GA  N +     + L  A   G +   + L
Sbjct:  349 RAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAIN----------------------IVIYLLQQGANPDVETVRG----------------------------------ETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSN-------ATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI--ENGSDVGAKAN-NGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGAD--VGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331823)

HSP 1 Score: 285.804 bits (730), Expect = 5.751e-79
Identity = 297/1155 (25.71%), Postives = 518/1155 (44.85%), Query Frame = 1
Query:  571 RQNESGT-----KLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE----------------------------------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQE-ETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN-----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHS-----YSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE---IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFG-------LVVY---------YCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEI--CKYIIVVMTVVGLVKEAAQLCLNRANYFSLE--NIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXX-------NQVTFNSLLNSIIQTTVMTIGELEFDSIF-NTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRN----LHSQNHLMTKMLTKI 3759
            R  ESG      +L +AD   +  A ++ + R    +        ++ Y+  +  + N +D  G TP+H A       A + L+ +P                                   IDI+       T LHLA  ++H E A++L+   +    +    G  P H A    + K +++  +  E +     +M+   + +   PLH AV  G   A ++CL+ GA ++   +   + +HLA  QG+I++VKL+   +        + T+    TPLH A+  +H  +V YL+ +GADI + D +  +PLL+AAS    +T+ LL++    I+V +   ++ L+  + +      +++      +    K LL+  D  G  PLH A RDG+ + ++ LI  GA  ++KN    +P+H AA++GR   V+ L++  K S II+E + +  TPLH++++ G+ +V+QLLLN GA    D   RN      L  AA  G  +  ++L    +  +D +DK   T L+LA        +++L+     +   V           + +D AI   + + ALA++  ++     +ALR+               LI  MP V E V  KC    +   D   + I Y+F FL+  +               F   DE    S+   +             P   L T              MV   R +LL H +    L+MKWN++G       L++Y         Y +L +    L +     +       +      +  N S+ +Q++    +ER+  +  I  C  +IVV  ++  ++E  Q+   + +Y  LE  N++  V+Y+ A V V      Q + G+     +   +++ F+S   L+LF+++    GI+VVMF ++L T I+ L +F + I AF  AFYILL+       N ++F+++  S+++T  M +GEL+F   + NT + +       +   + ++ I  +F+++M I+ MNLL+GLAV DI++V+  A L+R+ MQV L  E+E  +P    +R    +L  YPN           I R+       +D   D+     +      +L   + KLR+    L  Q+HL+  ++ K+
Sbjct:   97 RAAESGNLDDFKRLFMADNSRI--ALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRN-----PLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNV--------LDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLA------LIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFM--------------FAKIDEKTGESITTASP-----------IPLPALNT--------------MVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYI-LETVNLISWVLYISALVMV--TPAFQPDGGINT-IHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ------LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKM 1181          

HSP 2 Score: 108.227 bits (269), Expect = 2.769e-23
Identity = 115/441 (26.08%), Postives = 179/441 (40.59%), Query Frame = 1
Query:  376 NLLDIDK-----MSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKN-------NAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKL----KDNESMTPLHLACAHNHFEIAKMLLISSN--NLFDQEETGCIPFHIACGEGNIKMVDMLIK----------------------------------KSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN---FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCD-INVTEKGNKSALYLAVEHSYSDATKTIIS 1527
            N++DI +      + LH AA ++H EC +IL+ E  A    P      PIH AA+    K  ++ F     R                    EEM      E   P  +        AV L L S GA  + Q     TP+H A  +G     + + ++  ++ +L     D + MTPLH A   +H +I   L+      N  D+E     P  +A      K V +LI+                                    + Q +L  +L   +    +PLHYA ++GH  + +  +  GA +N       S LH AA  G    V+ L+  E      N ++    TPLH ++++ H +VVQ L+ +GA +  RD     PL +AA  G+ ETI+LL   H   ++  +K   +AL+LA   +   A   ++S
Sbjct:  215 NVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQR----------------GCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKS-GAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRS--PLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 635          

HSP 3 Score: 96.6709 bits (239), Expect = 9.725e-20
Identity = 81/333 (24.32%), Postives = 154/333 (46.25%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE--EEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLF---DQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVS 1230
            IS   H     +H    +G ++ +  + +  P + + C++  D+ KM+PLH A+ F+H + V  LV E  A++N  ++E  +P+  AA R   K   +          +     N+     +N        RL +  E+    +  A +  L+      N +D+ GC+P+HYA+  G+  + E L++L    I LK+N + +PLH A  +  +   + LL S    F   + +  G  P HI+  +G+ ++V +L+ +             ++RD+  + PL  A  +G+ +  ++     +  ++ V   G +ALHLA  +     + +L+S
Sbjct:  327 ISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEG-ADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG------RLTDFAEQVANCQTQAQLKLLL------NEKDSMGCSPLHYASRDGHIRSLENLIRLGAC-INLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGA----------LLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 635          

HSP 4 Score: 64.6994 bits (156), Expect = 5.553e-10
Identity = 59/267 (22.10%), Postives = 114/267 (42.70%), Query Frame = 1
Query: 1276 LHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVK--NEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGN-----------LKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLK 2037
            L AA   N     +  +   + I  +D    T    AA+      ++ +   + D N  +    + L++AVE    DA   ++S      +L   + K   P+H+A      K ++++     + D++   E  RT +HLAA +      +IL+     +       +   P+H AAK+   K +++   +G     R C +   + F  ++GN           +KA ++ L++GA++ +      TP++LAC  G   +V L+ +
Sbjct:   96 LRAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVL---NEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEF-DACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQ---RGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFE 355          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331824)

HSP 1 Score: 285.804 bits (730), Expect = 5.921e-79
Identity = 296/1155 (25.63%), Postives = 520/1155 (45.02%), Query Frame = 1
Query:  571 RQNESGT-----KLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE----------------------------------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQE-ETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN-----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHS-----YSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE---IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFG-------LVVY---------YCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEI--CKYIIVVMTVVGLVKEAAQLCLNRANYFSLE--NIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXX-------NQVTFNSLLNSIIQTTVMTIGELEFDSIF-NTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRN----LHSQNHLMTKMLTKI 3759
            R  ESG      +L +AD   +  A ++ + R    +        ++ Y+  +  + N +D  G TP+H A       A + L+ +P                                   IDI+       T LHLA  ++H E A++L+   +    +    G  P H A    + K +++  +  E +     +M+   + +   PLH AV  G   A ++CL+ GA ++   +   + +HLA  QG+I++VKL+   +        + T+    TPLH A+  +H  +V YL+ +GADI + D +  +PLL+AAS    +T+ LL++    I+V +   ++ L+  + +      +++      +    K LL+  D  G  PLH A RDG+ + ++ LI  GA  ++KN    +P+H AA++GR   V+ L++  K S II+E + +  TPLH++++ G+ +V+QLLLN GA    D   RN      L  AA  G  +  ++L    +  +D +DK   T L+LA        +++L+     +   V           + +D AI   + + ALA++  ++     +ALR+               LI  MP V E V  KC    +   D   + I Y+F   + +         +E  +KEF+                    D   +  P A + T              MV   R +LL H +    L+MKWN++G       L++Y         Y +L +    L +     +       +      +  N S+ +Q++    +ER+  +  I  C  +IVV  ++  ++E  Q+   + +Y  LE  N++  V+Y+ A V V      Q + G+     +   +++ F+S   L+LF+++    GI+VVMF ++L T I+ L +F + I AF  AFYILL+       N ++F+++  S+++T  M +GEL+F   + NT + +       +   + ++ I  +F+++M I+ MNLL+GLAV DI++V+  A L+R+ MQV L  E+E  +P    +R    +L  YPN           I R+       +D   D+     +      +L   + KLR+    L  Q+HL+  ++ K+
Sbjct:   97 RAAESGNLDDFKRLFMADNSRI--ALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRN-----PLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNV--------LDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLA------LIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQ------IEAKRKEFN--------------------DPKWRPAPLAVVNT--------------MVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYI-LETVNLISWVLYISALVMV--TPAFQPDGGINT-IHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ------LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKM 1180          

HSP 2 Score: 108.997 bits (271), Expect = 1.872e-23
Identity = 115/441 (26.08%), Postives = 179/441 (40.59%), Query Frame = 1
Query:  376 NLLDIDK-----MSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKN-------NAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKL----KDNESMTPLHLACAHNHFEIAKMLLISSN--NLFDQEETGCIPFHIACGEGNIKMVDMLIK----------------------------------KSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN---FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCD-INVTEKGNKSALYLAVEHSYSDATKTIIS 1527
            N++DI +      + LH AA ++H EC +IL+ E  A    P      PIH AA+    K  ++ F     R                    EEM      E   P  +        AV L L S GA  + Q     TP+H A  +G     + + ++  ++ +L     D + MTPLH A   +H +I   L+      N  D+E     P  +A      K V +LI+                                    + Q +L  +L   +    +PLHYA ++GH  + +  +  GA +N       S LH AA  G    V+ L+  E      N ++    TPLH ++++ H +VVQ L+ +GA +  RD     PL +AA  G+ ETI+LL   H   ++  +K   +AL+LA   +   A   ++S
Sbjct:  215 NVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQR----------------GCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKS-GAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRS--PLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLH-RDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 635          

HSP 3 Score: 97.0561 bits (240), Expect = 8.855e-20
Identity = 81/333 (24.32%), Postives = 154/333 (46.25%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE--EEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLF---DQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVS 1230
            IS   H     +H    +G ++ +  + +  P + + C++  D+ KM+PLH A+ F+H + V  LV E  A++N  ++E  +P+  AA R   K   +          +     N+     +N        RL +  E+    +  A +  L+      N +D+ GC+P+HYA+  G+  + E L++L    I LK+N + +PLH A  +  +   + LL S    F   + +  G  P HI+  +G+ ++V +L+ +             ++RD+  + PL  A  +G+ +  ++     +  ++ V   G +ALHLA  +     + +L+S
Sbjct:  327 ISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEG-ADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG------RLTDFAEQVANCQTQAQLKLLL------NEKDSMGCSPLHYASRDGHIRSLENLIRLGAC-INLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGA----------LLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 635          

HSP 4 Score: 65.4698 bits (158), Expect = 3.606e-10
Identity = 59/267 (22.10%), Postives = 114/267 (42.70%), Query Frame = 1
Query: 1276 LHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVK--NEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGN-----------LKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLK 2037
            L AA   N     +  +   + I  +D    T    AA+      ++ +   + D N  +    + L++AVE    DA   ++S      +L   + K   P+H+A      K ++++     + D++   E  RT +HLAA +      +IL+     +       +   P+H AAK+   K +++   +G     R C +   + F  ++GN           +KA ++ L++GA++ +      TP++LAC  G   +V L+ +
Sbjct:   96 LRAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVL---NEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEF-DACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQ---RGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFE 355          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331825)

HSP 1 Score: 285.419 bits (729), Expect = 6.985e-79
Identity = 273/1004 (27.19%), Postives = 474/1004 (47.21%), Query Frame = 1
Query:  700 YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE--IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQE-ETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN-----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHS-----YSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE---IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFG-------LVVY---------YCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEI--CKYIIVVMTVVGLVKEAAQLCLNRANYFSLE--NIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXX-------NQVTFNSLLNSIIQTTVMTIGELEFDSIF-NTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPN 3558
            YL+S   +  + +     P+H A    N+V + ++M      IDI+       T LHLA  ++H E A++L+   +    +    G  P H A    + K +++  +  E +     +M+   + +   PLH AV  G   A ++CL+ GA ++   +   + +HLA  QG+I++VKL+   +        + T+    TPLH A+  +H  +V YL+ +GADI + D +  +PLL+AAS    +T+ LL++    I+V +   ++ L+  + +      +++      +    K LL+  D  G  PLH A RDG+ + ++ LI  GA  ++KN    +P+H AA++GR   V+ L++  K S II+E + +  TPLH++++ G+ +V+QLLLN GA    D   RN      L  AA  G  +  ++L    +  +D +DK   T L+LA        +++L+     +   V           + +D AI   + + ALA++  ++     +ALR+               LI  MP V E V  KC    +   D   + I Y+F FL+  +               F   DE    S+   +             P   L T              MV   R +LL H +    L+MKWN++G       L++Y         Y +L +    L +     +       +      +  N S+ +Q++    +ER+  +  I  C  +IVV  ++  ++E  Q+   + +Y  LE  N++  V+Y+ A V V      Q + G+     +   +++ F+S   L+LF+++    GI+VVMF ++L T I+ L +F + I AF  AFYILL+       N ++F+++  S+++T  M +GEL+F   + NT + +       +   + ++ I  +F+++M I+ MNLL+GLAV DI++V+  A L+R+ MQV L  E+E  +P    +R    +L  YPN
Sbjct:  141 YLLSIPVDTGVLNEKKQAPVHLAT-ELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRN-----PLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNV--------LDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLA------LIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFM--------------FAKIDEKTGESITTASP-----------IPLPALNT--------------MVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYI-LETVNLISWVLYISALVMV--TPAFQPDGGINT-IHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ------LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPN 1075          

HSP 2 Score: 96.6709 bits (239), Expect = 9.499e-20
Identity = 81/333 (24.32%), Postives = 154/333 (46.25%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE--EEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLF---DQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVS 1230
            IS   H     +H    +G ++ +  + +  P + + C++  D+ KM+PLH A+ F+H + V  LV E  A++N  ++E  +P+  AA R   K   +          +     N+     +N        RL +  E+    +  A +  L+      N +D+ GC+P+HYA+  G+  + E L++L    I LK+N + +PLH A  +  +   + LL S    F   + +  G  P HI+  +G+ ++V +L+ +             ++RD+  + PL  A  +G+ +  ++     +  ++ V   G +ALHLA  +     + +L+S
Sbjct:  292 ISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEG-ADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG------RLTDFAEQVANCQTQAQLKLLL------NEKDSMGCSPLHYASRDGHIRSLENLIRLGAC-INLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGA----------LLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331826)

HSP 1 Score: 284.648 bits (727), Expect = 1.057e-78
Identity = 272/1004 (27.09%), Postives = 476/1004 (47.41%), Query Frame = 1
Query:  700 YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE--IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQE-ETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN-----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHS-----YSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE---IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFG-------LVVY---------YCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEI--CKYIIVVMTVVGLVKEAAQLCLNRANYFSLE--NIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXX-------NQVTFNSLLNSIIQTTVMTIGELEFDSIF-NTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPN 3558
            YL+S   +  + +     P+H A    N+V + ++M      IDI+       T LHLA  ++H E A++L+   +    +    G  P H A    + K +++  +  E +     +M+   + +   PLH AV  G   A ++CL+ GA ++   +   + +HLA  QG+I++VKL+   +        + T+    TPLH A+  +H  +V YL+ +GADI + D +  +PLL+AAS    +T+ LL++    I+V +   ++ L+  + +      +++      +    K LL+  D  G  PLH A RDG+ + ++ LI  GA  ++KN    +P+H AA++GR   V+ L++  K S II+E + +  TPLH++++ G+ +V+QLLLN GA    D   RN      L  AA  G  +  ++L    +  +D +DK   T L+LA        +++L+     +   V           + +D AI   + + ALA++  ++     +ALR+               LI  MP V E V  KC    +   D   + I Y+F   + +         +E  +KEF+                    D   +  P A + T              MV   R +LL H +    L+MKWN++G       L++Y         Y +L +    L +     +       +      +  N S+ +Q++    +ER+  +  I  C  +IVV  ++  ++E  Q+   + +Y  LE  N++  V+Y+ A V V      Q + G+     +   +++ F+S   L+LF+++    GI+VVMF ++L T I+ L +F + I AF  AFYILL+       N ++F+++  S+++T  M +GEL+F   + NT + +       +   + ++ I  +F+++M I+ MNLL+GLAV DI++V+  A L+R+ MQV L  E+E  +P    +R    +L  YPN
Sbjct:  141 YLLSIPVDTGVLNEKKQAPVHLAT-ELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRN-----PLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNV--------LDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLA------LIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQ------IEAKRKEFN--------------------DPKWRPAPLAVVNT--------------MVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYI-LETVNLISWVLYISALVMV--TPAFQPDGGINT-IHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ------LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPN 1074          

HSP 2 Score: 97.0561 bits (240), Expect = 8.289e-20
Identity = 81/333 (24.32%), Postives = 154/333 (46.25%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE--EEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLF---DQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVS 1230
            IS   H     +H    +G ++ +  + +  P + + C++  D+ KM+PLH A+ F+H + V  LV E  A++N  ++E  +P+  AA R   K   +          +     N+     +N        RL +  E+    +  A +  L+      N +D+ GC+P+HYA+  G+  + E L++L    I LK+N + +PLH A  +  +   + LL S    F   + +  G  P HI+  +G+ ++V +L+ +             ++RD+  + PL  A  +G+ +  ++     +  ++ V   G +ALHLA  +     + +L+S
Sbjct:  292 ISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEG-ADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG------RLTDFAEQVANCQTQAQLKLLL------NEKDSMGCSPLHYASRDGHIRSLENLIRLGAC-INLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGA----------LLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMS 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 214.542 bits (545), Expect = 3.785e-56
Identity = 176/608 (28.95%), Postives = 287/608 (47.20%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKA--RKIDFNHKN-SRQNESG-TKLNLA-------DVGTLNSATEEMQKRLIEEEKTPTKNNA-VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
            I+ +N   ++ +H  +++G +  +S L+++        V+       + LH A+     E VK+L+E  +A+VNV ++   TP++ AA+    A  R +  N  N S   E G T L +A        V  L  +    + RL        K++      L+    NP++    G TP+H A+  GN+  A  L++    D+      +++PLH+A       +  +LL    N+  +   G  P H A   G+ ++VDML+++          + A  ++   PLH A +  H DAA++ L   A V+ VT    +ALH+AAH G + + KLL+   A+ N       TPLH A +KN +KVV+ L+  GA I +      TPL +AA  G C  I + +  H                       DA+  +            P  +G  PLH+A R     I++IL+  GA  D +  E++TP+H+A++ G   IV +L++   Q  +    +D  T LH+AAK G  +V  +L+  GA  +A      + L   A  G++K AQ+LLQ  A VD+  K  +TPL++AC   + ++  LLL+  A
Sbjct:   37 INTSNANGLNALHLASKDGHIHVVSELLRRG-----AIVDSATKKGNTALHIASLAGQEEVVKLLLEH-NASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQ-KGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAP-------ISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMG-CMNIVIYLLQH-----------------------DASPDV------------PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGA 592          

HSP 2 Score: 202.601 bits (514), Expect = 1.653e-52
Identity = 184/711 (25.88%), Postives = 318/711 (44.73%), Query Frame = 1
Query:  232 NESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARY--------------RRKARK------------------IDFNHKNSRQNESG-TKLNLAD-VGTLNSATEEMQKRL-----IEEEKTP-------TKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----------LHIPDFKGNF----------------------PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGH 2130
            +E  R   I+     +    +H  +  G  E +  L++ N       VN+   +  +PL+ AA+ NH   V++L+    AN ++  E+  TP+  A +               R K R                   +D +H     ++SG T L++A   G  N A   +QK        +   +P        K N V L L+ KG N   +   G TP+H AA  G+E   + L++     I  K    + PLH+A    H + A++LL     + +         H+A   G++++  +L+ ++ D +  ++ L        TPLH A K       ++ L  GAS++A T +G + LH+AA  G + +V  L+  +A+ +V     +TPLH AA  N   +++ L+  GA +++R  +  TPL IA+  G+ + + LL+++   ++ T K   +AL++A +    +    +I  ENG  L          LH+    G+                       PLH+AC   N+++  +L++ GA      +   TP+H+AA+  +  I   L+E    +L   E +   TPLHL+++ G+ ++  LL+ + A  N    N L+ +   A + N+  A++L +NGA +D   KA  TPL++A   G   +V  LL++ A++      DA   + G  PL      GH
Sbjct:   61 SELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHN-----ASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNG-ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSL-LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN--ARALNGF-----TPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI--ENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYG--ALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANV------DAATSI-GYTPLHQTAQQGH 745          

HSP 3 Score: 180.259 bits (456), Expect = 1.832e-45
Identity = 122/349 (34.96%), Postives = 189/349 (54.15%), Query Frame = 1
Query: 1078 LHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            LH A K+GH       L +GA V++ T  G +ALH+A+  G  E+VKLL+   A+ NV ++   TPL+ AA++NH  VV+ L+  GA+      D +TPL +A   GH + + +L+++    +   K    AL++A +     A   ++ ++      H PD     G  PLHIA   GN+ I  +LI  GA  +   +   +P+H+AAK+G+T +V +L+E+     I  +  D  TPLH AA+SG+ +V+ +LL  GA  +A+  N L+ L  AA   ++ AA++LL + A VD +    +T L++A   GH R+  LLL  NAD + R        L G  PL  A
Sbjct:   48 LHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDND------HNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGN--IEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA-------LNGFTPLHIA 377          

HSP 4 Score: 174.481 bits (441), Expect = 1.012e-43
Identity = 154/561 (27.45%), Postives = 254/561 (45.28%), Query Frame = 1
Query:  283 IDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR-KARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEK----------TP-----TKNN-AVILYLVSKGANPNIQDTYGCTPMHYAAMRG-NEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDED-SNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKG 1908
            I  +H  A+ G    +S L+++      K       D ++PLH AAR  H + V +L+E   A ++   +  + P+H AA+     A +I   H+      +   L    V   +     + K L++             TP      KN   V+  L+  GA+ +     G TP+H AA  G   +    L      D+     E  TPLHLA   N  +I ++LL +   +  +      P HIA   GN+ +V +L++     D       A  +D  T LH A K G  + A V +E GA+++A T  G + LHL A  G I++ +LL+  EA+ +   K   TPLH A   N+ +V   L+EKGA   +   + +TPL IAA     +    L++     N   K   + L+L+ +  +++ +  +I     K  ++ P   G  P+H+  ++ N  + +IL   GA  D+  +   TP+H+A+ FG+  +V+ L++       +D       TPLH  A+ G+  ++ LLL + A+ NA+  N  + L  A   G
Sbjct:  239 ISPLHVAAKWGKTNMVSLLLEKGGNIEAKTR-----DGLTPLHCAARSGHEQVVDMLLERG-APISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAA-HCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVD-------ATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEH---KAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGAN---VDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG 777          

HSP 5 Score: 146.362 bits (368), Expect = 5.158e-35
Identity = 134/524 (25.57%), Postives = 228/524 (43.51%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYR-----------------RKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGA--NPNIQDTYGCTPMHYAAMRG-NEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTP 1785
            +H  A  G V     L+ +N     + +N       +PLH A + N L+ V++L+    A+++   E  +TP+H AA                       R     H  +R N++    ++  +   N A  + + R   E++TP        N  +++ L+  GA  +   +D Y  T +H AA  G +EVAA  +     +D   K  +  TPLHL   + H ++A++LL    ++  Q + G  P H+AC   N ++  +L++K            A  ++  TPLH A +    D A   LE GA  NA +  G + LHL++ +G  E+  LL+  +A  N   K   TP+H  A++++V V + L + GA+I+      YTPL +A+ +G    ++ L++N  ++                    DA  +I                G  PLH   + G+  IV +L++  A  + +    +TP+H+A K G   ++  L        I  EDE +  P
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALN-----GFTPLHIACKKNRLKVVELLLRHG-ASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQT----DIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVLIENGAALDAATK--KGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASP-------HATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANV--------------------DAATSI----------------GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL------KTITKEDETAAAP 798          

HSP 6 Score: 125.946 bits (315), Expect = 1.036e-28
Identity = 104/414 (25.12%), Postives = 183/414 (44.20%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIK-------------------KSEDQDELSKML----QAVNRDYK---TPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLL 1422
            IS T    +  +H  A  G +  + +L++ +        ++  +   +PLH AAR N  + ++IL+    A V+    E+ TP+H A+R       +D              L L     +++ T++M   L    K     + V   L+  GA  +     G TP+H  A  G+ +   QL+   E D+  +    +TPLH+AC +N+ ++A +LL    +     + G  P HIA  +  + +   L++                     E   E+S +L     AVN   K   TP+H   +  + + A++  + GA+++  T  G + LH+A+H G   MV+ L+   AN +    +  TPLH  A++ H  +V  L+E  A+  ++ ++  TPL IA   G+   +  L
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP-----DVPTVRGETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLG----NVDI-----------VMLLLQHGAQVDATTKDMYTALHIAAKE--GQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH-IKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 59.6918 bits (143), Expect = 2.026e-8
Identity = 69/309 (22.33%), Postives = 117/309 (37.86%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNS-----------------RQNESGTKLNLADVGTLNSATE----------------EMQKRLIEEEKT---PTKNNAVILYLVSK-------------GANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYK 1071
            +H  A+EG  E  + LI+         ++       +PLH  A++ H++  ++L+++  A+V+   +  VTP+H A  Y  +   +    K +                 R+N+      L + G L +A                  E+   LIE +     P KN    ++L ++             GAN ++    G TP+H A+  G       L++    ++    +   TPLH      H  I  +LL    N   Q   G  P HIA   G I ++D L K    +DE +         Y+
Sbjct:  506 LHIAAKEGQDEVAAVLIENG-----AALDAATKKGFTPLHLTAKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQ-NGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL-KTITKEDETAAAPSQAEEKYR 806          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 352.443 bits (903), Expect = 2.763e-102
Identity = 303/1106 (27.40%), Postives = 517/1106 (46.75%), Query Frame = 1
Query:  289 NMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLII-DEDEDSNTPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            ++ + A +G    +  LI++ P      ++L D +  S LHYA+   +L+ ++++V      V NV +E+  TP+H+A                                                E+   ++ AV+L L   GA+PNI +     P+H A  +     AE L+   + +  L+ +   TP+ LAC++N+ +  ++L+     +  Q + G  P H     G  + ++M++K  E+    S + +  +++   TPLH AV+ G+ +  K+C+ KGA V        +ALH A  QGS+E VK+++S     E   N+ +   +TPLH A   +HV++ +YLI KGA+I+S D    +PLL+A+S    +T+  L+    D  + EK  ++ L+  +       +  +T++     K++L   D +G  PLH AC+ G    V+ ++        K+ E+++ +H AA++GR      L+E    S ++ D DE   TPLHLA+++G+ +V+ LLL  GA    D     C     L  AA +G  +  ++LL  N   +D  ++   T L++A + GH   V LLL   A+I++    DA++       L  A+ N  R+   A ++ ++ + ++     S K      +  +I  +P+  + +  +C   +    +  DY I YNF++L+                                  + L+ Y + +K            K       L  MVR  R +LL H +    L MKW  +G  V++ NLAIYL  LL L   ++   P   +   N T  +   +    +Q L+         +C  +++VM V  + KE  QL   R NYF+   N  +    + A V V+ +  C  E      WQW+ GA +   S +  +L+ ++    GI+VVMF  ++ T +  + LF   + AF  AFY L+ ++  F+S+  ++ QT VMT+GEL + S F   +EE       + +  +TY +F  F+L+M I+ MNL++GLAV DI  VQ  A L+R+ MQ+ L   +E  +P +  +R       VYPN+
Sbjct:   28 DVFELAFKGKASAIDRLIQKGPEH----LSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAV-----------------------------------------------EQDQQQSCAVLLDL---GADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTC-----LHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALN---DADNSF-----LHEAVRNERREVVNATIEHERCDESM----TSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAP--------------------------------IQLKKYAKTDK-----------TKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLIS--------VCIIMVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPM-CCSVE----ATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGH-----MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTVVYPNK 1001          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 352.443 bits (903), Expect = 2.763e-102
Identity = 303/1106 (27.40%), Postives = 517/1106 (46.75%), Query Frame = 1
Query:  289 NMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLII-DEDEDSNTPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            ++ + A +G    +  LI++ P      ++L D +  S LHYA+   +L+ ++++V      V NV +E+  TP+H+A                                                E+   ++ AV+L L   GA+PNI +     P+H A  +     AE L+   + +  L+ +   TP+ LAC++N+ +  ++L+     +  Q + G  P H     G  + ++M++K  E+    S + +  +++   TPLH AV+ G+ +  K+C+ KGA V        +ALH A  QGS+E VK+++S     E   N+ +   +TPLH A   +HV++ +YLI KGA+I+S D    +PLL+A+S    +T+  L+    D  + EK  ++ L+  +       +  +T++     K++L   D +G  PLH AC+ G    V+ ++        K+ E+++ +H AA++GR      L+E    S ++ D DE   TPLHLA+++G+ +V+ LLL  GA    D     C     L  AA +G  +  ++LL  N   +D  ++   T L++A + GH   V LLL   A+I++    DA++       L  A+ N  R+   A ++ ++ + ++     S K      +  +I  +P+  + +  +C   +    +  DY I YNF++L+                                  + L+ Y + +K            K       L  MVR  R +LL H +    L MKW  +G  V++ NLAIYL  LL L   ++   P   +   N T  +   +    +Q L+         +C  +++VM V  + KE  QL   R NYF+   N  +    + A V V+ +  C  E      WQW+ GA +   S +  +L+ ++    GI+VVMF  ++ T +  + LF   + AF  AFY L+ ++  F+S+  ++ QT VMT+GEL + S F   +EE       + +  +TY +F  F+L+M I+ MNL++GLAV DI  VQ  A L+R+ MQ+ L   +E  +P +  +R       VYPN+
Sbjct:   28 DVFELAFKGKASAIDRLIQKGPEH----LSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAV-----------------------------------------------EQDQQQSCAVLLDL---GADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTC-----LHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALN---DADNSF-----LHEAVRNERREVVNATIEHERCDESM----TSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAP--------------------------------IQLKKYAKTDK-----------TKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLIS--------VCIIMVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPM-CCSVE----ATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGH-----MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTVVYPNK 1001          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpa1a (transient receptor potential cation channel, subfamily A, member 1a [Source:ZFIN;Acc:ZDB-GENE-050105-6])

HSP 1 Score: 347.051 bits (889), Expect = 2.470e-100
Identity = 308/1127 (27.33%), Postives = 526/1127 (46.67%), Query Frame = 1
Query:  400 SPLHYAARFNHLECVKILVE-EASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQV-DSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALR----NQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKK---EFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVR---RQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNL 3717
            SPLHYA+   H   ++ +V+      +NV +EE  TP+H+A                 ++++ G+                                     L+S GA+PN+ +     P+H A   G     EQL+   + D+ L+ +   TP+ L+ A ++ E   +L         Q   G  P H A   G  K +++++ K E+    +   +  V++   +PLH AV+ G+ D  K+C+  GA ++       +ALH A  QG+ E+VK+++S         N+T+   QTPLH A   +H ++ +YL+ +GA+I+  D   ++PLL+A S G   T+ LL+ +  D+   +K   + L+LA+       +    ++  E+ ++LL+  D +G  PLH ACR G    V+ ++      D K++E+++ +H AA+FGR      L+E    + +++E DE   TPLHLA++ G+ KV++LLL  GA  ++ +    S L  AA++G  +    LL +  ++ +  D    T L+LA + GH   V LLL   A I +    + ND     + L  A+ N  R+    +++SD+ E A+     N TK         +  +I  +P+  + +   C   + +  +  +Y I YNF +L+         H ++N+KK   E D+  +  SA                                     L  MV   R +LL H +    L MKW+ +G+  +  N+ +Y   +  L   ++  +P     + ++ V     +C  + +   +  L  S+ +   +++ M +  + KE  Q+   R NY   L N M+    + A + V+ +      + ++  W WQ GA++A  S +NL+L++++    GI+VVMF ++  T +  + LFF  I  FA +FY L+  Q  F  +  S++QT VM +GE+ +   F   + +      L F D+ T  IF  F+L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQ+ L   +E  +P +  +R     +  YPNR  S  K  F  G EV+   R      QL  +ER    QK   ++++E   K  NL
Sbjct:   74 SPLHYASANGHFRIIRHIVQIVGHQELNVRDEEGNTPLHWAV----------------QKDQPGS----------------------------------CSVLLSLGADPNVLNNSHQAPIHMAVSLGKNFVLEQLVSHKQTDVNLEGDLGNTPVILSAALDNHEALGILYKHGAKFCRQNNLGHFPIHAAAFSGAKKSMEVILLKGEEAGLSIDAHINYVDKSCSSPLHLAVRGGNLDIIKLCIGYGAKIDQQQCDKSTALHFACSQGATEVVKIMLSSYPKVCDLINITDGANQTPLHKAVIFDHFELSEYLMSQGANIDFVDCKGHSPLLLATSCGAWRTVNLLLSHGADLTKKDKSGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDIEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKGALFHS-DYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIIL----NKND----ASFLHEAVHNARREVTNMVIESDRCEEAMTTYKPNSTKR------CIVMDMIEFLPESFKHLLDTCIRESEEDVNCTNYYIEYNFRWLQ---------HPLQNLKKTGMEKDMAYKPLSA-------------------------------------LNAMVNFNRVNLLTHPVCKKYLEMKWSAYGIKAHLLNMTVYALGVFPLTYLIVNLKPT---LVTSRNVTSVNMVCTSLYK---QSYLTTSSML---LVLAMNMYAVGKEILQMFQQRLNYLRDLSNYMDWAAAICALLFVVPLL-----MNLKSSWHWQAGALAALTSWLNLLLYLQRFERIGIYVVMFREISRTLLSIIVLFFYLILGFALSFYALMIEQQHFGRMFLSLLQTFVMMVGEMNYQDNFMKPYLQ----GDLPFPDL-TLAIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKRIAMQIELHTNLEERLPYWFMKRVDQVTIREYPNRCFSGKKRWFFGGNEVKSRTRLGPTFHQLTPLERELTKQKYRLKEISETMEKQHNL 1070          

HSP 2 Score: 100.523 bits (249), Expect = 8.322e-21
Identity = 116/464 (25.00%), Postives = 195/464 (42.03%), Query Frame = 1
Query:  376 NLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARY-RRKARKIDFNH--KNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVI----------LYLVSKGANPNI-------------QDTYGCTPMHYAAMRG-NEVAAEQLMKLPEID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSED-------------------------------QDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQ---TPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCD-INVTEKGNKSALYLAVEHSYSDATK-------TIISDENGKKLLH 1554
            N+L+    +P+H A        ++ LV     +VN+  +   TP+  +A     +A  I + H  K  RQN  G           + A + M+  L++ E+     +A I          L+L  +G N +I             Q     T +H+A  +G  EV    L   P++   I + D  + TPLH A   +HFE+++ L+    N+   +  G  P  +A   G  + V++L+    D                                + + ++L   + +  TPLHYA + G  D+ K  L    S++  +   +SALH AA  G I     L+    +  + N+  +   TPLH A+ + HVKVV+ L+ KGA   S D   ++ L  AAS G+ +T+  L+ ++   +N T+    +AL+LA    +  A +        II ++N    LH
Sbjct:  134 NVLNNSHQAPIHMAVSLGKNFVLEQLVSHKQTDVNLEGDLGNTPVILSAALDNHEALGILYKHGAKFCRQNNLGH--FPIHAAAFSGAKKSMEVILLKGEEAGLSIDAHINYVDKSCSSPLHLAVRGGNLDIIKLCIGYGAKIDQQQCDKSTALHFACSQGATEVVKIMLSSYPKVCDLINITDGANQTPLHKAVIFDHFELSEYLMSQGANIDFVDCKGHSPLLLATSCGAWRTVNLLLSHGADLTKKDKSGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDIEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKGALFHS-DYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIILNKNDASFLH 594          

HSP 3 Score: 89.7373 bits (221), Expect = 1.620e-17
Identity = 94/374 (25.13%), Postives = 163/374 (43.58%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFA---ARYRRKARKIDFNHKNSRQNESGTK-LNLADV---GTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLL--ISSNNLFDQ-EETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYK--TPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTP 1374
            +H    +G  E +  ++   P K    +N+ D    +PLH A  F+H E  + L+ +  AN++  + +  +P+  A     +R     +      +++++SG   L+LA +   G  N  TE +Q   + E          +L         N +D  GCTP+HYA   G   + + ++ L E+ +  K  E  + LH A           LL  ++   L ++ +E G  P H+A  EG++K+V++L++K              + DY+  + LH+A   G+       L      +N     G +ALHLAA  G +  V+LL+   A   + NK   + LH A      +V   +IE  +D     + +Y P
Sbjct:  285 LHFACSQGATEVVKIMLSSYP-KVCDLINITDGANQTPLHKAVIFDHFELSEYLMSQG-ANIDFVDCKGHSPLLLATSCGAWRTVNLLLSHGADLTKKDKSGCNFLHLAILQPRGLKNLPTEVLQHESVRE----------LL---------NDEDIEGCTPLHYACRLGIPDSVKNMLGL-EVSLDQKSKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKGA----------LFHSDYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKI-ILNKNDASFLHEAVHNARREVTNMVIE--SDRCEEAMTTYKP 623          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 343.584 bits (880), Expect = 4.991e-99
Identity = 303/1119 (27.08%), Postives = 517/1119 (46.20%), Query Frame = 1
Query:  289 NMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEK-------------GADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLII-DEDEDSNTPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            ++ + A +G    +  LI++ P      ++L D +  S LHYA+   +L+ ++++V      V NV +E+  TP+H+A                                                E+   ++ AV+L L   GA+PNI +     P+H A  +     AE L+   + +  L+ +   TP+ LAC++N+ +  ++L+     +  Q + G  P H     G  + ++M++K  E+    S + +  +++   TPLH AV+ G+ +  K+C+ KGA V        +ALH A  QGS+E VK+++S     E   N+ +   +TPLH A   +HV++ +YLI K             GA+I+S D    +PLL+A+S    +T+  L+    D  + EK  ++ L+  +       +  +T++     K++L   D +G  PLH AC+ G    V+ ++        K+ E+++ +H AA++GR      L+E    S ++ D DE   TPLHLA+++G+ +V+ LLL  GA    D     C     L  AA +G  +  ++LL  N   +D  ++   T L++A + GH   V LLL   A+I++    DA++       L  A+ N  R+   A ++ ++ + ++     S K      +  +I  +P+  + +  +C   +    +  DY I YNF++L+                                  + L+ Y + +K            K       L  MVR  R +LL H +    L MKW  +G  V++ NLAIYL  LL L   ++   P   +   N T  +   +    +Q L+         +C  +++VM V  + KE  QL   R NYF+   N  +    + A V V+ +  C  E      WQW+ GA +   S +  +L+ ++    GI+VVMF  ++ T +  + LF   + AF  AFY L+ ++  F+S+  ++ QT VMT+GEL + S F   +EE       + +  +TY +F  F+L+M I+ MNL++GLAV DI  VQ  A L+R+ MQ+ L   +E  +P +  +R       VYPN+
Sbjct:   28 DVFELAFKGKASAIDRLIQKGPEH----LSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAV-----------------------------------------------EQDQQQSCAVLLDL---GADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIVNIRDGANRTPLHRATLFDHVELAEYLISKPNTLSLDLICLGKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQPKGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTC-----LHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALN---DADNSF-----LHEAVRNERREVVNATIEHERCDESM----TSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAP--------------------------------IQLKKYAKTDK-----------TKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLILNLRPSQDFSKGNGTSVIMVPVSFSEQQYLIS--------VCIIMVIVMNVYSICKEVVQLAQQRVNYFTDFSNPADWSAAISALVFVVPM-CCSVE----ATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYALMLHRPEFSSISLALAQTFVMTVGELNYQSTFLNSYEEGH-----MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPYWFLKRVDKPSTVVYPNK 1014          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 245.743 bits (626), Expect = 5.326e-66
Identity = 185/618 (29.94%), Postives = 306/618 (49.51%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR------------YRRKAR-KIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       SPL+ AA+ NHLE VK L+E   AN ++P E+  TP+  A +            Y  K + ++   H  +R +++ T    A V   N    ++   L +   TP       +N +V   L+++GAN N     G TP+H A+ RGN +    L+ +  +ID K KD   +TPLH A  + H  + ++LL     L  + + G  P H+A    ++  V  L++ + + D+++        D+ TPLH A   GH    KV L+KGA  NA    G + LH+A  +  +  + LL+   A+     +   TPLH AA   H+ +V+ L+++GA   + ++   TPL +AA  GHCE  + L++N+  ++   K +++ L+ A    + +  K ++  +        PD     G+ PLHIA R+G+ +  +IL+D  A      ++  TP+H+A K+G+  +V++L+ER          ++  TPLH+A       V++LL++ G   ++   N  +AL  AA +  L+ A  LLQ GA  +S     ITPL+LA + G   +V LL+   A++++   G+ N    G  PL      GH   A  ++K
Sbjct:   45 VNAQSQKGFSPLYMAAQENHLEVVKYLLEHG-ANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRT----AAVLLQNDPNPDV---LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE--LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDIT-------LDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKAN------PDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANP--NAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNL---GNKN----GLTPLHLVAQEGHVGIADMLVK 630          

HSP 2 Score: 233.417 bits (594), Expect = 4.651e-62
Identity = 179/609 (29.39%), Postives = 291/609 (47.78%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
            +H  AR  D    + L++ +P       ++L     +PLH AA + +L   ++L+    ANVN   +  +TP+H A+R R     +        Q ++ TK  L     L+ A      R++E   ++  P    TKN    +++ ++G            N  I D      TP+H AA  G+    + L+     D   K N       TPLH+AC  NH     +LL  S +L    E+G  P H+A   G++ +V  L+++    +       A N   +TPLH A + GHC+ A+  L+  A V+A     ++ LH AA  G  E+VKLL+  +AN +       TPLH AA + H +  + L+++ A         +TPL +A  YG  + ++LL++   + N   K   + L++AV H+  D  K ++S        H     G   LHIA +    ++   L+  GA  + ++ +  TP+HLA++ G+  +V +L+  SKQ+ +   +++  TPLHL A+ G+  +  +L+  GA   A +    + L  A   GN+K  + LLQ  A V+S  +   TPL+ A + GH  +VTLLLKH A
Sbjct:  118 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKNGITPLHIASR-RGNVIMVRLLLDRGAQIDAKTKDELTP---LHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLL-----DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPN-------ASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP---HSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLI--SKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 699          

HSP 3 Score: 201.445 bits (511), Expect = 5.676e-52
Identity = 144/492 (29.27%), Postives = 239/492 (48.58%), Query Frame = 1
Query:  691 VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTP-LHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAIL 2154
            ++L L+  G +       G T +H AA+ G E    +L+     ++  +  +  +PL++A   NH E+ K LL    N     E G  P  +A  +G+  +V +LI                    + P LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  AN N T K   TPLH A+ + +V +V+ L+++GA I+++  D  TPL  AA  GH   +++L+     +    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++V++L+D GA  + +     TP+H+A K      + +L++ S     +   E   TPLH+AA  G+  +++ LL  GA  NA N    + L  AA  G+ + AQ LLQN AQVD+  K   TPL+ A + GH  LV LL++H A+              G  PL  A   GH Q    +L
Sbjct:    1 MVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINY-GANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN------------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHL------TPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV--TESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTA-------GHTPLHIAAREGHAQTTRILL 464          

HSP 4 Score: 200.29 bits (508), Expect = 1.294e-51
Identity = 166/568 (29.23%), Postives = 274/568 (48.24%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQN-PRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA---------DVGTLNSATEEMQKRLIEEEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V  +  L+ Q  P +AK        + +SP+H AA+ +H++CV+ L++  +A ++    + +TP+H AA    +R     +D   K N+R     T L++A         D+   +SA+ E    + E   TP    A      ++  L+ +GA+PN  +    TP+H AA  G+ EVA   L    ++D K KD++  TPLH A    H E+ K+L+    N       G  P HIA  EG+ +   +L+ ++  Q +++K      + + TPLH A K G  D  ++ LE+GA+ NA    G + LH+A H  ++++VKLLVS   + + T +   T LH AA++N ++V   L++ GA+  S  +   TPL +A+  G  + + LL+    ++N+   GNK+ L                                  PLH+  ++G+  I  +L+  GA     +    TP+H+A  +G   +VK L++  +Q+ +  +     TPLH AA+ G+  ++ LLL +GA  N    N  S L  A   G +    VL
Sbjct:  217 LHCAARNGHVRVVEILLDQGAPLQAKTK------NGLSPIHMAAQGDHMDCVRQLLQY-NAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA---VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQ--TPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTK------KGF-TPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNL---GNKNGLT---------------------------------PLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQ--QQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 387.111 bits (993), Expect = 2.940e-114
Identity = 342/1189 (28.76%), Postives = 573/1189 (48.19%), Query Frame = 1
Query:  298 KFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILV-EEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLM-------QTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVE-RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNG-AQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKC---KVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEA-EPPYLYFIR-----NKTVGLNGSI---CAQVKQILVKERLKHS--AEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE-------SSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            K   EG+V ++   + +NP      +   D  + +PLH+AA+  +++ + ++V E A   +N  +    TP+H+A +            KN        KL+   V                              L+ +GA+PNIQ+ Y  +P+H A    +   AE L+     DI L+ +   TP+  AC  ++ E   +LL     L  Q + GC P H+    G++K +D+++KK E+    +   +   N +  +PLH AV+NG+ D  K C+  GA ++       +ALH AA QG+ E+VK +VS   +++  NK++       +TPLH +   +HV++ +YLI +GA+I+S D +S TPLL+A S    +++ LL+    D+ + +   ++ L+L V       +     +  EN KKL+   D +G  PLH ACR G    V  L+        K++ +R+P+H AA +GR    + L+   S   L+ D DE   TPLHLAA++G+ K++  LL         +    +AL +AA  G  +  + LL+     +D  DK + T ++LA + GH + V+LLL++ A I +    +AN    G + +  AI  G +   L  ++S++WE  L  QT S        + ++I  +P+  + +  +C    + + K P   D+ + YNF +L+   +      F +  K+E +V  E  +                                      L  MV+ +R DLL H +    L MKW  +G   +  NLAIY   L+ L   +I A  P  L  I       +T   N S+   CA V + L   +LK +    +C  ++  M++ G+VKEA QLC  +  Y     NI++  +Y+ + + V   S C + I V    QWQ GA++ F S +N ++++++   +GI++VMF ++L T +R + LFF  I AF  +FY+ L  QVTF+    +++Q+  M +G++ ++  F       P  +  I Y   T+    +F L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQV+L   +E  +P +  +R     +TVYPNR        +S +   F    +V+ ++  +D+  ++E  K  QK   + LT M      +  QN L+  ++ K+
Sbjct:   41 KLIAEGNVCRVRNFVLKNPGS----LAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQ------------KN--------KLDCLKV------------------------------LLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVS---SYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILL----NAN----GASYIHEAIRFGKKDTVLVSIQSERWEEIL--QTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSP---DFHVEYNFTYLQCPLS------FRKAHKRENNVHYEPLTT-------------------------------------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMKQECANVSRKLDLLQLKDTQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFV--SSLCHSPI-VVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLK-----PLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPFWFLKRVDKISITVYPNRPRIWGITFTSNFFHYFSSCDDVKAEIPINDETMELELWK--QKNRLKDLTTM------MQKQNDLIKLIIQKM 1099          

HSP 2 Score: 148.673 bits (374), Expect = 1.956e-35
Identity = 137/535 (25.61%), Postives = 248/535 (46.36%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQN---ESGTKLNL-ADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-----ID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLH-----AAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA 1848
            +H  A+ G+++ +  ++ ++   A++ +N LD    +PLH+A + N L+C+K+L+    A+ N+ N  R++P+H A         I   H +  +     S T +NL  D+G     T  MQ            N+  +  L+ +GA    Q+  GC P+H  A  G+    + ++K  E     ID  I   +NE  +PLHLA  + + ++ K  +     +  ++       H A  +G  ++V  ++    D +   K++   + + +TPLH +V   H + A+  + +GA++++     R+ L LA    + + V LL+S  A+  + +   +  LH         KN       +      +   D +  TPL  A  +G   ++  L+  +  +    K  +S L+ A  +   +  + ++   +  +LL+  D KG  PLH+A  +G+EKIV  L+       + +    T +H AA  G T  +K L+E S   LI   D++ NT +HLA + G+ K + LLL  GA
Sbjct:   73 LHHAAKLGNIDLMLMIVNES---AEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRG-ADPNIQNCYRLSPLHLA---------IQLFHNSIAEALILHSTTDINLEGDLGN----TPVMQ-------ACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDN---KIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSI-GLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGA 578          

HSP 3 Score: 125.561 bits (314), Expect = 2.521e-28
Identity = 114/478 (23.85%), Postives = 204/478 (42.68%), Query Frame = 1
Query:  838 DNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH--------------------QGSI--------------EMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY---------TPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISD-ENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAK----------------------FGRTYIVKILVERSK--------------QSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ---NGAQVDSMDKAKITPLYLACKNGHDRLV 2022
            D+  +    L    N   +   +L +  +L  ++++   P H A   GNI ++ M++ +S ++      + A++    TPLH+AV+    D  KV L +GA  N       S LHLA                      +G +              E + LL+   A     NKL   P+H  A    +K +  +++KG ++    ID +         +PL +A   G+ + +K  +     I++ +  N +AL+ A     ++  K ++S   +  K++ +PD     PLH +    + ++ + LI  GA  D +++E RTP+ LA                        +GR ++  ++++                 + L+ DED +  TPLH A + G P  +  LL       +++ NK S L FAA  G     Q LL+   +G  ++  D+  +TPL+LA +NGH+++V
Sbjct:   33 DDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEG-----INALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEM-GYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV 504          

HSP 4 Score: 69.3218 bits (168), Expect = 3.980e-11
Identity = 60/246 (24.39%), Postives = 114/246 (46.34%), Query Frame = 1
Query: 1372 PLLI---AASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ--------VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDA 2076
            PLLI    A    C     ++KN   +   +    + L+ A +    D    I+ +E+ ++ ++  D +GN PLH A +      +++L+  GA  +++N    +P+HLA +     I + L+  S   + ++ D   NTP+  A      + + LLL  GA    +N      +   A  G+LK   ++L+ G +        ++  +  K +PL+LA +NG+  +V   + + A I +R + +A
Sbjct:   36 PLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIV-NESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDL-GNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNA 279          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 370.548 bits (950), Expect = 1.347e-108
Identity = 337/1177 (28.63%), Postives = 560/1177 (47.58%), Query Frame = 1
Query:  298 KFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILV-EEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLM-------QTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVE-RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNG-AQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEA-EPPYLYFIRNKTVGLNGSICAQVKQI-LVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE-------SSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            K   EG+V ++   + +NP      +   D  + +PLH+AA+  +++ + ++V E A   +N  +    TP+H+A +            KN        KL+   V                              L+ +GA+PNIQ+ Y  +P+H A    +   AE L+     DI L+ +   TP+  AC  ++ E   +LL     L  Q + GC P H+    G++K +D+++KK E+    +   +   N +  +PLH AV+NG+ D  K C+  GA ++       +ALH AA QG+ E+VK +VS   +++  NK++       +TPLH +   +HV++ +YLI +GA+I+S D +S TPLL+A S    +++ LL+    D+ + +   ++ L+L V       +     +  EN KKL+   D +G  PLH ACR G    V  L+        K++ +R+P+H AA +GR    + L+   S   L+ D DE   TPLHLAA++G+ K++  LL         +    +AL +AA  G  +  + LL+     +D  DK + T ++LA + GH + V+LLL++ A I +    +AN    G + +  AI  G +   L  ++S++WE  L  QT S        + ++I  +P    E FK   ++ S+          YNF +L+   +      F +  K+E +V  E  +                                      L  MV+ +R DLL H +    L MKW  +G   +  NLAIY   L+ L   +I A  P  L  I           C  +K+       +K   E C  ++  M++ G+VKEA QLC  +  Y     NI++  +Y+ + + V   S C + I V    QWQ GA++ F S +N ++++++   +GI++VMF ++L T +R + LFF  I AF  +FY+ L  QVTF+    +++Q+  M +G++ ++  F       P  +  I Y   T+    +F L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQV+L   +E  +P +  +R     +TVYPNR        +S +   F    +V+ ++  +D+  ++E  K  QK   + LT M      +  QN L+  ++ K+
Sbjct:   41 KLIAEGNVCRVRNFVLKNPGS----LAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQ------------KN--------KLDCLKV------------------------------LLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVS---SYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILL----NAN----GASYIHEAIRFGKKDTVLVSIQSERWEEIL--QTFSHTSSYKCAILEMIYHLP----ESFKVGILNVSQ----------YNFTYLQCPLS------FRKAHKRENNVHYEPLTT-------------------------------------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEE---------CEHLKRTDFYNSSMKQ--EFCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFV--SSLCHSPI-VVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLK-----PLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPFWFLKRVDKISITVYPNRPRIWGITFTSNFFHYFSSCDDVKAEIPINDETMELELWK--QKNRLKDLTTM------MQKQNDLIKLIIQKM 1065          

HSP 2 Score: 148.288 bits (373), Expect = 2.732e-35
Identity = 137/535 (25.61%), Postives = 248/535 (46.36%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQN---ESGTKLNL-ADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-----ID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLH-----AAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA 1848
            +H  A+ G+++ +  ++ ++   A++ +N LD    +PLH+A + N L+C+K+L+    A+ N+ N  R++P+H A         I   H +  +     S T +NL  D+G     T  MQ            N+  +  L+ +GA    Q+  GC P+H  A  G+    + ++K  E     ID  I   +NE  +PLHLA  + + ++ K  +     +  ++       H A  +G  ++V  ++    D +   K++   + + +TPLH +V   H + A+  + +GA++++     R+ L LA    + + V LL+S  A+  + +   +  LH         KN       +      +   D +  TPL  A  +G   ++  L+  +  +    K  +S L+ A  +   +  + ++   +  +LL+  D KG  PLH+A  +G+EKIV  L+       + +    T +H AA  G T  +K L+E S   LI   D++ NT +HLA + G+ K + LLL  GA
Sbjct:   73 LHHAAKLGNIDLMLMIVNES---AEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRG-ADPNIQNCYRLSPLHLA---------IQLFHNSIAEALILHSTTDINLEGDLGN----TPVMQ-------ACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDN---KIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSI-GLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGA 578          

HSP 3 Score: 125.561 bits (314), Expect = 2.470e-28
Identity = 114/478 (23.85%), Postives = 204/478 (42.68%), Query Frame = 1
Query:  838 DNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH--------------------QGSI--------------EMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY---------TPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISD-ENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAK----------------------FGRTYIVKILVERSK--------------QSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ---NGAQVDSMDKAKITPLYLACKNGHDRLV 2022
            D+  +    L    N   +   +L +  +L  ++++   P H A   GNI ++ M++ +S ++      + A++    TPLH+AV+    D  KV L +GA  N       S LHLA                      +G +              E + LL+   A     NKL   P+H  A    +K +  +++KG ++    ID +         +PL +A   G+ + +K  +     I++ +  N +AL+ A     ++  K ++S   +  K++ +PD     PLH +    + ++ + LI  GA  D +++E RTP+ LA                        +GR ++  ++++                 + L+ DED +  TPLH A + G P  +  LL       +++ NK S L FAA  G     Q LL+   +G  ++  D+  +TPL+LA +NGH+++V
Sbjct:   33 DDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEG-----INALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEM-GYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV 504          

HSP 4 Score: 69.3218 bits (168), Expect = 4.180e-11
Identity = 60/246 (24.39%), Postives = 114/246 (46.34%), Query Frame = 1
Query: 1372 PLLI---AASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ--------VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDA 2076
            PLLI    A    C     ++KN   +   +    + L+ A +    D    I+ +E+ ++ ++  D +GN PLH A +      +++L+  GA  +++N    +P+HLA +     I + L+  S   + ++ D   NTP+  A      + + LLL  GA    +N      +   A  G+LK   ++L+ G +        ++  +  K +PL+LA +NG+  +V   + + A I +R + +A
Sbjct:   36 PLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIV-NESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDL-GNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNA 279          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 365.155 bits (936), Expect = 9.528e-107
Identity = 315/1106 (28.48%), Postives = 525/1106 (47.47%), Query Frame = 1
Query:  298 KFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILV-EEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYA-AMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLM-------QTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVE-RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNG-AQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKC---KVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            K   EG+V ++   + +NP      +   D  + +PLH+AA+  +++ + ++V E A   +N  +    TP+H+A +            KN        KL+   V                              L+ +GA+PNIQ+ Y  +P+H A  +  N +A   L+     DI L+ +   TP+  AC  ++ E   +LL     L  Q + GC P H+    G++K +D+++KK E+    +   +   N +  +PLH AV+NG+ D  K C+  GA ++       +ALH AA QG+ E+VK +VS   +++  NK++       +TPLH +   +HV++ +YLI +GA+I+S D +S TPLL+A S    +++ LL+    D+ + +   ++ L+L V       +     +  EN KKL+   D +G  PLH ACR G    V  L+        K++ +R+P+H AA +GR    + L+   S   L+ D DE   TPLHLAA++G+ K++  LL         +    +AL +AA  G  +  + LL+     +D  DK + T ++LA + GH + V+LLL++ A I +    +AN    G + +  AI  G +   L  ++S++WE  L  QT S        + ++I  +P+  + +  +C    + + K P   D+ + YNF +L+   +      F +  K+E +V  E  +                                      L  MV+ +R DLL H +    L MKW  +G   +  NLAIY   L+           P    I N                           +C  ++  M++ G+VKEA QLC  +  Y     NI++  +Y+ + + V   S C + I V    QWQ GA++ F S +N ++++++   +GI++VMF ++L T +R + LFF  I AF  +FY+ L  QVTF+    +++Q+  M +G++ ++  F       P  +  I Y   T+    +F L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQV+L   +E  +P +  +R     +TVYPNR
Sbjct:   41 KLIAEGNVCRVRNFVLKNPGS----LAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQ------------KN--------KLDCLKV------------------------------LLCRGADPNIQNCYRLSPLHLAIQLFHNSIA---LILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVS---SYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILL----NAN----GASYIHEAIRFGKKDTVLVSIQSERWEEIL--QTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSP---DFHVEYNFTYLQCPLS------FRKAHKRENNVHYEPLTT-------------------------------------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLI-----------PLTLMISNDFYD------------------TQYTRVCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFV--SSLCHSPI-VVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLK-----PLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPFWFLKRVDKISITVYPNR 992          

HSP 2 Score: 150.599 bits (379), Expect = 5.371e-36
Identity = 136/532 (25.56%), Postives = 249/532 (46.80%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNL-ADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-----ID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLH-----AAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA 1848
            +H  A+ G+++ +  ++ ++   A++ +N LD    +PLH+A + N L+C+K+L+    A+ N+ N  R++P+H A +         F++  +    S T +NL  D+G     T  MQ            N+  +  L+ +GA    Q+  GC P+H  A  G+    + ++K  E     ID  I   +NE  +PLHLA  + + ++ K  +     +  ++       H A  +G  ++V  ++    D +   K++   + + +TPLH +V   H + A+  + +GA++++     R+ L LA    + + V LL+S  A+  + +   +  LH         KN       +      +   D +  TPL  A  +G   ++  L+  +  +    K  +S L+ A  +   +  + ++   +  +LL+  D KG  PLH+A  +G+EKIV  L+       + +    T +H AA  G T  +K L+E S   LI   D++ NT +HLA + G+ K + LLL  GA
Sbjct:   73 LHHAAKLGNIDLMLMIVNES---AEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRG-ADPNIQNCYRLSPLHLAIQL--------FHNSIALILHSTTDINLEGDLGN----TPVMQ-------ACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDN---KIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSI-GLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGA 576          

HSP 3 Score: 126.716 bits (317), Expect = 1.170e-28
Identity = 114/476 (23.95%), Postives = 204/476 (42.86%), Query Frame = 1
Query:  838 DNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH------------------QGSI--------------EMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY---------TPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISD-ENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAK----------------------FGRTYIVKILVERSK--------------QSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ---NGAQVDSMDKAKITPLYLACKNGHDRLV 2022
            D+  +    L    N   +   +L +  +L  ++++   P H A   GNI ++ M++ +S ++      + A++    TPLH+AV+    D  KV L +GA  N       S LHLA                    +G +              E + LL+   A     NKL   P+H  A    +K +  +++KG ++    ID +         +PL +A   G+ + +K  +     I++ +  N +AL+ A     ++  K ++S   +  K++ +PD     PLH +    + ++ + LI  GA  D +++E RTP+ LA                        +GR ++  ++++                 + L+ DED +  TPLH A + G P  +  LL       +++ NK S L FAA  G     Q LL+   +G  ++  D+  +TPL+LA +NGH+++V
Sbjct:   33 DDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEG-----INALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEM-GYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV 502          

HSP 4 Score: 67.781 bits (164), Expect = 1.173e-10
Identity = 61/246 (24.80%), Postives = 113/246 (45.93%), Query Frame = 1
Query: 1372 PLLI---AASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ--------VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDA 2076
            PLLI    A    C     ++KN   +   +    + L+ A +    D    I+ +E+ ++ ++  D +GN PLH A +      +++L+  GA  +++N    +P+HLA +     I  IL   +  +L   E +  NTP+  A      + + LLL  GA    +N      +   A  G+LK   ++L+ G +        ++  +  K +PL+LA +NG+  +V   + + A I +R + +A
Sbjct:   36 PLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIV-NESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIALILHSTTDINL---EGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNA 277          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 360.147 bits (923), Expect = 3.136e-105
Identity = 327/1174 (27.85%), Postives = 554/1174 (47.19%), Query Frame = 1
Query:  310 EGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILV-EEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYA-AMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLM-------QTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVE-RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNG-AQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKC---KVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE---SSIYKTLFGI---GREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            EG+V ++   + +NP      +   D  + +PLH+AA+  +++ + ++V E A   +N  +    TP+H+A +            KN        KL+   V                              L+ +GA+PNIQ+ Y  +P+H A  +  N +A   L+     DI L+ +   TP+  AC  ++ E   +LL     L  Q + GC P H+    G++K +D+++KK E+    +   +   N +  +PLH AV+NG+ D  K C+  GA ++       +ALH AA QG+ E+VK +VS   +++  NK++       +TPLH +   +HV++ +YLI +GA+I+S D +S TPLL+A S    +++ LL+    D+ + +   ++ L+L V       +     +  EN KKL+   D +G  PLH ACR G    V  L+        K++ +R+P+H AA +GR    + L+   S   L+ D DE   TPLHLAA++G+ K++  LL         +    +AL +AA  G  +  + LL+     +D  DK + T ++LA + GH + V+LLL++ A I +    +AN    G + +  AI  G +   L  ++S++WE  L  QT S        + ++I  +P+  + +  +C    + + K P   D+ + YNF +L+   +      F +  K+E +V  E  +                                      L  MV+ +R DLL H +    L MKW  +G   +  NLAIY   L+           P    I N                              + +++  + G+VKEA QLC  +  Y     NI++  +Y+ + + V   S C + I V    QWQ GA++ F S +N ++++++   +GI++VMF ++L T +R + LFF  I AF  +FY+ L  QVTF+    +++Q+  M +G++ ++  F       P  +  I Y   T+    +F L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQV+L   +E  +P +  +R     +TVYPNR       + ++ GI     +V+ ++  +D+  ++E  K  QK   + LT M      +  QN L+  ++ K+
Sbjct:   23 EGNVCRVRNFVLKNPGS----LAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQ------------KN--------KLDCLKV------------------------------LLCRGADPNIQNCYRLSPLHLAIQLFHNSIA---LILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVS---SYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILL----NAN----GASYIHEAIRFGKKDTVLVSIQSERWEEIL--QTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSP---DFHVEYNFTYLQCPLS------FRKAHKRENNVHYEPLTT-------------------------------------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLI-----------PLTLMISN-----------------------------DFYVLIQLLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFV--SSLCHSPI-VVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLK-----PLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPFWFLKRVDKISITVYPNRPRIWGITFTSVSGICLSCDDVKAEIPINDETMELELWK--QKNRLKDLTTM------MQKQNDLIKLIIQKM 1023          

HSP 2 Score: 150.214 bits (378), Expect = 5.184e-36
Identity = 136/532 (25.56%), Postives = 249/532 (46.80%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNL-ADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-----ID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLH-----AAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA 1848
            +H  A+ G+++ +  ++ ++   A++ +N LD    +PLH+A + N L+C+K+L+    A+ N+ N  R++P+H A +         F++  +    S T +NL  D+G     T  MQ            N+  +  L+ +GA    Q+  GC P+H  A  G+    + ++K  E     ID  I   +NE  +PLHLA  + + ++ K  +     +  ++       H A  +G  ++V  ++    D +   K++   + + +TPLH +V   H + A+  + +GA++++     R+ L LA    + + V LL+S  A+  + +   +  LH         KN       +      +   D +  TPL  A  +G   ++  L+  +  +    K  +S L+ A  +   +  + ++   +  +LL+  D KG  PLH+A  +G+EKIV  L+       + +    T +H AA  G T  +K L+E S   LI   D++ NT +HLA + G+ K + LLL  GA
Sbjct:   51 LHHAAKLGNIDLMLMIVNES---AEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRG-ADPNIQNCYRLSPLHLAIQL--------FHNSIALILHSTTDINLEGDLGN----TPVMQ-------ACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDN---KIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSI-GLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGA 554          

HSP 3 Score: 126.331 bits (316), Expect = 1.435e-28
Identity = 114/469 (24.31%), Postives = 202/469 (43.07%), Query Frame = 1
Query:  859 LHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH------------------QGSI--------------EMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY---------TPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISD-ENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAK----------------------FGRTYIVKILVERSK--------------QSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ---NGAQVDSMDKAKITPLYLACKNGHDRLV 2022
            L L    N   +   +L +  +L  ++++   P H A   GNI ++ M++ +S ++      + A++    TPLH+AV+    D  KV L +GA  N       S LHLA                    +G +              E + LL+   A     NKL   P+H  A    +K +  +++KG ++    ID +         +PL +A   G+ + +K  +     I++ +  N +AL+ A     ++  K ++S   +  K++ +PD     PLH +    + ++ + LI  GA  D +++E RTP+ LA                        +GR ++  ++++                 + L+ DED +  TPLH A + G P  +  LL       +++ NK S L FAA  G     Q LL+   +G  ++  D+  +TPL+LA +NGH+++V
Sbjct:   18 LELIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEG-----INALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEM-GYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV 480          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 358.992 bits (920), Expect = 5.523e-105
Identity = 312/1043 (29.91%), Postives = 515/1043 (49.38%), Query Frame = 1
Query:  703 LVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGR--SALHLAAHQGSIEMVKLLVSFEANFNVTNKLM-------QTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVE-RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNG-AQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEA-EPPYLYFIRNKTVGLNGSICAQVKQI-LVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS-LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE-------SSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            L+ +GA+PNIQ+ Y  +P+H A    +   AE L+     DI L+ +   TP+  AC  ++ E   +LL     L  Q + GC P H+    G++K +D+++KK E+    +   +   N +  +PLH AV+NG+ D  K C+  G+   +++  G+  S LH AA QG+ E+VK +VS   +++  NK++       +TPLH +   +HV++ +YLI +GA+I+S D +S TPLL+A S    +++ LL+    D+ + +   ++ L+L V       +     +  EN KKL+   D +G  PLH ACR G    V  L+        K++ +R+P+H AA +GR    + L+   S   L+ D DE   TPLHLAA++G+ K++  LL         +    +AL +AA  G  +  + LL+     +D  DK + T ++LA + GH + V+LLL++ A I +    +AN    G + +  AI  G +   L  ++S++WE  L  QT S        + ++I  +P    E FK   ++ S+          YNF +L+   +      F +  K+E +V  E  +                                      L  MV+ +R DLL H +    L MKW  +G   +  NLAIY   L+ L   +I A  P  L  I           C  +K+       +K   E C  ++  M++ G+VKEA QLC  +  Y     NI++  +Y+ + + V   S C + I V    QWQ GA++ F S +N ++++++   +GI++VMF ++L T +R + LFF  I AF  +FY+ L  QVTF+    +++Q+  M +G++ ++  F       P  +  I Y   T+    +F L++ I+ MNLL+GLAV DI  VQ  A L+R+ MQV+L   +E  +P +  +R     +TVYPNR        +S +   F    +V+ ++  +D+  ++E  K  QK   + LT M      +  QN L+  ++ K+
Sbjct:   58 LLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGSHPYSLS-NGKFLSTLHFAATQGATEIVKFMVS---SYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILL----NAN----GASYIHEAIRFGKKDTVLVSIQSERWEEIL--QTFSHTSSYKCAILEMIYHLP----ESFKVGILNVSQ----------YNFTYLQCPLS------FRKAHKRENNVHYEPLTT-------------------------------------LNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAIIEE---------CEHLKRTDFYNSSMKQ--EFCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFV--SSLCHSPI-VVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVFLYPQVTFSRPYFALMQSFTMMLGDINYEEGFLK-----PLLDDQIEYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPFWFLKRVDKISITVYPNRPRIWGITFTSNFFHYFSSCDDVKAEIPINDETMELELWK--QKNRLKDLTTM------MQKQNDLIKLIIQKM 1001          

HSP 2 Score: 139.428 bits (350), Expect = 1.095e-32
Identity = 133/509 (26.13%), Postives = 233/509 (45.78%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQN---ESGTKLNL-ADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-----ID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIP-FHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLH-----AAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA 1848
            +N LD    +PLH+A + N L+C+K+L+    A+ N+ N  R++P+H A         I   H +  +     S T +NL  D+G     T  MQ            N+  +  L+ +GA    Q+  GC P+H  A  G+    + ++K  E     ID  I   +NE  +PLHLA  + + ++ K  +   ++ +       +   H A  +G  ++V  ++    D +   K++   + + +TPLH +V   H + A+  + +GA++++     R+ L LA    + + V LL+S  A+  + +   +  LH         KN       +      +   D +  TPL  A  +G   ++  L+  +  +    K  +S L+ A  +   +  + ++   +  +LL+  D KG  PLH+A  +G+EKIV  L+       + +    T +H AA  G T  +K L+E S   LI   D++ NT +HLA + G+ K + LLL  GA
Sbjct:   32 INALDSRGNTPLHWAVQKNKLDCLKVLLCRG-ADPNIQNCYRLSPLHLA---------IQLFHNSIAEALILHSTTDINLEGDLGN----TPVMQ-------ACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGSHPYSLSNGKFLSTLHFAATQGATEIVKFMVSSYSDDN---KIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV-FLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSI-GLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGA 514          

HSP 3 Score: 108.612 bits (270), Expect = 3.401e-23
Identity = 106/411 (25.79%), Postives = 174/411 (42.34%), Query Frame = 1
Query: 1045 LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH--QGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMK---------NHCDINVTEKGNKSALYLAVEHSYSDATKTIISD-------ENGK----------------------------KLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAK----------------------FGRTYIVKILVERSK--------------QSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ---NGAQVDSMDKAKITPLYLACKNGHDRLV 2022
            + A++    TPLH+AV+    D  KV L +GA  N       S LHLA      SI    +L S   + N+   L  TP+  A  K++ + +  L+ +GA +  ++     P+ + A  G  + + +++K         +H  IN T     S L+LAV++   D  K  IS         NGK                            K++ +PD     PLH +    + ++ + LI  GA  D +++E RTP+ LA                        +GR ++  ++++                 + L+ DED +  TPLH A + G P  +  LL       +++ NK S L FAA  G     Q LL+   +G  ++  D+  +TPL+LA +NGH+++V
Sbjct:   32 INALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHS-TTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDH-HINFTNNEKSSPLHLAVQNGNIDVVKACISYGSHPYSLSNGKFLSTLHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIV 440          

HSP 4 Score: 82.0333 bits (201), Expect = 4.833e-15
Identity = 87/339 (25.66%), Postives = 144/339 (42.48%), Query Frame = 1
Query:  262 SGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYR---------RKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQ--KRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLL--ISSNNLF-DQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGR---SALHLAAHQGSIEMVKLLV 1227
            S +N + +  +H  A +G  E + F++        K V+L D +  +PLH +  F+H+E  + L+ E  AN++  ++E  TP+  A              K   +       R       L    +  LNS   +M+  K+L+ +E                       D  GCTP+HYA   G   +   L+ L  + +  K     +PLH A  +  F   + LL  +S   L  D +E G  P H+A   G+ K+V +L+K+            + +R + T LHYA  +G+    K  LE   S+  +  T +   +A+HLA  +G  + V LL+
Sbjct:  208 SLSNGKFLSTLHFAATQGATEIVKFMVSSYSDD-NKIVDLPDGNDETPLHKSVLFDHVELAEYLISEG-ANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQMENIKKLVSDE-----------------------DCEGCTPLHYACRHGVPNSVNNLLGL-NMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALL-------LSDHRGW-TALHYAALSGYTRTIKTLLE--TSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLL 510          

HSP 5 Score: 82.0333 bits (201), Expect = 5.043e-15
Identity = 73/290 (25.17%), Postives = 132/290 (45.52%), Query Frame = 1
Query: 1231 FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIK-LLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAG-----AID---DVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNA----RNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMR 2061
            F    N  +    TPLH A +KN +  ++ L+ +GAD   ++    +PL +A    H    + L++ +  DIN+      + +  A      +A   ++    G KL       G +P+H+    G+ K + I++  G      ID   +  N E+ +P+HLA + G   +VK  +        +   +  +T LH AA  G  ++++ +++  +D N      + N  + L  +    +++ A+ L+  GA +DS DK   TPL LA      + V LLL   AD+ ++
Sbjct:   28 FFLGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLG--RGAKLCKQNKL-GCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGSHPYSLSNGKFLST-LHFAATQGATEIVKFMVSSYSDDNKIVDLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLK 313          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 333.183 bits (853), Expect = 1.937e-95
Identity = 302/1144 (26.40%), Postives = 529/1144 (46.24%), Query Frame = 1
Query:  310 EGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS-FEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS----IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEM 3696
            EGD+ +L   IK N RK  K     + + + PLH+AA    +E +++++  +S  V N+ +    TP+H AA                                        +K  +E  K          +L+S+GANPN+++    +P+H A         + L +    +I L+     T L   CA ++ E  ++LL     L    + G  P H A   G  K +++++   E         +  VN    +PLH AV++G  D  K+CL+ GA ++ +      ALH AA QG+ ++VKL++S +  + ++ N +    +T LH A+  +H  + +YLI  GADI S D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  ++ K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V +LL +NADI +     +         L  A+ N  ++  L  +++ +W+  L+  T +       P+ +++  +P+  + +   C + +++     DY I YNF++L+   +                                       +K+ PT  +  E   +      L VMV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   +++ +P   +   N T  +NG+     ++I          +IC  ++ + ++ G  KE  Q+   + NYF    N +E V+Y  + + V+ +      + +    QWQ GA++ F   MN +L++++    GIF+VM   +  T +R   +F   + AF  +FY+LL  Q  F++ L S+IQT  M +G++ +   F       P     + Y V+T+     F + + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   R   VYPNR        +   F   +E R+++   D   +ME LK  QK   + LT +
Sbjct:   41 EGDMCRLEDFIK-NRRKLSK----YEDENLCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAA----------------------------------------EKNQVESVK----------FLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASF--------LHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSN-RCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSM-------------------------------------TKKVAPTQDVVYEPLTI------LNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAF---NSTGIINGTSSTHEERIDTLNSF--PIKICMILVFLSSIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSIIFVLPLF-----LNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLE-----PLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPLWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILK--QKYRLKDLTSL 1059          

HSP 2 Score: 172.94 bits (437), Expect = 3.997e-43
Identity = 146/537 (27.19%), Postives = 250/537 (46.55%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNH--------VKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG VE +  +I  +   + + +N++D    +PLH AA  N +E VK L+ +  AN N+ N   ++P+H A      +  K+   HK +  N  G   N A + T      E  + L+E                 KGA     + +G  P+H AA  G +   E ++   E         I   +++  +PLHLA      ++ KM L +  ++   E   C+  H A  +G   +V ++I         S ++ AV+ + +T LH A    H D A+  +  GA +N+    GRS L LA    S  +V LL+   A  ++ + L +  LH   ++ +           +Q++ E   D    D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DE+ NT LH AA+ G+ K + +LL+Y AD
Sbjct:   68 LHHAAAEGQVELMELIINGS---SCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQG-ANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLE-----------------KGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGS---SDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMD---EDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEEGNTALHFAAREGHAKAVAMLLSYNAD 574          

HSP 3 Score: 90.8929 bits (224), Expect = 9.171e-18
Identity = 93/373 (24.93%), Postives = 166/373 (44.50%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN---VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGT-LNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMR--GNEVAAEQLMKLPEID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQ---TPLHAAAEKNHVKVVQYLIEKGADI 1344
            I+  NH+    +H   + GD++ +   +          +++++  K   LH+AA     + VK+++   + +   VN  +  + T +H A+          F+H +  +        L  VG  +NS   E +  LI    + + N  ++  L+ KGA  +I+D  G   +H    +  G      + M++  I   +  +DN+  TPLH AC          LL  + ++  + +    P H A   G I     L++   D    +++L   +    TPLH A KNGH    ++ L+KGA +    + G +ALH A+  G  + +K+++  + N   T++L +   T LH AA + H K V  L+   ADI
Sbjct:  233 INFVNHKKASPLHLAVQSGDLDMIKMCLDNGAH-----IDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASL---------FDHHDLAE-------YLISVGADINSTDSEGRSPLILATASASWN--IVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISD----TRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVIL--DTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADI 575          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 311.997 bits (798), Expect = 2.867e-88
Identity = 297/1144 (25.96%), Postives = 517/1144 (45.19%), Query Frame = 1
Query:  310 EGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS-FEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS----IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEM 3696
            EGD+ +L   IK N RK  K     + + + PLH+AA    +E +++++  +S  V N+ +    TP+H AA                                        +K  +E  K          +L+S+GANPN+++    +P+H A         + L +    +I L+     T L   CA ++ E  ++LL     L    + G  P H A   G  K +++++   E         +  VN    +PLH AV++G  D  K+CL+ GA ++ +      ALH AA QG+ ++VKL++S +  + ++ N +    +T LH A+  +H  + +YLI  GADI S D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  ++ K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V +LL +NADI +     +         L  A+ N  ++  L  +++ +W+  L+  T +       P+ +++  +P+  + +   C + +++     DY I YNF++L+   +                                       +K+ PT  +  E   +      L VMV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   +++ +P   +   N T  +NG+     ++I   +R                                NYF    N +E V+Y  + + V+ +      + +    QWQ GA++ F   MN +L++++    GIF+VM   +  T +R   +F   + AF  +FY+LL  Q  F++ L S+IQT  M +G++ +   F       P     + Y V+T+     F + + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   R   VYPNR        +   F   +E R+++   D   +ME LK  QK   + LT +
Sbjct:   41 EGDMCRLEDFIK-NRRKLSK----YEDENLCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAA----------------------------------------EKNQVESVK----------FLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASF--------LHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSN-RCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSM-------------------------------------TKKVAPTQDVVYEPLTI------LNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAF---NSTGIINGTSSTHEERIDTLKR--------------------------------NYFLDYNNALEWVIYTTSIIFVLPLF-----LNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLE-----PLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPLWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILK--QKYRLKDLTSL 1029          

HSP 2 Score: 172.94 bits (437), Expect = 4.245e-43
Identity = 146/537 (27.19%), Postives = 250/537 (46.55%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNH--------VKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG VE +  +I  +   + + +N++D    +PLH AA  N +E VK L+ +  AN N+ N   ++P+H A      +  K+   HK +  N  G   N A + T      E  + L+E                 KGA     + +G  P+H AA  G +   E ++   E         I   +++  +PLHLA      ++ KM L +  ++   E   C+  H A  +G   +V ++I         S ++ AV+ + +T LH A    H D A+  +  GA +N+    GRS L LA    S  +V LL+   A  ++ + L +  LH   ++ +           +Q++ E   D    D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DE+ NT LH AA+ G+ K + +LL+Y AD
Sbjct:   68 LHHAAAEGQVELMELIINGS---SCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQG-ANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLE-----------------KGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGS---SDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMD---EDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEEGNTALHFAAREGHAKAVAMLLSYNAD 574          

HSP 3 Score: 90.5077 bits (223), Expect = 9.351e-18
Identity = 93/373 (24.93%), Postives = 166/373 (44.50%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN---VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGT-LNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMR--GNEVAAEQLMKLPEID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQ---TPLHAAAEKNHVKVVQYLIEKGADI 1344
            I+  NH+    +H   + GD++ +   +          +++++  K   LH+AA     + VK+++   + +   VN  +  + T +H A+          F+H +  +        L  VG  +NS   E +  LI    + + N  ++  L+ KGA  +I+D  G   +H    +  G      + M++  I   +  +DN+  TPLH AC          LL  + ++  + +    P H A   G I     L++   D    +++L   +    TPLH A KNGH    ++ L+KGA +    + G +ALH A+  G  + +K+++  + N   T++L +   T LH AA + H K V  L+   ADI
Sbjct:  233 INFVNHKKASPLHLAVQSGDLDMIKMCLDNGAH-----IDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASL---------FDHHDLAE-------YLISVGADINSTDSEGRSPLILATASASWN--IVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISD----TRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVIL--DTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADI 575          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 229.95 bits (585), Expect = 3.544e-61
Identity = 191/679 (28.13%), Postives = 316/679 (46.54%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR------------YRRKAR-KIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEK---------------------------------GASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVER------------------SKQSLII-------------DEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       +PL+ AA+ NHLE VK L+E   AN NV  E+  TP+  A +            Y  K + ++   H  +R +++ T    A V   N    ++   L +   TP       +N  V   L+++GA+ N     G TP+H A+ RGN +    L+ +  +I+ + KD   +TPLH A  + H  I+++LL     +  + + G  P H+A    ++  V +L++ + + D+++        D+ TPLH A   GH   AKV L+K                                 GAS++AVT +G + LH+A+  G + +VK L+   A+ NV+N  ++TPLH AA   H +V +YL++  A   ++  D  TPL  AA  GH   +KLL++N    N+      + L+ A    + D    ++  E  +  +     KG  PLH+A + G  ++ ++L++  A  +   +   TP+H+A       IVK+L+ R                  +KQ+ I               E     TPLHLAA+ G+ +++ LLL+  A+ N  N + L+ L   + +G++  A VL+++G  VD+  +   TPL++A   G+ +LV  LL+H AD++ +          G +PL  A   GH      +LK
Sbjct:  108 VNAQSQKGFTPLYMAAQENHLEVVKFLLENG-ANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRT----AAVLLQNDPNPDV---LSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKD--ELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDIT-------LDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACM---TKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTK-------LGYSPLHQAAQQGHTDIVTLLLK 759          

HSP 2 Score: 225.328 bits (573), Expect = 1.206e-59
Identity = 183/623 (29.37%), Postives = 294/623 (47.19%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            +H  AR  D    + L++ +P       ++L     +PLH AA + +L   ++L+    A+VN   +  +TP+H A+R R     +        Q E+ TK  L     L+ A      R+ E   +   P    TKN    +++ ++G            N  I D      TP+H AA  G+   A+ L+     D   K N       TPLH+AC  NH  + ++LL +  ++    E+G  P H+A   G++ +V  L+++    +         N   +TPLH A + GH + AK  L+  A  NA     ++ LH AA  G   MVKLL+   A+ N+      TPLH AA + HV     L+EK A         +TPL +AA YG     +LL+++    N   K   + L++AV H+  D  K ++         H P + G  PLHIA +    ++ + L+  G   + ++ +  TP+HLAA+ G T +V +L+  SKQ+     ++   TPLHL ++ G+  V  +L+ +G   +A      + L  A+  GN+K  + LLQ+ A V++  K   +PL+ A + GH  +VTLLLK+ A  +  V+ +   PL
Sbjct:  181 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENLNVAQLLLNRG-ASVNFTPQNGITPLHIASR-RGNVIMVRLLLDRGAQIETRTKDELTP---LHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLL-----DKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPN-------VSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP---HSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLL--SKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN-EVSSNGTTPL 775          

HSP 3 Score: 185.652 bits (470), Expect = 3.605e-47
Identity = 154/557 (27.65%), Postives = 262/557 (47.04%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQN-PRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKL---PEI-DIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDE-NGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V     L+    P +AK        + +SP+H AA+ +HL+CV++L++  +A ++    + +TP+H AA    +R     +D   K NSR     T L++A         ++   R++E              L+  GA+ +     G TP+H A+  G+    + L++    P + ++K++     TPLH+A    H E+AK LL +      + +    P H A   G+  MV +L++     +  +           TPLH A + GH D A   LEK AS   +T  G + LH+AA  G + + +LL+  +A+ N   K   TPLH A   N++ +V+ L+ +G    S   + YTPL IAA     E  + L++     N       + L+LA +  +++    ++S + NG     + +  G  PLH+  ++G+  +  +LI  G   D       TP+H+A+ +G   +VK L++   Q+ +  + +   +PLH AA+ G+  ++ LLL  GA  N  + N  + L  A   G +    VL
Sbjct:  280 LHCAARNGHVRISEILLDHGAPIQAKTK------NGLSPIHMAAQGDHLDCVRLLLQY-NAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIA--------CKKNHIRVME-------------LLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVE-----TPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTA-------GHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN----LGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQH--QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          

HSP 4 Score: 181.415 bits (459), Expect = 8.562e-46
Identity = 138/481 (28.69%), Postives = 238/481 (49.48%), Query Frame = 1
Query:  745 GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTP-LHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE 2172
            G T +H AA+ G +    +L+     ++  +  +  TPL++A   NH E+ K LL +  N     E G  P  +A  +G+  +V  LI                    + P LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  A+ N T +   TPLH A+ + +V +V+ L+++GA IE+R  D  TPL  AA  GH    ++L+ +   I    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++ ++L+D GA  + +     TP+H+A K     ++++L+   K    ID   +S  TPLH+A+  G+  +++ LL  GA  N  N    + L  AA  G+ + A+ LLQN A+ ++  K   TPL+ A + GH  +V LLL++ A  ++           G  PL  A   GH   ALA+L+ +  +
Sbjct:   82 GNTALHIAALAGQDEVVRELVNY-GANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN------------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHL------TPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLL---KTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATT-------AGHTPLHTAAREGHVDTALALLEKEASQ 533          

HSP 5 Score: 160.999 bits (406), Expect = 1.746e-39
Identity = 116/392 (29.59%), Postives = 191/392 (48.72%), Query Frame = 1
Query: 1063 DYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----LHI-------------------PDF---KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKS 2160
            D  T    A ++G+ D A   L  G  +N     G + LHLA+ +G ++MV  L+  E     T K   T LH AA     +VV+ L+  GA++ ++    +TPL +AA   H E +K L++N  + NV  +   + L +A++  + +    +I+     K+    LHI                   PD     G  PLHIA    N  + Q+L++ GA  +   +   TP+H+A++ G   +V++L++R  Q  I    +D  TPLH AA++G+ ++ ++LL++GA   A+  N LS +  AA   +L   ++LLQ  A++D +    +TPL++A   GH R+  +LL   A  + R        L G  PL  A    H +    +LK+
Sbjct:   15 DAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQ--IETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRA-------LNGFTPLHIACKKNHIRVMELLLKT 397          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 229.95 bits (585), Expect = 4.685e-61
Identity = 174/613 (28.38%), Postives = 297/613 (48.45%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARY--------------RRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISM 2058
            +H  +  G  E +  L+K+        +N    +  +PL+ AA+ NH++ VK L+E   AN +   E+  TP+  A +               + K R    +    + +     L L +    +  ++ M  R  E   TP        N  V   L+++GA  +     G TP+H A+ RGN    + L+ +  +ID K +D   +TPLH A    H ++ ++LL     L  + + G  P H+A    +++ V  L++     D+       V  DY T LH A   GH    K+ L+K A+ NA    G + LH+A  +  I++++LLV + A+     +   TP+H AA   H+ +V  L++ GA  +  +I   T L +AA  G  E ++ L++N   ++   +  ++ L++A     ++  + ++     + + H PD     G  PLHI+ R+G   +  +L++AGA   +  ++  TP+H+AAK+G   + K+L++R  ++      ++  TPLH+AA     KV  LLL  GA  +A   N  + L  AA K  ++ A  LL  GA+ +++ K  +TPL+LA + GH  +VTLLL   A+I M
Sbjct:   80 LHIASLAGQAEVVKVLVKEGAN-----INAQSQNGFTPLYMAAQENHIDVVKYLLENG-ANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDD-------VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL-----QHMAH-PDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQR--RAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHM 669          

HSP 2 Score: 216.083 bits (549), Expect = 1.495e-56
Identity = 166/623 (26.65%), Postives = 297/623 (47.67%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPR---KAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-----SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGH 2130
            +H  AR+ D +  + L++ +     ++K  VN       +PLH AA + ++    +L+   +A V+      +TP+H A++               R N +  KL L   G +++ T +    L    ++   ++ V+  L+ + A    +   G +P+H AA   +    + L+  K P  D+ L   + +T LH+A    H+ + K+LL    N   +   G  P HIAC +  IK++++L+K           +QA+     TP+H A   GH +   + L+ GAS +     G +ALH+AA  G +E+V+ L+   A  +   +  QTPLH A+     ++VQ L++  A  ++   + YTPL I+A  G  +   +L++     ++  K   + L++A ++   D  K ++     +D  GK         G  PLH+A    N+K+  +L++ GA      +   TP+H+AAK  +  I   L+    ++  + +     TPLHLA++ G+  ++ LLL+ GA+ +    + L++L  AA +  +  A +L ++GA  D+  K   TPL +AC  G+ ++V  LLK  A+++ +          G  PL  A   GH
Sbjct:  175 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASK---------------RGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARS--GHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGAS-------IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN--------GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ--GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK-------NGYTPLHQAAQQGH 752          

HSP 3 Score: 184.496 bits (467), Expect = 1.214e-46
Identity = 124/358 (34.64%), Postives = 192/358 (53.63%), Query Frame = 1
Query: 1057 NRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-----SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            N++    LH A K GH    +  L +G+SV++ T  G +ALH+A+  G  E+VK+LV   AN N  ++   TPL+ AA++NH+ VV+YL+E GA+  +   D +TPL +A   GH + + +L++N    +   K    AL++A     + +   ++     +D   K +++     G  PLHIA   GN  +  +L++ GA  D       TP+H+A+K G T +VK+L++R  Q  I  +  D  TPLH AA+SG+ +V++LLL   A   AR  N LS L  AA   +++  + LLQ  A VD +    +T L++A   GH R+  LLL   A+ + R        L G  PL  A
Sbjct:   40 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ--IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-------LNGFTPLHIA 384          

HSP 4 Score: 155.221 bits (391), Expect = 1.410e-37
Identity = 118/418 (28.23%), Postives = 213/418 (50.96%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTP-LHAAAEKNHVKVVQYLIEK--GADIESRDI------DSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
            IDI   +   +  LHLA    H  + + LL   +++    + G    HIA   G  ++V +L+K+  +       + A +++  TPL+ A +  H D  K  LE GA+ +  T  G + L +A  QG  + V +L+      N T   ++ P LH AA K+  K    L++    AD++S+ +        +TPL IAA YG+     LL+     ++ T +   + L++A +   ++  K ++ D  G+  +      G  PLH A R G++++V++L++  A    + +   +P+H+AA+      VK L++   ++ + D   D  T LH+AA  G+ +V +LLL+  A+ NAR  N  + L  A  K  +K  ++L++ GA + ++ ++ +TP+++A   GH  +V LLL++ A
Sbjct:   34 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGAN-------INAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLL-DRGGQ--IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQY--KAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGA 434          

HSP 5 Score: 144.821 bits (364), Expect = 2.026e-34
Identity = 127/512 (24.80%), Postives = 214/512 (41.80%), Query Frame = 1
Query:  241 YRLSRII----SGTNHRSIDN---MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYR---------RKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL 1728
            YR+++++    +  N R+++    +H   ++  ++ +  L+K         +  +    ++P+H AA   HL  V +L++   A+ +V N    T +H AAR           R    +D     +R  E  T L++A              RL + E        ++  L+   A+P+   T G TP+H +A  G    A  L++       L   +  TPLH+A  +   ++AK+LL          + G  P H+A    N K+  +L++K            A  ++  TPLH A K      A   L  GA  N VT  G + LHLA+ +G  +MV LL+   AN +++ K   T LH AA+++ V V   L + GAD ++     YTPL++A  YG+ + +  L+K   ++N   K                                     G  PLH A + G+  I+ +L+  GA  +       T + +A + G   +V  L
Sbjct:  357 YRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYG-----ASIQAITESGLTPIHVAAFMGHLNIVLLLLQNG-ASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIA-------------SRLGKTE--------IVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH-SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASP-------HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK------------------------------------NGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 229.95 bits (585), Expect = 8.810e-61
Identity = 174/613 (28.38%), Postives = 297/613 (48.45%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARY--------------RRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISM 2058
            +H  +  G  E +  L+K+        +N    +  +PL+ AA+ NH++ VK L+E   AN +   E+  TP+  A +               + K R    +    + +     L L +    +  ++ M  R  E   TP        N  V   L+++GA  +     G TP+H A+ RGN    + L+ +  +ID K +D   +TPLH A    H ++ ++LL     L  + + G  P H+A    +++ V  L++     D+       V  DY T LH A   GH    K+ L+K A+ NA    G + LH+A  +  I++++LLV + A+     +   TP+H AA   H+ +V  L++ GA  +  +I   T L +AA  G  E ++ L++N   ++   +  ++ L++A     ++  + ++     + + H PD     G  PLHI+ R+G   +  +L++AGA   +  ++  TP+H+AAK+G   + K+L++R  ++      ++  TPLH+AA     KV  LLL  GA  +A   N  + L  AA K  ++ A  LL  GA+ +++ K  +TPL+LA + GH  +VTLLL   A+I M
Sbjct:   97 LHIASLAGQAEVVKVLVKEGAN-----INAQSQNGFTPLYMAAQENHIDVVKYLLENG-ANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDD-------VTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL-----QHMAH-PDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQR--RAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHM 686          

HSP 2 Score: 215.312 bits (547), Expect = 3.157e-56
Identity = 166/623 (26.65%), Postives = 297/623 (47.67%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPR---KAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-----SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGH 2130
            +H  AR+ D +  + L++ +     ++K  VN       +PLH AA + ++    +L+   +A V+      +TP+H A++               R N +  KL L   G +++ T +    L    ++   ++ V+  L+ + A    +   G +P+H AA   +    + L+  K P  D+ L   + +T LH+A    H+ + K+LL    N   +   G  P HIAC +  IK++++L+K           +QA+     TP+H A   GH +   + L+ GAS +     G +ALH+AA  G +E+V+ L+   A  +   +  QTPLH A+     ++VQ L++  A  ++   + YTPL I+A  G  +   +L++     ++  K   + L++A ++   D  K ++     +D  GK         G  PLH+A    N+K+  +L++ GA      +   TP+H+AAK  +  I   L+    ++  + +     TPLHLA++ G+  ++ LLL+ GA+ +    + L++L  AA +  +  A +L ++GA  D+  K   TPL +AC  G+ ++V  LLK  A+++ +          G  PL  A   GH
Sbjct:  192 LHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASK---------------RGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARS--GHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGAS-------IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN--------GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ--GVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK-------NGYTPLHQAAQQGH 769          

HSP 3 Score: 184.496 bits (467), Expect = 1.524e-46
Identity = 131/391 (33.50%), Postives = 202/391 (51.66%), Query Frame = 1
Query:  958 FHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-----SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            F  A   GN+  V   +K   D       +   N++    LH A K GH    +  L +G+SV++ T  G +ALH+A+  G  E+VK+LV   AN N  ++   TPL+ AA++NH+ VV+YL+E GA+  +   D +TPL +A   GH + + +L++N    +   K    AL++A     + +   ++     +D   K +++     G  PLHIA   GN  +  +L++ GA  D       TP+H+A+K G T +VK+L++R  Q  I  +  D  TPLH AA+SG+ +V++LLL   A   AR  N LS L  AA   +++  + LLQ  A VD +    +T L++A   GH R+  LLL   A+ + R        L G  PL  A
Sbjct:   31 FLRAARAGNLDKVVEYLKGGID-------INTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ--IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-------LNGFTPLHIA 401          

HSP 4 Score: 155.221 bits (391), Expect = 1.565e-37
Identity = 119/418 (28.47%), Postives = 213/418 (50.96%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTP-LHAAAEKNHVKVVQYLIEK--GADIESRDI------DSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
            IDI   +   +  LHLA    H  + + LL   +++    + G    HIA   G  ++V +L+K+  +       + A +++  TPL+ A +  H D  K  LE GA+ +  T  G + L +A  QG  + V +L+      N T   ++ P LH AA K+  K    L++    AD++S+ +        +TPL IAA YG+     LL+     ++ T +   + L++A +   ++  K ++ D  G+      D  G  PLH A R G++++V++L++  A    + +   +P+H+AA+      VK L++   ++ + D   D  T LH+AA  G+ +V +LLL+  A+ NAR  N  + L  A  K  +K  ++L++ GA + ++ ++ +TP+++A   GH  +V LLL++ A
Sbjct:   51 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGAN-------INAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLL-DRGGQIDAKTRD--GLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQY--KAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGA 451          

HSP 5 Score: 144.436 bits (363), Expect = 3.051e-34
Identity = 127/512 (24.80%), Postives = 214/512 (41.80%), Query Frame = 1
Query:  241 YRLSRII----SGTNHRSIDN---MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYR---------RKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL 1728
            YR+++++    +  N R+++    +H   ++  ++ +  L+K         +  +    ++P+H AA   HL  V +L++   A+ +V N    T +H AAR           R    +D     +R  E  T L++A              RL + E        ++  L+   A+P+   T G TP+H +A  G    A  L++       L   +  TPLH+A  +   ++AK+LL          + G  P H+A    N K+  +L++K            A  ++  TPLH A K      A   L  GA  N VT  G + LHLA+ +G  +MV LL+   AN +++ K   T LH AA+++ V V   L + GAD ++     YTPL++A  YG+ + +  L+K   ++N   K                                     G  PLH A + G+  I+ +L+  GA  +       T + +A + G   +V  L
Sbjct:  374 YRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYG-----ASIQAITESGLTPIHVAAFMGHLNIVLLLLQNG-ASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIAS-------------RLGKTE--------IVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAH-SLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASP-------HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTK------------------------------------NGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18297|TRPA1_CAEEL (Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5)

HSP 1 Score: 468.003 bits (1203), Expect = 1.838e-142
Identity = 386/1213 (31.82%), Postives = 602/1213 (49.63%), Query Frame = 1
Query:  271 NHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSA--LHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGAD-IESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYL--------AVEH------------------SYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE--------IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPY-----------LYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRR--RYIIRKLTVYPNRESSIYKTLF-GIGREVRRQ----MCKDDQLDDM-ERLKLHQKATTEQLTEMKFKLRNLHSQNHLM 3738
            N RSI  +H+ AREG+V  L    ++   KA   VN  D D M+PLHYAAR+ + + VK+L+ + +A  N  N E  TP+H A++Y                        +     + S  +E Q     +  T TK   +I  LVS+ A  +  + Y  TP+HYAAM+ N  A   L+KL + D+  +D+  MTPL LAC H   EI + L+ +++N+  +++     FHI    G  + ++M++    D  E  K L   N + KTPL  AV+  H +  K  L+     N+  +  R    +H AA +G +E++K LV    N N  N++   PLH AA+ N ++VV YLIE+  D I+  D    TPL++A ++   + ++ L+    ++ +T+K  ++ +++        +VE+                  S +  T  I+S++  + ++++ D   N P+HI   +G  +++Q+L   GA     NE+E T +H AA  G+T  V+ L+E   + L++ +DE  N+ LHLAA+SG+    ++LL+ GADK A+N  + + L  A   G L+  Q L+  GAQ++S    K T L+ A   G++ +V   +     I  R          G    D A +N H+  A A L++D+W+        I L      +     TP R L+ K P++A  V   C +  SK       ++ YNFEFL+D+Y                 V D+     +I        YDE+ KL   A+ Y  +   + K HPL +M    +  LL+H +   LL+ KWN  G  +YY  L +YL +++SL  Y+   + PY            YF  N+T       C Q+              + K II  + V  ++ E  QL   +  Y  + EN ++  +Y  A +TV D S C    GVR+ WQW   A+  F   +NL+  IRK+P FGIFVVMF D++ TF RF P+F LFI AF+ +FY++L N+  F+++  S ++TTVM IGE EF  IF+     +        +  V   +F  F ++M+I+ MNLLVGLAVDDIK VQEKA L+R+ MQV L L++E  +  FI+R  +Y   +   +P     ++KT F G     RR+    +  D ++D+M ER        T++L     KL+N+     +M
Sbjct:   49 NLRSI--IHQSAREGNVNAL----QEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSK-NALPNTKNREGDTPLHIASKY------------------------IYGYSDICSIIDEDQADSARKYNTATKK--IINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKL-KADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMM--DHDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKK-NSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLM-KDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQIESSSDTK-TVLHTAAFYGNESIVRYFIAEGVTIDRRDE-------EGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNC-IEKSKEETDSTQSVAYNFEFLDDTYMMRC-------------VSDDGTGEQLI---GCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLTQYVRHTKAPYNVWNEESYYDSEYFDENET-------CPQINTT-------KPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYVILQNRPEFSTIFMSPLKTTVMMIGEFEFTGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASLHFFIQRTKKYATCRYATFPY--GKLHKTGFAGWWSNFRRRFGLSVSTDPEIDEMYEREAEFTSEMTQKLQNQAAKLKNIQENIDVM 1182          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O75762|TRPA1_HUMAN (Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3)

HSP 1 Score: 355.525 bits (911), Expect = 2.225e-102
Identity = 288/1019 (28.26%), Postives = 496/1019 (48.68%), Query Frame = 1
Query:  700 YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLN-----GSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEF-DSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS------IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLT 3690
            +L+S+GANPN+++     P+H A    N    + L++   ID+ L+     T + +AC  N+ E  ++LL          + GC P H A   G+ + ++++++  E+     ++ +  +N    TPLH AV+NG  +  K+CL+ GA ++ V     +A+H AA QG+ E+VKL++S  +      N T+   +T LH A+  +H ++  YLI  GADI   D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  +  K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V LLL HNADI +     +         L  A+ N  ++  L I++S +W+  L+  + +  G    P+ ++I  +P+  + +   C + +++     DY I YNF++L+           +E  KK       + +  VI + ++                             L  MV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   ++  +P   +   N T  +N       I       L+K         C  ++ + ++ G  KEA Q+   + NYF  + N++E ++Y    + V+ +      + +    QWQ GA++ +   MN +L++++    GIF+VM   +L T +R   +F   + AF  +FYILL  Q  F+S L SIIQT  M +G++ + +S              L F  +V++TIF      + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   +   VYPN+  S      I+  LF  G E+R+++   D+  +ME LK  QK   + LT
Sbjct:  116 FLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASF--------LHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGN-KCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCP---------LEFTKK-------TPTQDVIYEPLT----------------------------ALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAF---NSTGIINETSDHSEILDTTNSYLIK--------TCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLF-----VEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIF------VPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTG-EIRQEIPNADKSLEMEILK--QKYRLKDLT 1055          

HSP 2 Score: 174.096 bits (440), Expect = 1.424e-42
Identity = 141/534 (26.40%), Postives = 245/534 (45.88%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAE-----KNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG +E +  + + +   + + ++ +D    +PLH A   N +E VK L+    AN N+ N   + P+H A +    +  K+   H+    N  G   N A +                     T N+  +  L+ KGA P   + +GC P+H AA  G++   E +++  E       + I   +N   TPLHLA  +   E+ KM L +   +   E+  C   H A  +G  ++V ++I       ++   +   +  ++T LH A    H + A   +  GA +N +   GRS L LA    S  +V LL+S  A  ++ +   +  LH   +     KN       + +    +   D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DED NT LH AA+ G+ K + LLL++ AD
Sbjct:   67 LHYAAAEGQIELMEKITRDS---SLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRG-ANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACT-----------------TNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDI---VNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEDGNTALHFAAREGHAKAVALLLSHNAD 573          

HSP 3 Score: 99.3673 bits (246), Expect = 1.427e-19
Identity = 96/363 (26.45%), Postives = 167/363 (46.01%), Query Frame = 1
Query: 1177 LHLAAHQGSIEMVKLLVSFEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHC-DINVTEKGNKSALYLAVEHSYSDATKTII--------SDENGKKLLHIPDFKG-----------------------NF-------PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDS--NTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKN--GHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNG 2127
            LH AA +G IE+++  ++ +++  V +++     TPLH A EKN ++ V++L+ +GA+   R+ +   PL IA    + E +K+L+++   D+N+  +   +A+ +A   + S+A + ++        S++ G   +H   F G                       NF       PLH+A ++G+ +++++ +D GA  D   +   T +H AA  G T IVK+++     S+ I    D    T LH A+   + ++   L++ GAD N  +    S L  A    +     +LL  GAQVD  D      L+L  +   G   L    ++    I   V  + ND   GC PL  A   G
Sbjct:   67 LHYAAAEGQIELMEK-ITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQ-QIKELVMDEDND---GCTPLHYACRQG 424          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BLA8|TRPA1_MOUSE (Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.355e-94
Identity = 302/1144 (26.40%), Postives = 529/1144 (46.24%), Query Frame = 1
Query:  310 EGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANV-NVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS-FEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS----IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEM 3696
            EGD+ +L   IK N RK  K     + + + PLH+AA    +E +++++  +S  V N+ +    TP+H AA                                        +K  +E  K          +L+S+GANPN+++    +P+H A         + L +    +I L+     T L   CA ++ E  ++LL     L    + G  P H A   G  K +++++   E         +  VN    +PLH AV++G  D  K+CL+ GA ++ +      ALH AA QG+ ++VKL++S +  + ++ N +    +T LH A+  +H  + +YLI  GADI S D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  ++ K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V +LL +NADI +     +         L  A+ N  ++  L  +++ +W+  L+  T +       P+ +++  +P+  + +   C + +++     DY I YNF++L+   +                                       +K+ PT  +  E   +      L VMV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   +++ +P   +   N T  +NG+     ++I          +IC  ++ + ++ G  KE  Q+   + NYF    N +E V+Y  + + V+ +      + +    QWQ GA++ F   MN +L++++    GIF+VM   +  T +R   +F   + AF  +FY+LL  Q  F++ L S+IQT  M +G++ +   F       P     + Y V+T+     F + + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   R   VYPNR        +   F   +E R+++   D   +ME LK  QK   + LT +
Sbjct:   41 EGDMCRLEDFIK-NRRKLSK----YEDENLCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAA----------------------------------------EKNQVESVK----------FLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASF--------LHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSN-RCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSM-------------------------------------TKKVAPTQDVVYEPLTI------LNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAF---NSTGIINGTSSTHEERIDTLNSF--PIKICMILVFLSSIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSIIFVLPLF-----LNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLE-----PLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPLWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILK--QKYRLKDLTSL 1059          

HSP 2 Score: 172.94 bits (437), Expect = 2.796e-42
Identity = 146/537 (27.19%), Postives = 250/537 (46.55%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNH--------VKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG VE +  +I  +   + + +N++D    +PLH AA  N +E VK L+ +  AN N+ N   ++P+H A      +  K+   HK +  N  G   N A + T      E  + L+E                 KGA     + +G  P+H AA  G +   E ++   E         I   +++  +PLHLA      ++ KM L +  ++   E   C+  H A  +G   +V ++I         S ++ AV+ + +T LH A    H D A+  +  GA +N+    GRS L LA    S  +V LL+   A  ++ + L +  LH   ++ +           +Q++ E   D    D D  TPL  A   G   ++  L+  +  I+   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DE+ NT LH AA+ G+ K + +LL+Y AD
Sbjct:   68 LHHAAAEGQVELMELIINGS---SCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQG-ANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLE-----------------KGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGS---SDIVNAVDGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMD---EDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEEGNTALHFAAREGHAKAVAMLLSYNAD 574          

HSP 3 Score: 90.8929 bits (224), Expect = 6.415e-17
Identity = 93/373 (24.93%), Postives = 166/373 (44.50%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN---VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGT-LNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMR--GNEVAAEQLMKLPEID--IKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQ---TPLHAAAEKNHVKVVQYLIEKGADI 1344
            I+  NH+    +H   + GD++ +   +          +++++  K   LH+AA     + VK+++   + +   VN  +  + T +H A+          F+H +  +        L  VG  +NS   E +  LI    + + N  ++  L+ KGA  +I+D  G   +H    +  G      + M++  I   +  +DN+  TPLH AC          LL  + ++  + +    P H A   G I     L++   D    +++L   +    TPLH A KNGH    ++ L+KGA +    + G +ALH A+  G  + +K+++  + N   T++L +   T LH AA + H K V  L+   ADI
Sbjct:  233 INFVNHKKASPLHLAVQSGDLDMIKMCLDNGAH-----IDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASL---------FDHHDLAE-------YLISVGADINSTDSEGRSPLILATASASWN--IVNLLLCKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISD----TRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVIL--DTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADI 575          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6RI86|TRPA1_RAT (Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 7.621e-94
Identity = 301/1144 (26.31%), Postives = 526/1144 (45.98%), Query Frame = 1
Query:  310 EGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS-FEANFNVTNKL---MQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYS--DATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS----IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEM 3696
            EGD+ +L   IK N RK  K     + + +  LH+AA    +E +++++  +S   +NV ++   TP+H+AA                                        +K  +E  K          +L+S+GANPN+++     P+H A         + L +    +I L+     T L   CA ++ E  ++LL     L    + G  P H A   G  + +++++   E         +  VN    +PLH AV++G  D  K+CL+ GA ++ +      ALH AA QG+ ++VKL++S +  + ++ N +    +T LH A+  +H  +  YLI  GADI S D +  +PL++A +      + LL+     +++ +   ++ L+L V+  Y   +     +  ++ K+L+   D  G  PLH ACR G    V  L+        K++++++P+H AA +GR    + L++    + +++E D    TPLHLAAK+G+ KV+QLLL  GA     + N  +AL  A+  G  +  +V+L    +  D +D+   T L+ A + GH + V +LL +NADI +     +         L  A+ N  ++  L  ++S +W+  L+  T         P+ +++  +P+  + +   C + +++     DY I YNF++L+   +                                       +K+ PT  +  E   +      L VMV+  R +LL+H +    L MKW  +G   +  NL  Y   L+ +   +++ +P   +   N T  +N +I    ++I          +IC  ++ + ++ G  KE  Q+   + NYF    N +E V+Y  + + V+ +      + +    QWQ GA++ F   MN +L++++    GIF+VM   +  T +R   +F   + AF  +FY+LL  Q  F++ L S+IQT  M +G++ +   F       P     + Y V+T+     F + + I+ MNLL+GLAV DI  VQ+ A+L+R+ MQV L   +E  +P +  R+   R   VYPNR        +   F   +E R++    D   +ME LK  QK   + LT +
Sbjct:   41 EGDMCRLEAFIK-NRRKLSK----YEDENLCLLHHAAAEGQVELMQLIINGSSCEALNVMDDYGNTPLHWAA----------------------------------------EKNQVESVK----------FLLSQGANPNLRNRNMMAPLHIAVQGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKRCMELILAYGEKTGYSREAHINFVNHKKASPLHLAVQSGDLDMIKMCLDSGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAVDGNQETLLHRASLFDHHDLADYLISVGADINSTDSEGRSPLILATASASWNIVNLLLSKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFLQMQHIKELVMDEDNDGCTPLHYACRQGAPVSVNNLLRFNVSVHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASF--------LHIALHNKRKEVVLTTIRSKRWDECLQVFTHDSPSN-RCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSM-------------------------------------TKKVTPTQDVIYEPLTI------LNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAF---NSTGIINETISTHEERINTLNSF--PLKICMILVFLSSIFGYCKEVVQIFQQKRNYFLDYNNALEWVIYTTSMIFVLPLF-----LDIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLSLIQTFSMMLGDINYRDAFLE-----PLFRNELAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILK--QKYRLKDLTSL 1059          

HSP 2 Score: 179.489 bits (454), Expect = 2.594e-44
Identity = 148/537 (27.56%), Postives = 252/537 (46.93%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR-YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE-------IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNH--------VKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            +H  A EG VE +  +I  +  +A   +N++D    +PLH+AA  N +E VK L+ +  AN N+ N   + P+H A +    +  K+   HK +  N  G   N A + T      E  + L+E                 KGA     + +G  P+H AA  G +   E ++   E         I   +++  +PLHLA      ++ KM L S  ++   E   C+  H A  +G   +V ++I         S ++ AV+ + +T LH A    H D A   +  GA +N+    GRS L LA    S  +V LL+S  A  ++ + L +  LH   ++ +           +Q++ E   D    D D  TPL  A   G   ++  L++ +  ++   K  KS L+ A  +   +  + ++ D +  +LL+  D  G  PLH+A ++G++K+VQ+L+  GA+  + +    T +H A+  G T  +K++++ + +    D  DE+ NT LH AA+ G+ K + +LL+Y AD
Sbjct:   68 LHHAAAEGQVELMQLIINGSSCEA---LNVMDDYGNTPLHWAAEKNQVESVKFLLSQG-ANPNLRNRNMMAPLHIAVQGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLE-----------------KGAKLCKSNKWGDYPVHQAAFSGAKRCMELILAYGEKTGYSREAHINFVNHKKASPLHLAVQSGDLDMIKMCLDSGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGS---SDIVNAVDGNQETLLHRASLFDHHDLADYLISVGADINSTDSEGRSPLILATASASWNIVNLLLSKGAKVDIKDHLGRNFLHLTVQQPYGLRNLRPEFLQMQHIKELVMD---EDNDGCTPLHYACRQGAPVSVNNLLRFNVSVHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGAL-FLSDHNGWTALHHASMGGYTQTMKVILDTNLKC--TDRLDEEGNTALHFAAREGHAKAVAMLLSYNAD 574          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z020|TRPA1_DROME (Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4)

HSP 1 Score: 285.419 bits (729), Expect = 7.002e-78
Identity = 273/1004 (27.19%), Postives = 474/1004 (47.21%), Query Frame = 1
Query:  700 YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPE--IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQE-ETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN-----FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHS-----YSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGA----DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE---IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFG-------LVVY---------YCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEI--CKYIIVVMTVVGLVKEAAQLCLNRANYFSLE--NIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXX-------NQVTFNSLLNSIIQTTVMTIGELEFDSIF-NTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPN 3558
            YL+S   +  + +     P+H A    N+V + ++M      IDI+       T LHLA  ++H E A++L+   +    +    G  P H A    + K +++  +  E +     +M+   + +   PLH AV  G   A ++CL+ GA ++   +   + +HLA  QG+I++VKL+   +        + T+    TPLH A+  +H  +V YL+ +GADI + D +  +PLL+AAS    +T+ LL++    I+V +   ++ L+  + +      +++      +    K LL+  D  G  PLH A RDG+ + ++ LI  GA  ++KN    +P+H AA++GR   V+ L++  K S II+E + +  TPLH++++ G+ +V+QLLLN GA    D   RN      L  AA  G  +  ++L    +  +D +DK   T L+LA        +++L+     +   V           + +D AI   + + ALA++  ++     +ALR+               LI  MP V E V  KC    +   D   + I Y+F FL+  +               F   DE    S+   +             P   L T              MV   R +LL H +    L+MKWN++G       L++Y         Y +L +    L +     +       +      +  N S+ +Q++    +ER+  +  I  C  +IVV  ++  ++E  Q+   + +Y  LE  N++  V+Y+ A V V      Q + G+     +   +++ F+S   L+LF+++    GI+VVMF ++L T I+ L +F + I AF  AFYILL+       N ++F+++  S+++T  M +GEL+F   + NT + +       +   + ++ I  +F+++M I+ MNLL+GLAV DI++V+  A L+R+ MQV L  E+E  +P    +R    +L  YPN
Sbjct:  141 YLLSIPVDTGVLNEKKQAPVHLAT-ELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRN-----PLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNV--------LDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLA------LIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFM--------------FAKIDEKTGESITTASP-----------IPLPALNT--------------MVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYI-LETVNLISWVLYISALVMV--TPAFQPDGGINT-IHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILLSKIIDPQPNHLSFSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ------LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLPHVWLQRVDKMELIEYPN 1075          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A210R3P2 (Transient receptor potential cation channel subfamily A member 1-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00226 PE=3 SV=1)

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 504/1173 (42.97%), Postives = 701/1173 (59.76%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQ---NPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD---ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSL-KGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYA--SWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKH-SAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDN-RLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE-----SSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIV 3762
            +H+ AR GDV     LI Q   + +   K +N+ D D+++PLHYAAR+NH    K+LV+   A+ N  + E +TP+H+AARYRR+        KN+  ++      L D       T +    L++        N+VI YLV  GAN N QD YG TP+HYAAMRGNE AA++LM   +IDI+  D + MT LH+A  HN  EI K+L+ +   L  Q++    P H  C EGNI +V +L +    QD    +S M+   + D  T LH AV+NGH D  K+CLEK A VN       + +HLA+  G I+ +KLLV   A  +  N +  TPLH A   NHV+VV+YLIE+GA++E +D D+YTPLL+AASYGH + IKLL++   D    EK +K+ALYLA E    DA K ++     ++L+++ D   N PLHIA   G   IV+ L++     D KNEEE+TP+HLAAK GRT IV+ LV R   S + DEDEDSNT LHLAA+ G+ K   +LL+ GAD  ARNCN  + LD AA+KG +K  +VLL+  A ++ MDK K TPL+LA + GH  +V LLL+  A+I      D+N      N LD AIDN H   AL I+ S+ WE ALRN+T  L      TPMRKLI+KMPD+AE VF KC   N K  +H DY +T+N+EFL+D Y+  +W                      S    +     Y+E+  L  +A+ YT D   + KNHPLM+MV  +REDLL H +V++LLR KWN+FG V YY N  +Y  +L  L  Y++   PPY Y     T G N S C  V         +H  A+I KY+++ +    L++E  Q+   +  Y   EN++E + YV A + VID   CQ   G R  WQW  GA++ F++ ++LVLF++K P FGI+VVMF D+L TFI+F  +FFLFI AFA  FY +L NQV F +   ++++T+VM IGE E+D+IFN      P D+   ++ + VTY +F IF+++MSII MNLLVGLAVDDIKAVQE+A L+RM MQV LAL+VE +VPEFIRR+++ +K T+ PN+      S +     G           + +LDD+E+++  Q+   + + +++F ++ + SQN  +  M+T ++
Sbjct:   61 LHQCARNGDVRSTQILIGQIKASSKNTYKKINVRDEDRITPLHYAARYNHKAVAKLLVDNG-ADPNCRDSENLTPLHYAARYRRQ------RQKNTDTDDDDDGPELPD------NTPQDDSALVD--------NSVISYLVQNGANINKQDKYGQTPLHYAAMRGNEFAAKELMSYKDIDIETVDMQKMTALHMAATHNQVEITKLLIDAGAPLRCQDDEDSTPLHCCCSEGNIDIVKLLFEAGSRQDGWVTISNMVTDRDCDQSTCLHMAVENGHYDVVKLCLEKRADVNTPASNYMNPIHLASKAGDIKCLKLLVEHHARIDALNDVQATPLHIACAFNHVEVVEYLIERGANLEKKDKDNYTPLLMAASYGHADIIKLLLRKRVDHEAVEKNDKTALYLAAEEDNLDALKALLMVGRVRRLVNVGDRYDNTPLHIAAEKGYLNIVKCLLEQKVDVDAKNEEEQTPLHLAAKSGRTNIVRELVLRDHSS-VNDEDEDSNTALHLAAECGHAKAAGVLLDNGADVAARNCNLWTPLDSAASKGWVKTCKVLLEADAPINPMDKTKTTPLHLAARFGHSGVVELLLQWKANIQQ---NDSNSD----NCLDLAIDNNHPDVALTIINSEMWEDALRNETSELGTDQKSTPMRKLIKKMPDIAEAVFNKCMTDNKKSFEHPDYKVTFNYEFLDDVYSLGTW-----------------RETGPSESGGSSDGSVYNEDFTLSSSAKPYTTDSSEMKKNHPLMIMVTSKREDLLAHPLVTSLLRHKWNSFGRVFYYINFFVYAIFLTFLTGYILSTSPPYSY----STTG-NAS-CELVYTSTSPVYEQHIVAKIGKYVVIALAAWNLLRELLQIYQAKLQYLGWENLIEWLTYVFALLLVIDFQDCQKTTGYRFDWQWSLGAIAIFLAWIDLVLFLQKFPRFGIYVVMFKDILNTFIQFFIVFFLFIVAFALGFYTVLQNQVPFKTFGQALVKTSVMMIGEFEYDAIFNGN----PADHTEKVYQESVTYILFVIFMIIMSIIIMNLLVGLAVDDIKAVQEQAALKRMAMQVALALDVERIVPEFIRRKFVTKKQTIKPNQGLKNPFSQLANLEAGDLSSAAINKALNPELDDIEKVQEAQERLQKDVGKLRFSVKEMRSQNTKLESMMTALL 1177          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3J6X3 (transient receptor potential cation channel subfamily A member 1 homolog isoform X2 OS=Lingula unguis OX=7574 GN=LOC106170600 PE=3 SV=1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 485/1192 (40.69%), Postives = 732/1192 (61.41%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESG--TKLNLADVGTLNSATEE------MQKRLIEEEKTPT----KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD---ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSL-KGYV-DTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLC-PTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYL---YFIRNKTVGLNGSICAQVKQILVKERLKHS------AEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQ-TEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNR-----LIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKN 3768
            +H+ AR+G+ ++L  L+       KK +N  D +K+SPLHYAAR+NH E V+ILVE   A+VN   E+ +TP+HFAAR++R  R    +  +  +  S   T  + A V T  S  EE      +    + EE T         +V+ YLV +GA  N QD YG TP+H+AAMRGN++ + +L+ +  IDI+  D + MT LHLA  H+  E++++L+ +  NL   ++    P H+A  EGNIK+V ML +  + +D    LS+M+   N +  T LH AV N H + AK+ LEKG   NA      + LHLA+  G + +V+LL+   A  +  N   +TPLH AAE +H +VV+ L++  ADIE RD D++TPLL+AA +G+ E +K+L++ + D +  +K +K+A++ A E ++    + ++ +    KL+   D  GN PLHIA + G+   V++L++  A+ D KNE+E+TP+HLAA  GRT +V+ LV R K +++ DEDE+SNT LHLAA +G+ KV+ +LL+ GAD  ARN    +ALD AA  G +KAA+ LL+  + +D +D+ K+TPL+LA K GH  LV LL+K  A+++ R   D +    G N LD AID  H   A+AI+K+DKWE A++NQ   + KG V DTP+RKLIRKMPDVAE+VF  C   N  + +H D  IT+N+E+L+D YA WG         ++   D  S S S+         YDE+  +  P  R Y++D +++ KNHPL +MV  +REDLL H +VS+LL+ KW+ FG   YY NL  Y  +L  L  YM+  EPPY+   Y   N T     S C ++    + + +++         I K+I++ + V+ LV+E  Q+C ++ NY ++EN +E ++YV A + VID  +CQ +   +R PWQW  GA++ F++ + L+LFIRK+P FGI+VVMFTD+L TF +F  +F LFI AF   F++LL NQ  F+S   S+++T VM IGE EFD+ + T   E  P+ +      ++Y+ VTY IF +FL++MSI+ MNLLVGLAVDDIKAVQ++A L+R+ MQ+ LAL+VE  +P F+RRR +I++  + PN++S   K        + + +    +LD M+ ++  Q+ T   + ++K +++ L S    +  M+T ++K+
Sbjct:   52 LHQCARDGNPDKLRRLLDY-LGNVKKKINAHDENKLSPLHYAARYNHFEAVRILVERG-ADVNNKGEDDLTPLHFAARFKRMKRIKSTDSLDEVEGSSAPLTPSSEATVETAVSNEEEGADGENVPNGAVREEVTSDDELDNQPSVVKYLVERGAKVNAQDYYGLTPLHFAAMRGNDLVSRELLSVRGIDIEATDKQQMTALHLAATHSCVEVSQILIEAGANLRCIDDELSTPLHLAAEEGNIKIVRMLFEAGQKKDGWVTLSQMVTDQNVEKSTALHLAVNNSHYEVAKLILEKGGDANATANNFSTPLHLASVGGDVRVVQLLLDSNARVDALNHNQETPLHKAAENDHSEVVELLLKSNADIEKRDKDNFTPLLLAACWGNPEVVKVLLRYNADPSAVDKNDKTAIFWAAEDNHVSCLQVLLGNPKVSKLIDEADRYGNTPLHIAAQLGHINCVKLLMEYNAMMDDKNEDEQTPLHLAAMHGRTLVVRELVNRQK-TIVNDEDEESNTALHLAALAGHQKVMDVLLDLGADVEARNAKGWTALDCAAYMGKVKAAKTLLEADSPIDPLDRNKVTPLHLAAKGGHTELVELLIKMGANVAQR---DHD----GLNCLDMAIDCNHENVAMAIVKTDKWEEAMKNQIADVTKGLVRDTPLRKLIRKMPDVAEKVFNNCMKPNMTNLEHKDCEITFNYEYLDDMYADWG---------EKGTSDAGSSSGSI---------YDEDTHIIKPDVRPYSKDSRILKKNHPLQIMVSSKREDLLSHPLVSSLLKHKWHKFGAAFYYINLIFYCVFLTFLTGYMLVHEPPYMLVNYTAWNGTDIYTVS-CQELASFGLHQPVQYPIAFLLFGTIGKWIVLALAVLTLVRELFQICYSKLNYLNVENFIEWLIYVPAILLVIDWDSCQMSNPQIRHPWQWNVGAIALFLAWIELLLFIRKLPRFGIYVVMFTDILWTFCQFFLVFVLFIVAFGLTFHVLLKNQAPFSSPARSLLKTAVMMIGEFEFDTQYTT---EITPEGQNMHSDQVYYEGVTYAIFILFLVLMSILIMNLLVGLAVDDIKAVQDQAVLKRLAMQIDLALDVENQIPGFLRRRMVIKQEALKPNQQSWFTKDKSLTSASIAQAL--QPELDRMDYIEEQQELTRTDIWKLKGQVKALKSSTDRIETMMTALMKH 1209          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A3T1DFU1 (Transient receptor potential cation channel subfamily A member basal OS=Capitella teleta OX=283909 GN=CtTRPAbasal PE=2 SV=1)

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 490/1170 (41.88%), Postives = 710/1170 (60.68%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATE-EMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD---ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLK-GYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS------IYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKN 3768
            +H+ AR+G+ E +  L++      KK VN  D + +S LHYA+R+NH   VK+LV+   A+ N  +EE   P+HFAARY+R                   +L+  +V  +N + E E    +I E    T +N+VIL+LV  GAN N +D YGCTP+H+AAMRGNEVA ++L+  P I+++  D   MT LHLA +H+  EI +ML+ S  NL   +E    P H AC EG+I +  ML +  E QD    +S+M+   +    +PLHYAV+N   + AK+C+++GA VN       + LHLAA  G  ++V+LL+   A  +  +    TPLH AA  NH  VV++L+E+GA I+  D D+++PLL+AA  GH ETIK L+    ++   +K +K+A+Y A E     A + ++   + K LL + D   N PLHIA + G    V  L+DAGA  + KNEEE++ +HLAA+ G+T +V+  V R+K  +I DEDEDSNT LHLA+ +G+ KV++ LL  GAD  ARNC   + LD AA KG  K  +VLL+  A VD MDK K TPL+L+   GH  +V +LLK +A +  R +        G N LD AIDNG++  AL I+ S KW+ ALRN+T  +  G  DTPMRKLIRKMPDVAE+VF +C  +NS +PD   Y IT+ +EFL+D YA W          +E D  D   S+    D++    +DE+ KL   A+ Y+ D  ++ +NHPLM+MV+  +EDLL H +VS+LL  KW +F   VYY NL IY  +L  L  Y+     P+ Y   +     NGS   +V +          A+I KY I+V+  + ++ E  Q+   +  YFS EN++E V Y+ A + VID  TCQ+  G+R+PWQWQ  AV+ F++ ++LVLFIRK P FGI+VVMFTD+  TF++F P+FFLFI AFA AF++LL NQ  F S+L S+++T+VM IGE+E+  +F             +FY  +T  +F  F++ M+II MNLLVGLAVDDIKAVQEKA L+R+ MQV LAL+VE +VP+F+RR+++ + L V PN  S+        K++F +          + +LD+ME L+ +Q+   + +  M+ +++N+ + N  ++ ML+ ++K+
Sbjct:   60 LHQCARDGNGENMRRLLQSLTGNVKKKVNARDDETLSALHYASRYNHHHIVKLLVQYG-ADANQEDEEGAAPLHFAARYKR------------------MRLHTQEVPLVNISGEGEDLGPVIPES---TIDNSVILFLVHVGANINARDKYGCTPLHFAAMRGNEVATKELLSCPGINVEAVDKTQMTSLHLAASHDEEEICRMLIESGANLRCSDEDEATPLHYACAEGSIGITQMLFEAGEKQDGWVTVSQMVTDQDNQQNSPLHYAVENRSYEVAKICIDRGADVNTSRSNYTTPLHLAATAGDCKIVELLLDHNARIDALDINQSTPLHKAAAYNHADVVEFLLERGAKIDKFDKDNFSPLLLAACNGHAETIKTLLDKGANLYAVDKNDKTAVYWASEEDKLKALQVLLEHPDCKDLLDMSDRYDNTPLHIAAQKGYINCVNALLDAGADIEFKNEEEKSAIHLAAEAGKTNVVREFVNRNKM-VINDEDEDSNTALHLASLAGHNKVVEALLQAGADVEARNCTLWTPLDCAAAKGWEKTVRVLLEADAPVDPMDKTKTTPLHLSSSRGHAGVVEILLKWHASVVQRDS-------EGRNCLDLAIDNGNKDVALCIVGSVKWKDALRNETLDVSTGNRDTPMRKLIRKMPDVAEKVFHRCSQANSHNPDSAAYEITFYYEFLDDMYAQW----------REQDGTDALSSSG---DSI----FDEDNKLTDNAKPYSADSTVLKQNHPLMIMVKNEQEDLLVHPLVSSLLMHKWRSFARWVYYFNLLIYCTFLTFLTGYICSTNAPFEY---DPLAAANGSTFCEVVENAQSVNQSTFAKIAKYFIIVLAGLKILSELFQIYNAKWQYFSWENLIEWVTYISALLLVIDFETCQSRTGIRQPWQWQLAAVAIFLAWIDLVLFIRKFPRFGIYVVMFTDICYTFMQFFPVFFLFIVAFALAFFVLLKNQNEFRSVLWSMLKTSVMMIGEMEYTGVFQ---------ENSMFYSELTIILFIFFMIFMNIIIMNLLVGLAVDDIKAVQEKAVLKRLAMQVELALDVESIVPQFLRRKFVRKSLNVKPNDNSNNRMKHFFQKSMF-MSSSTDLNKALNPELDEMEVLQENQEKMLKNINSMRIRMKNMETSNAQLSNMLSALLKH 1169          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3J6I3 (transient receptor potential cation channel subfamily A member 1 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106170600 PE=3 SV=1)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 486/1225 (39.67%), Postives = 734/1225 (59.92%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESG--TKLNLADVGTLNSATEE---------------------------------------MQKRLIEEEKTPT----KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD---ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSL-KGYV-DTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLC-PTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYL---YFIRNKTVGLNGSICAQVKQILVKERLKHS------AEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQ-TEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNR-----LIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKN 3768
            +H+ AR+G+ ++L  L+       KK +N  D +K+SPLHYAAR+NH E V+ILVE   A+VN   E+ +TP+HFAAR++R  R    +  +  +  S   T  + A V T  S  EE                                         K+++ EE T         +V+ YLV +GA  N QD YG TP+H+AAMRGN++ + +L+ +  IDI+  D + MT LHLA  H+  E++++L+ +  NL   ++    P H+A  EGNIK+V ML +  + +D    LS+M+   N +  T LH AV N H + AK+ LEKG   NA      + LHLA+  G + +V+LL+   A  +  N   +TPLH AAE +H +VV+ L++  ADIE RD D++TPLL+AA +G+ E +K+L++ + D +  +K +K+A++ A E ++    + ++ +    KL+   D  GN PLHIA + G+   V++L++  A+ D KNE+E+TP+HLAA  GRT +V+ LV R K +++ DEDE+SNT LHLAA +G+ KV+ +LL+ GAD  ARN    +ALD AA  G +KAA+ LL+  + +D +D+ K+TPL+LA K GH  LV LL+K  A+++ R   D +    G N LD AID  H   A+AI+K+DKWE A++NQ   + KG V DTP+RKLIRKMPDVAE+VF  C   N  + +H D  IT+N+E+L+D YA WG         ++   D  S S S+         YDE+  +  P  R Y++D +++ KNHPL +MV  +REDLL H +VS+LL+ KW+ FG   YY NL  Y  +L  L  YM+  EPPY+   Y   N T     S C ++    + + +++         I K+I++ + V+ LV+E  Q+C ++ NY ++EN +E ++YV A + VID  +CQ +   +R PWQW  GA++ F++ + L+LFIRK+P FGI+VVMFTD+L TF +F  +F LFI AF   F++LL NQ  F+S   S+++T VM IGE EFD+ + T   E  P+ +      ++Y+ VTY IF +FL++MSI+ MNLLVGLAVDDIKAVQ++A L+R+ MQ+ LAL+VE  +P F+RRR +I++  + PN++S   K        + + +    +LD M+ ++  Q+ T   + ++K +++ L S    +  M+T ++K+
Sbjct:   52 LHQCARDGNPDKLRRLLDY-LGNVKKKINAHDENKLSPLHYAARYNHFEAVRILVERG-ADVNNKGEDDLTPLHFAARFKRMKRIKSTDSLDEVEGSSAPLTPSSEATVETAVSNEEEGADGENVPNGATPYISIVNVRADEEEMDEAPEEKQVEPPKPKKIVREEVTSDDELDNQPSVVKYLVERGAKVNAQDYYGLTPLHFAAMRGNDLVSRELLSVRGIDIEATDKQQMTALHLAATHSCVEVSQILIEAGANLRCIDDELSTPLHLAAEEGNIKIVRMLFEAGQKKDGWVTLSQMVTDQNVEKSTALHLAVNNSHYEVAKLILEKGGDANATANNFSTPLHLASVGGDVRVVQLLLDSNARVDALNHNQETPLHKAAENDHSEVVELLLKSNADIEKRDKDNFTPLLLAACWGNPEVVKVLLRYNADPSAVDKNDKTAIFWAAEDNHVSCLQVLLGNPKVSKLIDEADRYGNTPLHIAAQLGHINCVKLLMEYNAMMDDKNEDEQTPLHLAAMHGRTLVVRELVNRQK-TIVNDEDEESNTALHLAALAGHQKVMDVLLDLGADVEARNAKGWTALDCAAYMGKVKAAKTLLEADSPIDPLDRNKVTPLHLAAKGGHTELVELLIKMGANVAQR---DHD----GLNCLDMAIDCNHENVAMAIVKTDKWEEAMKNQIADVTKGLVRDTPLRKLIRKMPDVAEKVFNNCMKPNMTNLEHKDCEITFNYEYLDDMYADWG---------EKGTSDAGSSSGSI---------YDEDTHIIKPDVRPYSKDSRILKKNHPLQIMVSSKREDLLSHPLVSSLLKHKWHKFGAAFYYINLIFYCVFLTFLTGYMLVHEPPYMLVNYTAWNGTDIYTVS-CQELASFGLHQPVQYPIAFLLFGTIGKWIVLALAVLTLVRELFQICYSKLNYLNVENFIEWLIYVPAILLVIDWDSCQMSNPQIRHPWQWNVGAIALFLAWIELLLFIRKLPRFGIYVVMFTDILWTFCQFFLVFVLFIVAFGLTFHVLLKNQAPFSSPARSLLKTAVMMIGEFEFDTQYTT---EITPEGQNMHSDQVYYEGVTYAIFILFLVLMSILIMNLLVGLAVDDIKAVQDQAVLKRLAMQIDLALDVENQIPGFLRRRMVIKQEALKPNQQSWFTKDKSLTSASIAQAL--QPELDRMDYIEEQQELTRTDIWKLKGQVKALKSSTDRIETMMTALMKH 1242          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A3S1HED0 (ANK_REP_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_014619 PE=3 SV=1)

HSP 1 Score: 798.89 bits (2062), Expect = 0.000e+0
Identity = 477/1169 (40.80%), Postives = 705/1169 (60.31%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEI-DIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLI----KKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQ-TKSLKGYVDTPMRKLIRKMPDVAEEVFKKC-KVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE-----SSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIV 3762
            +H+ AR+GD   +  L++      +K VN  D D ++PLHYAAR+NHL  VK+LV+ A ANV +  ++ VTP+H AARYRR+ ++ + +      ++        D+G  N     + +   EE        +++ YLV + AN N  D YG TP+HYAAMRGNEVA   L+    I +I + DN+ +TPLH A  HN  EIA+ML+    ++   ++    P H AC EGN+ MV +L     +  E   ++++M+ A + ++ TPLH+AV+N H D AK+ LEKGA VN         LHLAA  G + + +LLV  +A  +  N    T LH AA  N V+ +++L+EKGA I  RDID+YTPLL+AA+YG+ + ++LL++   D +  +K +K+A++LA E +     K ++S    K+L++  D   N PLHIA + G   IVQ L++ GA  D KNEEE TP+HLAAK GRT IV+ L+ ++  +++ DEDE+SNT LHLAA+ G+ KV++LLL+ GAD +ARN N  + LD AA+KG  +   VLL+  A VD  DK K TPL+LA   GH ++V LLL+ +AD++++  G       G N L  AI+N H   A  I+ SD W+ ALRN       G++ TPMRKLIR+MP+VA +VF +C      K+P+ +D+ IT+++EFLED YA W + H ++    E   D  S + S    T S E  D++ +L P A+ Y+ D  ++ KNHPL +M++  RE LL H +V++LL+ KWN  G   YY + AIY+ +L  L  YMI  +PP+ Y   N +  +  + C+ +            A+   Y+I+ +  + L KE  QL   + NY    N++E ++YV A + VI  + CQ   G R  WQW  GA++ F++ ++LVLFI+K P FGI+VVMFTD+L TF +F  +FFLF+ AFA +FY L  NQ  F+++  S I+T+VM IGE EFD+IFN    +       + Y   +Y IF IFL++MSI+ MNLLVGLAVDDIKAVQE+A L+RM MQV LAL+VE ++P+F+RRR   R+ T+ PNR        ++   +     +++ +  D   D++E++K  Q     Q+ ++K  ++++   N  +  +L  IV
Sbjct:  197 LHQCARDGDEYNMKILLQNLDSHVRKKVNQYDEDDLTPLHYAARYNHLSVVKLLVQ-AGANVQMTGDDNVTPLHHAARYRREKKRKEISPDLEALDD--------DLGA-NGLMSLLDQGDAEE--------SIVSYLVKQNANINAVDMYGQTPLHYAAMRGNEVACRDLLNFKNIINISIGDNQGITPLHCAALHNQVEIARMLIEGGADVMCTDKERSTPLHHACMEGNVDMVQLLFDAGARSKESWVKVNEMVAAQDFEFSTPLHHAVENSHYDVAKILLEKGAVVNQDRKNFVYPLHLAAQSGDVRICRLLVEHQARIDAVNSDHATALHRAAALNKVEALRFLVEKGAAINRRDIDNYTPLLLAATYGNTDAVELLLQKGADFHAQDKHDKTAIFLAAEENKIQVLKKLLSKPRVKQLINESDCYDNSPLHIAAKQGYLDIVQCLLENGADLDDKNEEEETPLHLAAKHGRTNIVRELI-KTDTTIVNDEDENSNTALHLAAQCGHYKVVKLLLDLGADVSARNYNAWTPLDLAASKGWTRTCSVLLEEDAPVDPTDKNKTTPLHLASSFGHSKVVKLLLEWDADVTLKDDG-------GRNCLGRAIENHHVNVAEVIIYSDVWKDALRNAYVNPNTGFIVTPMRKLIRRMPEVALKVFDRCLSYGQEKNPESMDFEITFDYEFLEDVYARW-ITHNIQRQVTETGSDYTSSTGS----TFSGE--DDDVELSPNAQPYSSDSNVLKKNHPLFLMIQNEREALLGHPLVTSLLQHKWNALGSFFYYFSFAIYMVFLTFLTGYMISTDPPHTY--GNDSSRIEDNECSGLPY-----SQPSFAKAGTYVIIALAGLNLFKEMIQLYQAKLNYLGWTNLIEWIVYVTALLLVISFNECQRTTGYRYEWQWHLGAIAVFLAWIDLVLFIQKFPRFGIYVVMFTDILFTFSQFFVVFFLFVIAFAVSFYALFQNQNPFDTVPKSFIKTSVMMIGEFEFDTIFNDSTND-------VKYPTASYIIFVIFLVIMSILLMNLLVGLAVDDIKAVQEQAALKRMAMQVELALDVERIIPDFLRRRAFCRRKTIRPNRLFANPIQRMFTNSYLSPSALQKALNPDK--DEVEKVKESQDKIVTQVKKLKASMQDIREHNQKLESLLKAIV 1316          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 361.688 bits (927), Expect = 8.893e-106
Identity = 320/1181 (27.10%), Postives = 561/1181 (47.50%), Query Frame = 1
Query:  268 TNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKL-LVSFEAN---FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLL-QNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRN-QTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRN--KTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR--ESSIYKTLFGIGREVRRQMCKDD-QLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            +N  S D + ++A EG+    +  ++++P++    + + D    SPLHYAA   HL  +K++V+ A    +NV +EE  TP+H+A +            K+ R + S                                       L+S GA+PNI +    +P+H A    +    EQL+   + ++ L+ +   TP+ LA + ++ E   +L  +   L  Q + G  P H A   G  K ++++++K ++    +   +  V++   +PLH AV+ G+ D  ++C+  GA +N       +ALH A  QG+ E VKL L++++      N+T+   QTPLH A   +H ++ +YLI +GADI+  D   ++PLL+A S G   T+ LL+ +  ++ V +K   + L+LA+       +    ++  E+ ++LL+  D +G  PLH ACR G    V+ ++      D K++++++ +H AA++GR      L+E    + +++E DE   TPLHLA++ G+ KV++LLL  GA  ++ +    S L  AA +G  +  + LL  N   +D +D    T L+LA + GH   V  LL   A   +   GDA+        L  A+ NG ++   A++ SD+ E A+   +  S K  +   M   I  +P+  + +   C   +    +   Y I YNF++L+ +      NH ++N                       +  +E++   P A L                MV   R +LL H +    L MKW  +G+  +  N+ +Y   +L           P  Y I N    + +N ++          ++  +    C ++++ M    + KE  Q+   R  Y   + N+M+    + + + VI +      + V   W WQ GA++  +S +NL+L++++   FGI+VVMF ++  T +  + LF   I AFA AFY L+  Q  F  +  S++QT VM +GE+ +   F       P  +  + + ++TY IF  F+L++ I+ MNLL+GLAV DI  VQ  A L+++GMQ+ L   +E  +P +  +R     +  +PN+      +    G  R+VR ++C    Q   MER    QK   +++TE      ++  Q+HL+  ++ K+
Sbjct:   12 SNQMSTD-VFEWALEGN----TMALEKHPKQ----LAVRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQ------------KDQRGSCSA--------------------------------------LLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLSHGAELKVRDKAGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHS-DYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLN-KGDASF-------LHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDM---IEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHT------NHRIQNT----------------------DNIEEDDDYKPLAALNA--------------MVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYTLGVL-----------PLTYLIVNLRPKLTVNKNVTTVTMVTTSIDKQCYFITSCMFLVLAMNTYAVGKEIVQMFQQRLKYLRDMSNLMDWSSTICSLLFVIPLL-----LNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLK-----PYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLPYWFVKRVDQVSVREFPNKCYNGKRWVCCGGEVRKVRPRLCPTPRQSTPMERELAKQKHRLKEMTE------SIEKQHHLLKLIVQKM 1052          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 353.214 bits (905), Expect = 3.476e-103
Identity = 298/1106 (26.94%), Postives = 527/1106 (47.65%), Query Frame = 1
Query:  280 SIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLL-QNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRE 3564
            ++ N+ +++ +G++  L FL ++NP   K      D     P+H+AA   +L  ++++V       +N  ++   TP+H+A                  +N+ G+                                     L+  GA+PNI       P+H A    +    + L+     D+ L+ +   TP  +AC++N+ +  ++L   +  L  Q + G    H     G  + ++++++K E+     S  +  +++   +PLH AV+ G+ +  K+C+ KGA V+       +ALH A  QG+ E VK+++      E   N+ +   QTPLH A   +HV++ +YL+ KGADI+  D    +PLL+A +    +T+  L+    D  V +K  ++ L+L +       +  + ++  +  ++L+   D++G  PLH AC+ G    V+ ++        K++++++ +H AA++GR      L+E    S +++E E++  TPLHLA++ G+ KV++LLL  GA   + +    S L  AA +G  +   +LL  N   +D  ++   T L+LA + GH   V LLL   A   +           G + L  A+ NG ++ A A +++++   AL +  K   G+    +  LI  +P+  + +   C V +   P++I+Y ITYNF++L+                           A ++L   +    D++    P A               L  MV+  R +LL H +    L MKW  +G  V+  NLA+YL  LL L   +I  +P     +   TV +  S+  + +  ++         +C  +++VM V  + KE  QL   R  YF    N+ +    + + V VI +        V   W W+ GA++   + +N +L+ ++   FGI+VVMF +++ T I  + LF   + AF  +FY L+ ++V FNS+  S+ QT VMT+GEL +    NT  E Y    +L F + ++Y IF +F+L+M I+ MNL++GLAV DI  VQ  ATL+R+ MQ+ L   +E  +P +  +R     +T+YPN++
Sbjct:   19 AMANVFEWSCKGNISSLEFLSQKNPELLKS----RDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVE----------------KNQEGS----------------------------------CSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNK--------NGASFLHEAVRNGKKEVANAAIENERSSEAL-SLFKKGPGF-RCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQ---------------------------APILLKKYA--KTDKSMNFQPLA--------------ALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTM-ASVSFRTQSYMI--------SVCIVMVLVMNVYAICKELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLF-----FSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQ---NTLLEAY-EQGQLAFPE-ISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKPSITIYPNKK 997          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 353.599 bits (906), Expect = 7.836e-103
Identity = 310/1164 (26.63%), Postives = 551/1164 (47.34%), Query Frame = 1
Query:  280 SIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLL-QNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTL------FGIGREVRRQMCKDDQLD-DMERLKLHQKATTEQLTEMKFKLRNL 3717
            ++ N+ +++ +G++  L FL ++NP   K      D     P+H+AA   +L  ++++V       +N  ++   TP+H+A                  +N+ G+                                     L+  GA+PNI       P+H A    +    + L+     D+ L+ +   TP  +AC++N+ +  ++L   +  L  Q + G    H     G  + ++++++K E+     S  +  +++   +PLH AV+ G+ +  K+C+ KGA V+       +ALH A  QG+ E VK+++      E   N+ +   QTPLH A   +HV++ +YL+ KGADI+  D    +PLL+A +    +T+  L+    D  V +K  ++ L+L +       +  + ++  +  ++L+   D++G  PLH AC+ G    V+ ++        K++++++ +H AA++GR      L+E    S +++E E++  TPLHLA++ G+ KV++LLL  GA   + +    S L  AA +G  +   +LL  N   +D  ++   T L+LA + GH   V LLL   A   +           G + L  A+ NG ++ A A +++++   AL +  K   G+    +  LI  +P+  + +   C V +   P++I+Y ITYNF++L+                           A ++L   +    D++    P A               L  MV+  R +LL H +    L MKW  +G  V+  NLA+YL  LL L   +I  +P     +   TV +  S+  + +  ++         +C  +++VM V  + KE  QL   R  YF    N+ +    + + V VI +        V   W W+ GA++   + +N +L+ ++   FGI+VVMF +++ T I  + LF   + AF  +FY L+ ++V FNS+  S+ QT VMT+GEL +    NT  E Y    +L F + ++Y IF +F+L+M I+ MNL++GLAV DI  VQ  ATL+R+ MQ+ L   +E  +P +  +R     +T+YPN++      +      FG   EVR ++  + +    +ER  + QK   ++++ +  K  NL
Sbjct:   19 AMANVFEWSCKGNISSLEFLSQKNPELLKS----RDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVE----------------KNQEGS----------------------------------CSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNK--------NGASFLHEAVRNGKKEVANAAIENERSSEAL-SLFKKGPGF-RCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQ---------------------------APILLKKYA--KTDKSMNFQPLA--------------ALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTM-ASVSFRTQSYMI--------SVCIVMVLVMNVYAICKELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLF-----FSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQ---NTLLEAY-EQGQLAFPE-ISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKPSITIYPNKKCEKVLGMIQQFWNFGEETEVRVRLNTNARKSCPLEREIMKQKYRLKEISSVLEKQHNL 1055          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 353.599 bits (906), Expect = 7.836e-103
Identity = 310/1164 (26.63%), Postives = 551/1164 (47.34%), Query Frame = 1
Query:  280 SIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLL-QNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTL------FGIGREVRRQMCKDDQLD-DMERLKLHQKATTEQLTEMKFKLRNL 3717
            ++ N+ +++ +G++  L FL ++NP   K      D     P+H+AA   +L  ++++V       +N  ++   TP+H+A                  +N+ G+                                     L+  GA+PNI       P+H A    +    + L+     D+ L+ +   TP  +AC++N+ +  ++L   +  L  Q + G    H     G  + ++++++K E+     S  +  +++   +PLH AV+ G+ +  K+C+ KGA V+       +ALH A  QG+ E VK+++      E   N+ +   QTPLH A   +HV++ +YL+ KGADI+  D    +PLL+A +    +T+  L+    D  V +K  ++ L+L +       +  + ++  +  ++L+   D++G  PLH AC+ G    V+ ++        K++++++ +H AA++GR      L+E    S +++E E++  TPLHLA++ G+ KV++LLL  GA   + +    S L  AA +G  +   +LL  N   +D  ++   T L+LA + GH   V LLL   A   +           G + L  A+ NG ++ A A +++++   AL +  K   G+    +  LI  +P+  + +   C V +   P++I+Y ITYNF++L+                           A ++L   +    D++    P A               L  MV+  R +LL H +    L MKW  +G  V+  NLA+YL  LL L   +I  +P     +   TV +  S+  + +  ++         +C  +++VM V  + KE  QL   R  YF    N+ +    + + V VI +        V   W W+ GA++   + +N +L+ ++   FGI+VVMF +++ T I  + LF   + AF  +FY L+ ++V FNS+  S+ QT VMT+GEL +    NT  E Y    +L F + ++Y IF +F+L+M I+ MNL++GLAV DI  VQ  ATL+R+ MQ+ L   +E  +P +  +R     +T+YPN++      +      FG   EVR ++  + +    +ER  + QK   ++++ +  K  NL
Sbjct:   19 AMANVFEWSCKGNISSLEFLSQKNPELLKS----RDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVE----------------KNQEGS----------------------------------CSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEIINIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLVIFQPKGLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQS-DYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNK--------NGASFLHEAVRNGKKEVANAAIENERSSEAL-SLFKKGPGF-RCVVLDLIEFLPESTKHLLDLCMVESEHDPNNINYHITYNFKWLQ---------------------------APILLKKYA--KTDKSMNFQPLA--------------ALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTM-ASVSFRTQSYMI--------SVCIVMVLVMNVYAICKELVQLAQQRLIYFMDSTNVSDWASAISSLVFVIPLF-----FSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYALMLHRVEFNSISLSLAQTFVMTVGELNYQ---NTLLEAY-EQGQLAFPE-ISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKPSITIYPNKKCEKVLGMIQQFWNFGEETEVRVRLNTNARKSCPLEREIMKQKYRLKEISSVLEKQHNL 1055          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 343.199 bits (879), Expect = 1.959e-99
Identity = 316/1178 (26.83%), Postives = 552/1178 (46.86%), Query Frame = 1
Query:  268 TNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-ELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKL-LVSFEAN---FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV--EHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLL-QNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRN-QTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR--ESSIYKTLFGIGREVRRQMCKDD-QLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKI 3759
            +N  S D + ++A EG+    +  ++++P++    + + D    SPLHYAA   HL  +K++V+ A    +NV +EE  TP+H+A +            K+ R + S                                       L+S GA+PNI +    +P+H A    +    EQL+   + ++ L+ +   TP+ LA + ++ E   +L  +   L  Q + G  P H A   G  K ++++++K ++    +   +  V++   +PLH AV+ G+ D  ++C+  GA +N       +ALH A  QG+ E VKL L++++      N+T+   QTPLH A   +H ++ +YLI +GADI+  D   ++PLL+A S G   T+ LL+ +  ++ V +K   + L+LA+       +    ++  E+ ++LL+  D +G  PLH ACR G    V+ ++      D K++++++ +H AA++GR      L+E    + +++E DE   TPLHLA++ G+ KV++LLL  GA  ++ +    S L  AA +G  +  + LL  N   +D +D    T L+LA + GH   V  LL   A   +   GDA+        L  A+ NG ++   A++ SD+ E A+   +  S K  +   M   I  +P+  + +   C   +    +   Y I YNF++L+ +      NH ++N                       +  +E++   P A L                MV   R +LL H +    L MKW  +G+  +  N+ +Y   +L L   ++   P         TV  N +    +    + +RLK+  +                              + N+M+    + + + VI +      + V   W WQ GA++  +S +NL+L++++   FGI+VVMF ++  T +  + LF   I AFA AFY L+  Q  F  +  S++QT VM +GE+ +   F       P  +  + + ++TY IF  F+L++ I+ MNLL+GLAV DI  VQ  A L+++GMQ+ L   +E  +P +  +R     +  +PN+      +    G  R+VR ++C    Q   MER    QK   +++TE      ++  Q+HL+  ++ K+
Sbjct:   12 SNQMSTD-VFEWALEGN----TMALEKHPKQ----LAVRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQ------------KDQRGSCSA--------------------------------------LLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDIINITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLSHGAELKVRDKAGCNFLHLAILQPRGLKNLPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHS-DYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLN-KGDASF-------LHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDM---IEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHT------NHRIQNT----------------------DNIEEDDDYKPLAALNA--------------MVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYTLGVLPLTYLIVNLRPKL-------TVNKNVTT-VTMVTTSIDKRLKYLRD------------------------------MSNLMDWSSTICSLLFVIPLL-----LNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYALMVEQRHFGRMFLSLMQTFVMMVGEISYQDNFLK-----PYMSSQLPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLPYWFVKRVDQVSVREFPNKCYNGKRWVCCGGEVRKVRPRLCPTPRQSTPMERELAKQKHRLKEMTE------SIEKQHHLLKLIVQKM 1022          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.802 bits (595), Expect = 8.036e-64
Identity = 168/590 (28.47%), Postives = 292/590 (49.49%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARY--------------RRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAG 2070
            +N    +  +PL+ AA+ NHLE VK L++   AN +V  E+  TP+  A +               + K R    +    + + +   L L      +  ++ M  +  E   TP        N  V   L++ GA  +     G TP+H AA RGN    + L+ +  +ID K +D   +TPLH A    H ++ +MLL     +  + + G  P H+A    ++  V +L+ +    D+       V  DY TPLH A   GH   AK+ L++G   NA    G + LH+A  +  I++++LL+   A+ + T +   TP+H A+   H+ VVQ L++ GA   + ++   TPL +A+  G  E +K L+++   + V  + +++ L++A     ++  + ++   SD N       P   G+ PL+ A R+G+  +  +L++ GA      ++  TP+H+A+K+GR  +  +L+E+   +    + ++  TPLH+A    + KV  LLL+ GA  ++   N  + L  AA K  L+  +VLL+ GA+ + + +  + PL+LA + GH  +V LLL  +A IS+   G
Sbjct:  102 INAQSQNGFTPLYMAAQENHLEIVKFLLDNG-ANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD--GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDD-------VTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNA------PTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASA--DPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKG 673          

HSP 2 Score: 214.927 bits (546), Expect = 1.128e-57
Identity = 169/633 (26.70%), Postives = 298/633 (47.08%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPR---KAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM---KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-----SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            +H  AR+ D    + L++        +K  +N       +PLH AA + ++    +L+   +A V+      +TP+H AA+               R N +  KL L     +++ T +    L    ++   +  VI  L+ + A    +   G +P+H A  +G  +A  QL+   + P  D+ L   + +TPLH+A    H+ +AK+LL        +   G  P HIAC +  IK++++L+K           +        TP+H A   GH +  ++ L+ GAS NA    G + LH+A+  G +E+VK L+   A   V  +  QTPLH A+     ++VQ L+++G+D  +      TPL  A+  GH +   LL++N  DI+   K   + L++A ++   +    ++     +D  GK         G  PLH+A    ++K+  +L+D GA      +   TP+H+AAK  +  + K+L+E   ++ ++ +      PLHLAA+ G+  ++ LLL   A  +      L+A+  AA +  +  A++L ++ A V++  K   TPL++A   G+ ++V  LL++ A ++ +          G  PL  A   GH     A+L+
Sbjct:  175 LHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAA-VDFTARNGITPLHVAAK---------------RGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS--GHEKVIEMLLERDAPILAKTKNGLSPLHMAT-QGEHLACVQLLLGRQAPVDDVTL---DYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS-------IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKN--------GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQ--GVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTR-------NGYTPLHQAAQQGHTHVVNALLQ 761          

HSP 3 Score: 192.971 bits (489), Expect = 1.375e-50
Identity = 147/527 (27.89%), Postives = 250/527 (47.44%), Query Frame = 1
Query:  691 VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLL------------------------------------ISSNNLFDQ-EETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDP--LTGCNPLDAAIDNGHRQCALAIL 2154
            ++  LV  GAN N Q   G TP++ AA   N +   + +     +  +   +  TPL +A    H ++  +LL                                    ++S  + +Q  E+G  P HIA   GN+ +  +L+        L   +    R+  TPLH A K G+ +  K+ L++GA ++  T  G + LH AA  G  +++++L+  +A      K   +PLH A +  H+  VQ L+ + A ++   +D  TPL +AA  GH    KLL+    + N       + L++A + +     + ++  ++G   +H     G  P+H+A   G+  +VQ+L+  GA  +  N    TP+H+A++ G+  +VK L++ S   + +   ED  TPLH+A++ G  +++QLLL  G+D NA   +  + L FA+ +G+   A +LL+NGA +  + K   TPL++A K G   + TLLL+  A         + DP    G  PL  A    H++ AL +L
Sbjct:   91 IVRVLVEFGANINAQSQNGFTPLYMAAQE-NHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLN-------LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLL--KHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ-SGARVGVKARED-QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYA---------SADPKGKNGLTPLHVATHYDHQKVALLLL 595          

HSP 4 Score: 183.341 bits (464), Expect = 1.630e-47
Identity = 119/395 (30.13%), Postives = 199/395 (50.38%), Query Frame = 1
Query: 1057 NRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINV----------TEKGNKSALYLAVEHSYSDATKTII--SDENGKKLLHIPDFKGNF----------------------PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVER-------------------------------SKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
            N++    LH A K GH D     L++ A ++  T  G +ALH+AA  G  ++V++LV F AN N  ++   TPL+ AA++NH+++V++L++ GA+      D +TPL +A   GH + + LL+++     V           +  N +AL L  EH+    +K ++  + E+G   LHI    GN                       PLH+A + GN  +V++L+D GA  D K  +  TP+H AA+ G   ++++L+ER                                +Q+ + D   D  TPLH+AA  G+ +V +LLL+ G + NAR  N  + L  A  K  +K  ++LL++GA + +  ++ +TP+++A   GH  +V LLL++ A
Sbjct:   40 NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGA 434          

HSP 5 Score: 160.229 bits (404), Expect = 3.238e-40
Identity = 120/385 (31.17%), Postives = 181/385 (47.01%), Query Frame = 1
Query: 1063 DYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII-SDENGK---KLLHIPDFK------------------------------GNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            D  T    A +NG+ +     L+ G  +N     G +ALHLA+ +G +++V  L+  EA  +   K+  T LH AA      +V+ L+E GA+I ++  + +TPL +AA   H E +K L+ N  + +V  +   + L +A++  +      ++ SD  GK     LHI   K                              G  PLHIA   GN  +  +L++ GA  D       TP+H+AAK G   +VK+L++R  +  I  +  D  TPLH AA+SG+ KVI++LL   A   A+  N LS L  A    +L   Q+LL   A VD +    +TPL++A   GH R+  LLL    + + R        L G  PL  A
Sbjct:    9 DAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK--IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-------LNGFTPLHIA 384          

HSP 6 Score: 148.288 bits (373), Expect = 1.976e-36
Identity = 112/415 (26.99%), Postives = 190/415 (45.78%), Query Frame = 1
Query:  397 MSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSR----QNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQIL 1629
            ++P+H A+   HL  V++L++   A+ N  N    TP+H A+R  +           +R      E  T L++A              RL + E        ++  L+ +G++PN     G TP+++A+  G+   A  L++    DI     +  TPLH+A  +   E+A +LL    +   + + G  P H+A    + K+  +L+ K       +K       +  TPLH A K    +  KV LE GA  N +T  G + LHLAA +G  +MV LL+   A+ ++  K   T +H AA+++ V V + L +  AD+ +     YTPL +A+ YG+ + +  L++N   +N   +   + L+ A +  ++     ++  E     L      GN  L IA R G   +V  L
Sbjct:  411 LTPIHVASFMGHLNVVQLLLQNG-ASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIAS-------------RLGKAE--------IVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLE-NGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAK-------NGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNEL---TANGNTALAIARRLGYISVVDTL 792          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.794 bits (582), Expect = 1.694e-62
Identity = 182/655 (27.79%), Postives = 313/655 (47.79%), Query Frame = 1
Query:  259 ISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPR--KAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR---KARKIDFNHKNSRQNESG-TKLNLA-------DVGTLNSATEEMQKRL----IEEEKTPTKNNAVIL------------------------------YLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAG 2070
            I+  N   ++ +H  ++EG V+ ++ L+K+      A K  N       + LH AA     + V++LVE   AN+N  ++   TP++ AA+          +D     S   E G T L +A        VG L  +  + + RL    I   K  T   A++L                               L++ GA  +     G TP+H AA RGN    + L+ +  +ID K +D   +TPLH A    H ++ +MLL     +  + + G  P H+A    ++  V +L+ +    D+       V  DY TPLH A   GH   AK+ L++G   NA    G + LH+A  +  I++++LL+   A+ + T +   TP+H A+   H+ VVQ L++ GA   + ++   TPL +A+  G  E +K L+++   + V  + +++ L++A     ++  + ++   SD N       P   G+ PL+ A R+G+  +  +L++ GA      ++  TP+H+A+K+GR  +  +L+E+   +      ++  TPLH+A    + KV  LLL+ GA  ++   N  + L  AA K  L+  +VLL+ GA+ + + +  + PL+LA + GH  +V LLL  +A IS+   G
Sbjct:   37 INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGN-------TALHIAALAGQTDIVRVLVE-FGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD--GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDD-------VTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNA------PTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKG 668          

HSP 2 Score: 212.231 bits (539), Expect = 5.059e-57
Identity = 165/627 (26.32%), Postives = 298/627 (47.53%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM---KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSD 2163
            +H  AR+ D    + L++      +   ++      +PLH AA + ++    +L+   +A V+      +TP+H AA+               R N +  KL L     +++ T +    L    ++   +  VI  L+ + A    +   G +P+H A  +G  +A  QL+   + P  D+ L   + +TPLH+A    H+ +AK+LL        +   G  P HIAC +  IK++++L+K           +        TP+H A   GH +  ++ L+ GAS NA    G + LH+A+  G +E+VK L+   A   V  +  QTPLH A+     ++VQ L+++G+D  +      TPL  A+  GH +   LL++N  DI+   K   + L++A ++   +   T++ ++       +    G  PLH+A    ++K+  +L+D GA      +   TP+H+AAK  +  + K+L+E   ++ ++ +      PLHLAA+ G+  ++ LLL   A  +      L+A+  AA +  +  A++L ++ A V++  K   TPL++A   G+ ++V  LL++ A ++ +          G  PL  A   GH     A+L+ +
Sbjct:  176 LHIAARKDDTNAAALLLQH-----EHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAA-VDFTARNGITPLHVAAK---------------RGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS--GHEKVIEMLLERDAPILAKTKNGLSPLHMAT-QGEHLACVQLLLGRQAPVDDVTL---DYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS-------IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLE-VATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQ--GVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTR-------NGYTPLHQAAQQGHTHVVNALLQHE 758          

HSP 3 Score: 199.519 bits (506), Expect = 6.822e-53
Identity = 149/517 (28.82%), Postives = 248/517 (47.97%), Query Frame = 1
Query:  691 VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNN---------------------LFDQEE--------TGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAIL 2154
            ++  LV  GAN N Q   G TP++ AA   N +   + +     +  +   +  TPL +A    H ++  +LL S                        L  Q E        +G  P HIA   GN+ +  +L+        L   +    R+  TPLH A K G+ +  K+ L++GA ++  T  G + LH AA  G  +++++L+  +A      K   +PLH A +  H+  VQ L+ + A ++   +D  TPL +AA  GH    KLL+    + N       + L++A + +     + ++  ++G   +H     G  P+H+A   G+  +VQ+L+  GA  +  N    TP+H+A++ G+  +VK L++ S   + +   ED  TPLH+A++ G  +++QLLL  G+D NA   +  + L FA+ +G+   A +LL+NGA +  + K   TPL++A K G   + TLLL+  A    +VAG       G  PL  A    H++ AL +L
Sbjct:   92 IVRVLVEFGANINAQSQNGFTPLYMAAQE-NHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLN-------LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLL--KHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ-SGARVGVKARED-QTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQ-----NGLTPLHVATHYDHQKVALLLL 590          

HSP 4 Score: 181.415 bits (459), Expect = 4.459e-47
Identity = 119/353 (33.71%), Postives = 186/353 (52.69%), Query Frame = 1
Query: 1057 NRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            N++    LH A K GH D     L++ A ++  T  G +ALH+AA  G  ++V++LV F AN N  ++   TPL+ AA++NH+++V++L++ GA+      D +TPL +A   GH + + LL+++    +   K    AL++A     ++A   ++  E+      +    G  PLHIA   GN  +  +L++ GA  D       TP+H+AAK G   +VK+L++R  +  I  +  D  TPLH AA+SG+ KVI++LL   A   A+  N LS L  A    +L   Q+LL   A VD +    +TPL++A   GH R+  LLL    + + R        L G  PL  A
Sbjct:   41 NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNAD---VTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK--IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARA-------LNGFTPLHIA 377          

HSP 5 Score: 145.976 bits (367), Expect = 8.186e-36
Identity = 113/417 (27.10%), Postives = 191/417 (45.80%), Query Frame = 1
Query:  397 MSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSR----QNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLL--ISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQIL 1629
            ++P+H A+   HL  V++L++   A+ N  N    TP+H A+R  +           +R      E  T L++A              RL + E        ++  L+ +G++PN     G TP+++A+  G+   A  L++    DI     +  TPLH+A  +   E+A +LL   +S +     + G  P H+A    + K+  +L+ K       +K       +  TPLH A K    +  KV LE GA  N +T  G + LHLAA +G  +MV LL+   A+ ++  K   T +H AA+++ V V + L +  AD+ +     YTPL +A+ YG+ + +  L++N   +N   +   + L+ A +  ++     ++  E     L      GN  L IA R G   +V  L
Sbjct:  404 LTPIHVASFMGHLNVVQLLLQNG-ASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIAS-------------RLGKAE--------IVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLE-NGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAK-------NGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNEL---TANGNTALAIARRLGYISVVDTL 787          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.149 bits (531), Expect = 2.794e-55
Identity = 177/608 (29.11%), Postives = 278/608 (45.72%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLP-EIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKS------EDQDELSKMLQAVNRDY------------------------KTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIE----KGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNK-SALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVI---QLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLAC 1998
            +H  A  G+VE L+ L+       KK     D  + + LHYAA   +++CV  LV  + A +N  +E R TP+H+AA        + F+  N+   +S                       I+   T ++    + +L+ K A+P IQD  G TP+HYAA  G+ V  E L++ P       K    ++PLHLA  H H    ++L+ S  +L  +E  G  P  +A   G+   V +LI+        E  D  + +  A    +                        +TP+  AV NGH D A + L KGAS+NA    G +ALH  A  G  E V LL+    + ++  +  + PLH AA   H+ ++  L++     GA I   D + YTPL  A   GH   ++LL++   D+   ++GN  S L+ AV +      + +I D  G K+++ PD KG  PLH A    + + +Q+L+   A+ +V +   ++P+ +A + G+   V++LV  +K  L + +D + NT LHLA    +          L+     NA N    + L  AA  G     QVLL  GA + ++D    TP  L+C
Sbjct:  425 LHAAASGGNVECLNLLLSTGADMNKK-----DRFERTALHYAAANCNVQCVVTLVA-SGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQS----------------------YIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE--LDVFQKQEGNAFSPLHCAVLNDNESCAEMLI-DTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKL-QDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTP-ALSC 999          

HSP 2 Score: 177.178 bits (448), Expect = 3.406e-45
Identity = 176/713 (24.68%), Postives = 298/713 (41.80%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKA-------RKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTY------------------TGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPL-LIAASYGHCETIKLLMKNHCDIN--VTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLH-------------IPDFKGNF-----------PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKN----ARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMR---------------------------VAGDANDPLT---GCNPLDAAIDNGHRQCALAILKSDKWE 2172
            +H  A  G  E ++FL+ +        +N  D      +H+AA   H E VK+LV    A+V   +++  +P+H A+   +           +D +  NS  N +           L+ A    Q  ++ E             L+  GAN N  +  G TP+H+AA   +     +L+     D+ ++  +  +PLH+   H  F  ++ L+ +   +  ++  G  P HIA   G+  +++ LI    D  +     + ++  +  PLH A  +G  D  +  L  G   + V+                    GR+ LH AA  G++E + LL+S  A+ N  ++  +T LH AA   +V+ V  L+  GA +  +D    TPL   AA+ G   T+   + N   +   +      S   + +EH         I D+ G   +H             + +  G F           PLH+A   G+   +++LI +    DV+     TP+ LAA  G T  V++L++    S+++ E  D  T LH AA +G+ + ++LL+   AD N    A + N+ + +  A   G+   A +LL  GA +++ D    T L+     GH+  V LLL+ + D+S+R                           +A  A  PLT   G  PL  A  NGH  C   +L+ D ++
Sbjct:  142 LHHAAFNGHSEMVNFLVAKGAN-----INAFDKKDRRAIHWAAYMGHTEVVKVLVAHG-ADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTA-----------LHVACYNGQDVVVNE-------------LIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAK-----RGIHGMF--PLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGA-SVLLKEGPDRRTALHSAATNGHVECLRLLVE-NADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQ 815          

HSP 3 Score: 168.318 bits (425), Expect = 1.578e-42
Identity = 127/429 (29.60%), Postives = 209/429 (48.72%), Query Frame = 1
Query:  823 DIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKI-VQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGN-------LKAAQV-----------LLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADI 2052
            ++   D+E  TPLH A      EI ++L++S   +  ++     P H AC   +   V  L+K S D       + A +++++TPLH A  N     A+  +   +S N     GR+ALH AA  G  EMV  LV+  AN N  +K  +  +H AA   H +VV+ L+  GAD+  +D   Y+PL  A+S G    +KLL+    DI+       +AL++A  +        +I  + G   ++  + +G  PLH A    +  + +++L++ GA  +V++++ ++P+H+ A  GR    + L++   +  I  ED D NTPLH+AA+ G+  +I  L+  GAD   R  + +  L  AA  G        L A Q            +L  G ++D+ D+   T L+ A   G+   + LLL   AD+
Sbjct:   31 EVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSAD-------VNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELI--DCGAN-VNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGE--IDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADM 447          

HSP 4 Score: 157.147 bits (396), Expect = 4.679e-39
Identity = 168/643 (26.13%), Postives = 288/643 (44.79%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKA---RKIDFNHKNSRQNESGT-KLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIAC---GEGNI------------KMVDMLIKKSEDQDELSKMLQA------VNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGR--SALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRD-IDSYTPLLIAASYGHCETIKLLMKNHCD---INVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQS--LIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQN-GAQVDSMDKAKI-TPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTK 2196
            VN+   D  SPLH  A        + L++     ++  + +  TP+H AARY  +      I      +++   G   L+LA    L+  ++  +K L   +K    ++    +++S G   +  D +G T +H AA  GN V    L+     D+  KD    T LH A A+ + +    L+ S   L +Q+E  C P H A    G+G+               +D+    SE Q  L  +L+        ++   TP+HYA   GH    ++ LE+  +  +   +G   S LHLAA+ G    +++L+    + +V      TPL  AA + H   V+ LI+ GA +  ++  D  T L  AA+ GH E ++LL++N      ++ ++   ++ + LAV + ++D    ++S       ++  D KG   LH     G+E+ V +L+       ++    R P+H+AA  G   I+  LV+ +  S   I   D +  TPLH A  +G+   ++LLL     +     N  S L  A    N   A++L+   GA++ +   AK   PL+ A    H   + LLL HNA +++         + G +PL  A +NG       ++ S K ++ L++  +
Sbjct:  297 VNVQSKDGKSPLHMTAVHGRFTRSQTLIQNG-GEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLA---ALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGN-VECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSK---GASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEG-NAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVT-------DMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANR 923          

HSP 5 Score: 151.754 bits (382), Expect = 2.492e-37
Identity = 122/423 (28.84%), Postives = 197/423 (46.57%), Query Frame = 1
Query: 1069 KTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAAS---------------------------------YGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKV-IQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKS-DKWEI--ALRNQTKSLKGY-VDTP 2223
            + PL  A+ NG  D  +  + K   VNAV    R+ LH AA+ G  E+++LLV   A  N  +    TPLH A        VQ L++  AD+ +RD +  TPL +AA+                                  GH E +  L+    +IN  +K ++ A++ A    +++  K +++  +G   +   D KG  PLH A   G   +V++L+D G   D  N    T +H+A   G+  +V  L++      +   +E   TPLH AA S +  + ++LL+N GAD N ++ +  S L   A  G    +Q L+QNG ++D  D+   TPL++A + GH+ L+  L+ + AD + R        + G  PL  A  +G   C   +L +  K+ I  +  N+     G+ +DTP
Sbjct:    7 QAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVA--HGAD-VRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGAN--VNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKR-------GIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTP 417          

HSP 6 Score: 105.145 bits (261), Expect = 4.813e-23
Identity = 113/448 (25.22%), Postives = 177/448 (39.51%), Query Frame = 1
Query:  265 GTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDID-----KMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKML----LISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIK----KSEDQDELSKMLQAVNRDYKT-----------------------PLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSF--------EAN-----------------------------FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAA 1389
            G +   I  +H  A  G    L  LI+          +L+D+D       +PL  AA   H +CV++L++  ++ +     +R T +H AA        +    +N+  NE+       D    N  T  M    +    T   +      L+SKGA+ N +D  GCT +H  A  G+E   + L++   +D+ L++     PLH+A A  H  I   L    + S   +   +  G  P H AC  G+   V++L++    + ++ +  S +  AV  D ++                       PLH A    H +  ++ L   A VN     G+S L +A   G    V++LV+         +AN                              N TN  +QTPLH AA      VVQ L+ KGA I + D + YTP L  A
Sbjct:  578 GKSGHPISPLHLAAYHGHHGALEVLIR----------SLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAAT-NGHVECLRLLVENADSNEA------VDASDANEQTPVMLA--VGNGHTDCAS-----LLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQR-SVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCA 1000          

HSP 7 Score: 51.2174 bits (121), Expect = 1.977e-6
Identity = 43/127 (33.86%), Postives = 66/127 (51.97%), Query Frame = 1
Query: 1774 SNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAIL 2154
            S  PL  A  +G P  ++ L+    + NA +  K + L  AA  G  +  ++L+ +GA+V+S D   +TPL+ AC +  +  V  LLKH+AD++ R   D N       PL  A  N   +CA AI+
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNAR---DKNWQ----TPLHVAAANRAVKCAEAII 125          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 3.824e-55
Identity = 150/497 (30.18%), Postives = 245/497 (49.30%), Query Frame = 1
Query:  691 VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM---KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIIS-----DENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            V+  L+ +GA    +   G +P+H A  +G+ V   Q++   + P  DI L   + +T LH+A    H+  AK+LL    N   +   G  P HIAC +  I+++++L+K           ++AV     TP+H +   G+ +   + L+ GAS NA    G +ALH+AA  G  E+V+ L+   A  +   +  QTPLH AA    +++VQ L++  A  ++   + YTPL +AA  GH +   +L+++   + VT K   + L++A ++   +    ++      D  GK         G  PLH+A    N+K+  +L+D GA      +   TP+H+AAK  +  I   L+E   ++  I        PLHL A+ G+  V  LLL   AD N    + LS L  AA +  +  A++L+++GA V++  K   TPL +AC  G+ ++V  LL+H AD++ +          G  PL  A   GH      +LK
Sbjct:   21 VVEILLEQGAPILAKTKNGLSPLHMAT-QGDHVECVQVLMQYRAPVDDITL---DYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGAS-------IEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKN--------GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ--GVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTK-------NGYTPLHQAAQQGHTHIVNLLLK 489          

HSP 2 Score: 172.94 bits (437), Expect = 8.163e-44
Identity = 156/539 (28.94%), Postives = 252/539 (46.75%), Query Frame = 1
Query:  274 HR--SIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA---RYRRKARKIDFN-HKNSRQNESGTKLNLADVGTLNSATEEMQK------RLIEEEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRG-NEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLL 1833
            HR   +  +H  AR G  + +  L++Q      K  N      +SPLH A + +H+ECV++L+ +  A V+    + +T +H AA    YR     +D   + N R     T L++A         E + K       + E   TP   +A      ++L L+  GA+PN  +  G T +H AA  G  EV    L    ++D K +  E  TPLH+A      EI ++LL    +       G  P H+A  EG+  +  +L+       E    L    +   TPLH A K G  + A + L++ AS +A    G + LH+A+H  + ++  LL+   A+ + T K   TPLH AA+K+ +++   L+E GA+  +       PL + A  GH +   LL+  + D+N   K   S L+LA +    +  + ++  ++G  +       G  PL +AC  GN K+V  L+  GA  + K +   TP+H AA+ G T+IV +L++   +    D   + NT L +A + GY  V+  L
Sbjct:    2 HRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKN-----GLSPLHMATQGDHVECVQVLM-QYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAR--EEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILL-------EHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV--KHGAHVNATTKL-GYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARP--NDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 3 Score: 158.303 bits (399), Expect = 3.271e-39
Identity = 114/396 (28.79%), Postives = 189/396 (47.73%), Query Frame = 1
Query: 1060 RDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRS---------------------------------ALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----------LHI-------------------PDFK---GNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADI 2052
            +D  TPLH A ++GH    ++ LE+GA + A T  G S                                 ALH+AAH G     K+L+   AN NV      TPLH A +KN ++V++ L++ GA IE+      TP+ ++A  G+   + +L++     N T    ++AL++A     ++  ++++   NG ++          LHI                   PD     G  PLH+A R+G+E +  IL++ GA   V  ++  TP+H+A+K+G+  +  +L++R          ++  TPLH+A+     KV  LLL+ GA  +A   N  + L  AA K  L+ A  LL+ GA+ +++ +  + PL+L  + GH  + +LLL   AD+
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL--RNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP--DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADV 395          

HSP 4 Score: 65.855 bits (159), Expect = 7.139e-11
Identity = 42/116 (36.21%), Postives = 62/116 (53.45%), Query Frame = 1
Query: 1768 EDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            +D  TPLH AA+SG+ +V+++LL  GA   A+  N LS L  A    +++  QVL+Q  A VD +    +T L++A   GH R   +LL   A+ ++R        L G  PL  A
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRA-------LNGFTPLHIA 112          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 9.184e-49
Identity = 125/409 (30.56%), Postives = 203/409 (49.63%), Query Frame = 1
Query:  946 GCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIIS-----DENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            G  P HIAC +  I+++++L+K           ++AV     TP+H +   G+ +   + L+ GAS NA    G +ALH+AA  G  E+V+ L+   A  +   +  QTPLH AA    +++VQ L++  A  ++   + YTPL +AA  GH +   +L+++   + VT K   + L++A ++   +    ++      D  GK         G  PLH+A    N+K+  +L+D GA      +   TP+H+AAK  +  I   L+E   ++  I        PLHL A+ G+  V  LLL   AD N    + LS L  AA +  +  A++L+++GA V++  K   TPL +AC  G+ ++V  LL+H AD++ +          G  PL  A   GH      +LK
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGAS-------IEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKN--------GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ--GVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTK-------NGYTPLHQAAQQGHTHIVNLLLK 399          

HSP 2 Score: 178.718 bits (452), Expect = 8.245e-46
Identity = 120/400 (30.00%), Postives = 191/400 (47.75%), Query Frame = 1
Query:  847 SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA 2046
              TPLH+AC  N   + ++LL    ++    E+G  P H++   GN+ +V +L++     +       A N   +T LH A + G  +  +  L  GA V+A     ++ LH+AA  G +E+V+LL+   A+ +       TPLH AA + H  V   L+E GA +       +TPL +A+ YG  E   LL++     +   K   + L++A  H  +     ++ D+      H     G  PLHIA +    +I   L++ GA  +    +   P+HL A+ G   +  +L+ R     +    +   +PLHLAA+     V ++L+ +GA  NA      + L  A   GN+K    LLQ+GA V+S  K   TPL+ A + GH  +V LLLK  A
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPN-------ATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVA-SHYDNQKVALLLLDQGASP--HATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYAD--VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 402          

HSP 3 Score: 145.591 bits (366), Expect = 1.957e-35
Identity = 116/439 (26.42%), Postives = 194/439 (44.19%), Query Frame = 1
Query:  703 LVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQD-------------------ELSKML-------QAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIIS---DENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            L+ KGANPN++   G TP+H A  +      E L+K     I+      +TP+H++    +  I  +LL    +       G    H+A   G  ++V  L++     D                   E+ ++L        A   +  TPLH A + GH D   + LE GAS+   T  G + LH+A+  G +E+  LL+   A+ +   K   TPLH A+  ++ KV   L+++GA   +   + YTPL IAA     E    L++   + N   +   + L+L  +  ++D    +++   D N     H     G  PLH+A ++    + +IL+  GA  +   +   TP+ +A  +G   +V  L++      +  + ++  TPLH AA+ G+  ++ LLL  GA  N    N  +AL  A   G +     L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY-GASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVN-----HATK-SGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD--VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 4 Score: 144.436 bits (363), Expect = 3.692e-35
Identity = 88/312 (28.21%), Postives = 164/312 (52.56%), Query Frame = 1
Query: 1126 LEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFK---GNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADI 2052
            L+KGA+ N     G + LH+A  +  I +++LL+ + A+     +   TP+H +A   ++ +V  L++ GA   + ++   T L +AA  G  E ++ L++N   ++   +  ++ L++A      +  + ++        +  PD     G  PLH+A R+G+E +  IL++ GA   V  ++  TP+H+A+K+G+  +  +L++R          ++  TPLH+A+     KV  LLL+ GA  +A   N  + L  AA K  L+ A  LL+ GA+ +++ +  + PL+L  + GH  + +LLL   AD+
Sbjct:    2 LDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH------MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASP--DAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADV 305          

HSP 5 Score: 142.895 bits (359), Expect = 1.195e-34
Identity = 118/420 (28.10%), Postives = 187/420 (44.52%), Query Frame = 1
Query:  268 TNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDIN-VTEKGNKSALYLAVEHSYSDATKTI 1521
            TN R    +H  AR G  E +  L++   +     V+    ++ +PLH AAR   LE V++L++   A+ +       TP+H AAR           H++                                         V   L+  GA+  +    G TP+H A+  G  EVA+  L +    D   K+   +TPLH+A  +++ ++A +LL    +     + G  P HIA  +  +++   L++   + +       A+ R    PLH   + GH D A + L + A VN  T +G S LHLAA +  + + ++LV   A+ N T KL  TPL  A    ++K+V +L++ GAD+ S+  + YTPL  AA  GH   + LL+K     N VT  GN +AL +A    Y     T+
Sbjct:   77 TNVRGETALHMAARAGQTEVVRSLLRNGAQ-----VDAKAREEQTPLHIAARLGKLEIVQLLLQHM-ASPDAATSNGYTPLHVAARE---------GHED-----------------------------------------VTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNG--LTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETN-------AITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGN-TALAIARRLGYISVVDTL 430          

HSP 6 Score: 142.124 bits (357), Expect = 1.867e-34
Identity = 117/489 (23.93%), Postives = 208/489 (42.54%), Query Frame = 1
Query:  376 NLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE----------EEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIV---KILVERSKQSLIIDEDEDSNTP 1785
            N+  ++  +PLH A + N +  +++L++   A++    E  +TP+H +A        +      +  N +  +   A      +   E+ + L+           EE+TP    A      ++  L+   A+P+   + G TP+H AA  G+E     L++     + +   +  TPLH+A  +   E+A +LL    +     + G  P H+A    N K+  +L+ +            A  ++  TPLH A K    + A   LE GA  NA+T  G + LHL A +G  ++  LL++  A+ N   K   +PLH AA+++ V V + L++ GA + +     YTPL++A  YG+ + +  L+++  D+N   K                                     G  PLH A + G+  IV +L+  GA  +       T + +A + G   +V   K++ E +  S  +      N P
Sbjct:    9 NVRALNGFTPLHIACKKNRIRVMELLLKYG-ASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLE-HGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASP-------HATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTK------------------------------------NGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRNVP 452          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 77.0258 bits (188), Expect = 4.916e-16
Identity = 60/231 (25.97%), Postives = 99/231 (42.86%), Query Frame = 1
Query:  754 PMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLL--ISSNNLFD-QEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKG-ADIESRDIDSYTPLLIAASYGHCETIKLLMKNH 1434
            P+H A M       ++L+      +  KD +   PLH + +    EI   LL  + + NL D  +++G  PFHIAC  GN+++V  L                    Y  PL                     +N +T  G + LHLA  +   E+ + L+   A+  + +K  Q PLH AA    +K+++ L   G + +  +D   +TPL  A + GH +   LL++ +
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSL--------------------YDRPLK------------------PDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKY 197          

HSP 2 Score: 65.4698 bits (158), Expect = 3.983e-12
Identity = 52/167 (31.14%), Postives = 82/167 (49.10%), Query Frame = 1
Query:  700 YLVSKGANPNIQD---TYGCTPMHYAAMRGNEVAAEQLMKLP-EIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYK---TPLHYAVKNGHCDAAKVCLEK-GASVNAVTYTGRSA 1176
            +L+SK  N N+ D     G TP H A   GN    + L   P + D+    N+ +T LHLA     FE+++ L+ +  ++  +++   IP H A   G++K++++L    +          AVN   K   TPL +A+  GH DAA + +EK GA  + V   G  A
Sbjct:   54 FLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGK---------SAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKA 211          

HSP 3 Score: 64.3142 bits (155), Expect = 8.927e-12
Identity = 56/200 (28.00%), Postives = 94/200 (47.00%), Query Frame = 1
Query: 1573 NFPLHIACRDGNE--KIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN-TPLHLAAKSGYPKVIQLLLN--YGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            N+PLH AC + NE  K+ ++L    ++   K+++ R P+H +  F    I   L+ + +   + D  +DS  TP H+A   G  +V++ L +     D N      ++ L  A  K   + +Q L++NGA V   DK    PL+ A   G  +L+ LL         + A +  D   G  PL  A+  GH   A+ +++
Sbjct:    3 NYPLHQACME-NEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG-----KSAVNWQDK-QGWTPLFHALAEGHGDAAVLLVE 195          

HSP 4 Score: 50.0618 bits (118), Expect = 5.353e-7
Identity = 52/198 (26.26%), Postives = 91/198 (45.96%), Query Frame = 1
Query: 1273 PLHAAAEKNHVKVVQYLI-EKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSA---LYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLL-NYGAD 1851
            PLH A  +N    VQ L+  K + +  +D D   PL  + S+   E    L+    ++N+ +  + S     ++A      +  K++  D   K  L+    +G   LH+A      ++ Q LI+ GA   +K++  + P+H AA  G   ++++L    K S +  +D+   TPL  A   G+     LL+  YGA+
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLY-DRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGK-SAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAE 200          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 70.8626 bits (172), Expect = 1.073e-12
Identity = 76/301 (25.25%), Postives = 126/301 (41.86%), Query Frame = 1
Query: 1267 QTPLHAAAEKNHVKVVQYLIEKG--ADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNF-PLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAK-SGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            + PLH AAE   ++ V  L+      D++  D DS TPL++A +  H + ++       D+      N S     +E    D +K +IS             K  F PL++AC+  N    ++L++  +  +  N + ++  HL            L +++   L           LH+ AK  G P++IQLL+ YGAD N                              ++D  +K   TP++ A ++GH  ++T LLKHNA + +    D N    G +PL  A+   H     A+L+
Sbjct:  425 RVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVR-------DLLTIGGANASP----IEKPILDYSKNVISST-----------KVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQP---------LFKKNSTGL---------CTLHIVAKIGGDPQLIQLLIRYGADPN------------------------------EIDGFNKW--TPIFYAVRSGHSEVITELLKHNARLDIE---DDN----GHSPLFYALWESHVDVLNALLQ 646          

HSP 2 Score: 64.3142 bits (155), Expect = 1.120e-10
Identity = 67/268 (25.00%), Postives = 112/268 (41.79%), Query Frame = 1
Query:  727 NIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRD-IDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII 1524
            N QD +   P+HYAA  G  E     L+     D+   D++S TPL LA  +NH ++ + LL                     G  N   ++  I       + SK + +  +    PL+ A K  + DAAK+ LE  +  NA     +S+ HL        + K   +     ++  K+   P          +++Q LI  GAD    D  + +TP+  A   GH E I  L+K++  +++ +    S L+ A+  S+ D    ++
Sbjct:  418 NAQDIHSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLL-------------------TIGGANASPIEKPIL------DYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQ-----PLFKKNSTGLCTLHIVAKIGGDP----------QLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALL 645          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 67.781 bits (164), Expect = 9.892e-12
Identity = 63/239 (26.36%), Postives = 110/239 (46.03%), Query Frame = 1
Query:  811 LPEIDIKLK------DNESMTPLHLACAHNHFEIAKML--LISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNA-VTYTGRSALHLAAHQGSIEMVKLLVS---FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRD-IDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAV 1488
            L E+ I L+      DN   TPLH +C +   E+ K++  L+   N++++     IP       G             D + L            TPLH  V   H    +V L+   S++  V     S LHLA    +  ++ +L+S   F+ N+   N+L +TPL+ A   N  +    L+  GAD+E R+ +  +T + +AA+ G  + +KLL+ N+ + ++ ++G  + +  AV
Sbjct:  410 LEELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNE-----IPIDDVSAFG-------------DAESL------------TPLHLCVLGAHPKTTEVLLQ---SLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQ-DNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAV 614          

HSP 2 Score: 63.929 bits (154), Expect = 1.561e-10
Identity = 62/237 (26.16%), Postives = 109/237 (45.99%), Query Frame = 1
Query:  652 LIEEEKTPTKNNAVILYLVSKGANPNI--QDTYGCTPMHYAAMRGNEVAAEQLMKL----------PEIDIK-LKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRD---YKTPLHYAVKNGHCDAAKVCLEKGASVNAV-TYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKV 1311
            + EEEK+     + IL  +     P +   D Y  TP+HY+   G     + ++KL          P  D+    D ES+TPLHL     H +  ++LL S +     + +  +  H+A    N  ++ +L+         SK      +D   ++TPL+ A +    +AA   L  GA +       G +A+ +AA +G  ++VKLL++  ANF++ ++   TP+  A  + H+ +
Sbjct:  395 ITEEEKSSACTLSYILEELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLL--HLATEWNNYPLLHVLLS--------SKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHI 621          

HSP 3 Score: 55.0694 bits (131), Expect = 6.893e-8
Identity = 66/265 (24.91%), Postives = 108/265 (40.75%), Query Frame = 1
Query:  328 LSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE-SMTPLHLACAHNHFEIAKMLLISSNNLFDQEET-GCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAA 1116
            LS+++++ P   + C+   D  K +PLHY+ ++   E  K+++ +     N+ NE    PI   + +                 ES T L+L  +G     TE + + L                      +PN++     + +H A    N      L+     DI  +DNE   TPL+LAC  N FE A  LL +  +L  +E+  G     +A  EG   +V +LI  + + D         +    TP+ +AV  GH   A
Sbjct:  406 LSYILEELPIHLRPCLFQHDNYKRTPLHYSCQYGLSEVTKLII-KLMKEWNIWNE---IPIDDVSAF--------------GDAESLTPLHLCVLGAHPKTTEVLLQSL----------------------DPNVK-LKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFD-------IEDEGGWTPMEHAVLRGHLHIA 622          

HSP 4 Score: 53.5286 bits (127), Expect = 2.492e-7
Identity = 42/143 (29.37%), Postives = 68/143 (47.55%), Query Frame = 1
Query: 1669 ERTPMHLAAKFGRTYIVKILVERSKQSLIIDE----------DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGA-QVDSMD-KAKITPLYLACKNGHDRLVTLLLKHNADISMR 2061
            +RTP+H + ++G + + K++++  K+  I +E          D +S TPLHL     +PK  ++LL    D N +     S L  A    N     VLL +    ++  D +   TPLYLAC+         LL + AD+ +R
Sbjct:  428 KRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQ-SLDPNVK-LKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIR 568          

HSP 5 Score: 49.6766 bits (117), Expect = 3.203e-6
Identity = 45/192 (23.44%), Postives = 87/192 (45.31%), Query Frame = 1
Query: 1465 KSALYLAVEHSYSDATKTIISDENGKKLLH-IP--------DFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNAR-NCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGH 2010
            ++ L+ + ++  S+ TK II       + + IP        D +   PLH+     + K  ++L+ +  +D     +  + +HLA ++    ++ +L+   +  +   ++E   TPL+LA +  + +    LL  GAD   R      +A+  AA +G     ++L+ N A  D  D+   TP+  A   GH
Sbjct:  429 RTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQS--LDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGH 618          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 65.0846 bits (157), Expect = 7.028e-11
Identity = 33/99 (33.33%), Postives = 61/99 (61.62%), Query Frame = 1
Query: 1165 GRSALHLAAHQGSIEMVKLLVSFEANFNVTNK--LMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY--TPLLIAASYGHCETIKLLMKNHCDINV 1449
            GR+ L +A  +G  ++VK ++  E  +++ ++     T LH AA + H+++V+ LIE GAD+  + I+ +  TPL+ A++ GH + +K L+KN  D  +
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIE-EGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTI 427          

HSP 2 Score: 52.373 bits (124), Expect = 5.375e-7
Identity = 39/114 (34.21%), Postives = 62/114 (54.39%), Query Frame = 1
Query: 1735 RSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGA-DKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVD--SMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVA 2067
            R KQ   I  D    T L +A   G   V++ ++  G  D N ++    +AL  AA +G+++  ++L++NGA V+  S++    TPL  A  NGH  +V  LLK+ AD ++R A
Sbjct:  317 RPKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNA 430          

HSP 3 Score: 50.8322 bits (120), Expect = 1.275e-6
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 1
Query: 1561 DFKGNFPLHIACRDGNEKIVQILIDAGAID-DVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALD 1890
            D  G   L IAC  G   +V+ +I+ G  D + ++    T +H AA  G   IV++L+E      I   +   +TPL  A+ +G+  V++ LL  GAD   RN   L+A +
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          

HSP 4 Score: 48.9062 bits (115), Expect = 5.464e-6
Identity = 31/117 (26.50%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  835 KDNESMTPLHLACAHNHFEIAKMLLISSN-NLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALH 1182
            +D+   T L +AC    +++ K ++     ++ DQ+  G    H A  +G+I++V++LI+   D +     ++++     TPL  A  NGH D  K  L+ GA        G +A  
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVN-----IKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 62.003 bits (149), Expect = 5.329e-10
Identity = 61/228 (26.75%), Postives = 96/228 (42.11%), Query Frame = 1
Query: 1180 HLAAHQGSIEMVKLLVS---FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSY-TPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGAD 1851
            H A  +G +  VK ++     E N +  +    T LH A+  N + VV +L+ +GAD+ +R    + TPL  AA YG+   +  L+K+  D  +T+    + L+L+V  S       ++ +   K LL I            CRD                     + RT +  AA  G +  V  L++      I   D +  TPLH     G P V++ L+  GAD
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDI-----------DCRD--------------------PKGRTSLLWAAYQGDSLTVAELLKFGASIKI--ADTEGFTPLHWGTVKGQPHVLKYLIQDGAD 272          

HSP 2 Score: 60.8474 bits (146), Expect = 1.227e-9
Identity = 56/209 (26.79%), Postives = 91/209 (43.54%), Query Frame = 1
Query:  751 TPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCI---PFHIACGEGNIKMVDMLIKKSED----QDELSKMLQ-AVNRDYKTPLHYAVKNGHCDAAKVCLEKGA-SVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADI 1344
            T  H A  RG+    ++++  KL E++      E +T LH A  +N   +   L+    ++      G +   P H A   G + +VD L+K   D     D+   +L  +VN      + Y + N         + KG   ++     GR++L  AA+QG    V  L+ F A+  + +    TPLH    K    V++YLI+ GAD 
Sbjct:   75 TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADV--NARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFN--------VVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          

HSP 3 Score: 51.9878 bits (123), Expect = 6.648e-7
Identity = 42/164 (25.61%), Postives = 73/164 (44.51%), Query Frame = 1
Query: 1171 SALHLAAHQGSIEMVKLLVSFEANFNV-TNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLM-----KNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGA 1644
            + LH A+    + +V  LVS  A+ N     L  TPLH AA   +V +V +L++ GAD    D   +  L ++ +  +   +  ++     K   DI+  +   +++L  A   +Y   + T+         + I D +G  PLH     G   +++ LI  GA
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWA---AYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGA 271          

HSP 4 Score: 50.8322 bits (120), Expect = 1.226e-6
Identity = 45/170 (26.47%), Postives = 69/170 (40.59%), Query Frame = 1
Query: 1585 HIACRDGNEKIVQILIDAGAID---DVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSN----TPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQ-----VDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISM 2058
            H AC+ G+   V+ +I    ++   D  + E  T +H A+   R  +V  LV +       D +  +     TPLH AA+ GY  ++  LL +GAD    +    + L  +    N+     +L N        +D  D    T L  A   G    V  LLK  A I +
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGA-----DVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKI 242          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 262.692 bits (670), Expect = 6.782e-77
Identity = 175/480 (36.46%), Postives = 267/480 (55.62%), Query Frame = 1
Query:  850 MTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSE---DQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALH---LAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPD-------FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMP 2250
            MTPLH+AC+H    +AK L+ +  +L   +E    P H AC EGN+ +  +L   +E       +SKM+   +R+ +T LH AV+ GH D AK+CLEKGA+VNAV  +     H   + A +    M+K+      +F  + K+ +  L    +   V ++ Y+I   A IE RD D  TPL+IAA   H +T++ L+++  DI   +  ++++++ A      +  +  +  E+ K +  I D         G+  L +  R  +    Q+L+D GA  D KN+E+ TP+H AAKFGR   V  L++R   ++I DED  SNTPLHLAA  G+  V++ LL  G   +ARN    + LD AA +G ++ A +LL   A VD  DKAK TPL+LA + GH  +V LLL   A+I++  +        G N LD AI++ H++ A+AI+    W+ A+RN+ K L   + +PMRKLI+K+P
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDV--VIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAAL--EHQKPVWTICDDVCLNGLVGGSNKLILVLRISS----QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDP-AIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSA-------GRNCLDIAIESSHKEVAVAIIDHVDWKQAMRNRCK-LGNAITSPMRKLIKKLP 467          

HSP 2 Score: 78.1814 bits (191), Expect = 8.971e-15
Identity = 86/325 (26.46%), Postives = 139/325 (42.77%), Query Frame = 1
Query: 1258 KLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLM--------KNHCDINVTEKGN--KSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVK-NEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLK-------------------------------------AAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            K   TPLH A     + V + L+E GAD+ S D +  TPL  A   G+    KLL          +     VT++    ++AL+LAVE  + D  K  +  E G  +  + + K N   H       E I  ++I    +  +   + E+    +   F    I+   + R + + I   D+D +TPL +AA+  +   ++ LL +GAD  A++ N  +++  AA +G ++                                     ++Q+LL NGA +DS +   ITP++ A K G  R V  LLK +  I     G +N PL
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCL--EKGANVNAVKESK-NKTFHKTIVVARECIF-VMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFR-ACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPL 321          

HSP 3 Score: 72.4034 bits (176), Expect = 5.142e-13
Identity = 67/275 (24.36%), Postives = 110/275 (40.00%), Query Frame = 1
Query:  364 KKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLA 1188
            + C+   D DK +PL  AA  NH++ V+ L++  +        +R +    AA    +  +    H+            + D   LN       K ++    +          L+  GA  + ++    TP+HYAA  G       L+K     I  +D  S TPLHLA  H H  + K LL     +  +  T   P   A   G +++ ++L+ +    D   K          TPLH A + GH +  K+ L + A++      GR+ L +A
Sbjct:  170 RACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWT-------ICDDVCLNGLVGGSNKLILVLRISSQ-------LLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKA-------KTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIA 423          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO27354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9H1])

HSP 1 Score: 130.183 bits (326), Expect = 2.203e-31
Identity = 157/606 (25.91%), Postives = 269/606 (44.39%), Query Frame = 1
Query: 1618 VQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYP-KVIQLLLNY--GADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWE--IALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMI-EAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQW--EEYPPDNRLIFYDV--VTYTIFGIFLLMMSIITMNLL 3402
            VQ+LI  GA  D +  E  TP  LA K+ +T     L++R     I  ++    + LHLA       + ++LLL++  G+  NAR+ +  + L  AA +G+ ++  +LL     +D+ D     P Y+   N    +V L L   AD++ R   D       C  LD AID    + A  +++ D+W   I  RN    L      PM  LI  +PDVA+    +C V       H DY +T++   L+      G               D SE                                         VMV    E+LL H +   LLR KW  FG V YY  L ++L +++    ++I E +   LY   +     N S  A  KQ L  E+   S      ++++   +  +KE  Q+ + R +YF  + N++ELV+Y  A +  I     +  +       W  G V+ F++ +N++L+I+ +   G++V M+ +V  +F++ + +F + +      +Y+LL  +  F+ +  + ++T VM +GE+++  + ++    +E  P     +  +  VTY  F +F++M+ I+ MNLL
Sbjct:   20 VQLLISKGATKDTRGFENNTPFLLAVKYDKTQAAAELLKRGAD--IKAKNLFFLSSLHLAVSLHKDCETLKLLLDWDDGSLLNARDLDLQTPLHVAAARGSPESINLLLGKNCTIDAKDANDQYPFYIVEVN----IVKLCLAEGADVTXRNKDDKT-----C--LDVAIDWKRTEVAKVLIQHDRWWEVICTRNSAGEL------PMVGLIEALPDVAKLALDQCIVRCPLPTSHQDYCLTFHTVLLDPGPCKEGQTS-----------RDASE-----------------------------------------VMVENDCEELLSHPVTQGLLRYKWFAFGKVPYYIYLMVFLIFVILFSYFIITERDSSTLYHPTHP----NAS--ALEKQYL--EKRPSSTNSITIVLILFATIEFLKEFYQIFMIRLDYFKDITNLVELVLYTCAII-FISPYLAEEPLYTAAYGHWNAGVVTLFLAYLNVLLYIKGIGSSGLYVTMYFEVWYSFLKVITVFLVVLLGSTLVYYLLLKEEDDFSGVHYAFVRTFVMMVGEIDYTGVLSSNVINKEVNPATGAPYVPLPPVTYVFFFVFVVMVPILLMNLL 545          

HSP 2 Score: 65.855 bits (159), Expect = 7.637e-11
Identity = 56/219 (25.57%), Postives = 90/219 (41.10%), Query Frame = 1
Query: 1285 AAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQN 1941
            AA  N +  VQ LI KGA  ++R  ++ TP L+A  Y   +    L+K   DI        S+L+LAV       T  ++ D +   LL+  D     PLH+A   G+ + + +L+      D K+  ++ P          YIV++                               +++L L  GAD   RN +  + LD A      + A+VL+Q+
Sbjct:   11 AAFSNQLPAVQLLISKGATKDTRGFENNTPFLLAVKYDKTQAAAELLKRGADIKAKNLFFLSSLHLAVSLHKDCETLKLLLDWDDGSLLNARDLDLQTPLHVAAARGSPESINLLLGKNCTIDAKDANDQYPF---------YIVEV------------------------------NIVKLCLAEGADVTXRNKDDKTCLDVAIDWKRTEVAKVLIQH 190          

HSP 3 Score: 62.7734 bits (151), Expect = 7.405e-10
Identity = 52/211 (24.64%), Postives = 92/211 (43.60%), Query Frame = 1
Query:  967 ACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYK--TPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAH-QGSIEMVKLLVSFEAN--FNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPL 1584
            A     +  V +LI K   +D          R ++  TP   AVK     AA   L++GA + A      S+LHLA       E +KLL+ ++     N  +  +QTPLH AA +   + +  L+ K   I+++D +   P  I         +KL +    D+    K +K+ L +A++   ++  K +I  +   +++   +  G  P+
Sbjct:   11 AAFSNQLPAVQLLISKGATKD---------TRGFENNTPFLLAVKYDKTQAAAELLKRGADIKAKNLFFLSSLHLAVSLHKDCETLKLLLDWDDGSLLNARDLDLQTPLHVAAARGSPESINLLLGKNCTIDAKDANDQYPFYIV----EVNIVKLCLAEGADVTXRNKDDKTCLDVAIDWKRTEVAKVLIQHDRWWEVICTRNSAGELPM 208          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC56])

HSP 1 Score: 118.242 bits (295), Expect = 1.229e-29
Identity = 87/239 (36.40%), Postives = 142/239 (59.41%), Query Frame = 1
Query: 3067 IRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGI-GREVRRQMCKDDQLD----DMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKN 3768
            +RK P  GI+VVMFT +  TF +F  +FFLFI  F  AF+IL+ +Q  F +   S+++TT+  +GE E+D+++N    E PP         + + ++  FL++  II MNLLVGLAVDDIK VQEKA L+R+ MQV L L+VE  +P  +RRR+  ++  VYPN+    Y T++    R        +D ++     +E+L+ +Q+   +++  +K KL+++      +  M+  ++K+
Sbjct:    1 MRKFPKLGIYVVMFTHIFKTFAQFFVVFFLFIIGFGLAFHILIYDQGPFATPGRSMLKTTMGMLGEFEYDTVYNDN--EVPP---------IAWALYVCFLVINCIILMNLLVGLAVDDIKGVQEKAVLKRLAMQVDLVLDVEKALPAMLRRRFASKQEIVYPNKTR--YWTIWSFWSRNTSPARAINDAMNPEKTPIEKLQRNQEILKDEVLNVKLKLKSVLQHTTQLEVMMKAMMKH 226          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST04])

HSP 1 Score: 123.635 bits (309), Expect = 6.699e-29
Identity = 151/633 (23.85%), Postives = 255/633 (40.28%), Query Frame = 1
Query: 1843 GADKNARNCNKLSALDFAATKGNLKAAQVL-LQNGAQVDSMDKA-KITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRK-------------------------VPF---FGI--FVVMFTD-----------VLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVR 3609
            G D   R     +AL FAA KG+L++ Q++ + N   ++  D A + T L+LA KNGH  +V  LL   +D + ++  +  +     N LD AI+ G     + I    +W        + L     T ++ L+ KMP  AE+   +C        D  DY++T++F FL+      GM    ++  K+F            LD                                L  MV+ +R + L H +   ++ +KW + G   Y  NL  YL                +L  + + T+ L+    A+++  LV        +I KY I+VM++  L+KE  Q+   +  Y    +N ME  +Y+ + V +I        + V    +    A + F++ +  VL++R+                         +PF   FGI  F+++  D                    P       A           Q  F+ L  S+  T ++ +GE+++    +T ++  P  N  I     +Y I+ IF + M II  NLL+GL+V D+  + + A +E+  MQV L LE+E   P  + R+  +     +PNR  +  + L   G   R
Sbjct:   13 GWDTEGR-----TALHFAAAKGSLRSVQLICMANPNCINDEDNADQDTSLHLAAKNGHSEVVDFLL---SDPNQKITYNGYNQ----NGLDVAIEAGRENVVMVIANHTRWREMCHRVEEGL-----TQLQHLVIKMPSAAEKFLDRCVEECGAGKDE-DYSVTFDFMFLQ------GMPDIRKDDPKKF------------LDC-------------------------------LHTMVKYKRVNCLSHQVCGAIMNIKWRSVGWKAYVMNLTFYLI---------------FLLLLTSMTIMLD----ARIEDNLV-------IDIPKYTIIVMSLFHLLKELFQIWDEKFKYLLKADNWMEWFLYMSSLVYMIQYEVFDNHVSVTGETR-PLAATAIFIAWVIFVLYLRRFSTFGIYIIMMTNIIKTLIKIIILFIPFVIAFGIPFFLLLKKDYYEDSDTTTSSTNTNNNITAPNSTNSTAAAPQTAQRKTDTQFLFDELPYSLFTTFMLILGEMKYP---HTVYKYQPIPNPWI-----SYIIYIIFCVCMPIIIKNLLIGLSVGDVNRILQTAKMEQHAMQVELLLELERATPRRVLRKIWVAYFVDFPNRNKTWKQKLMEFGSPKR 543          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB40])

HSP 1 Score: 115.931 bits (289), Expect = 2.236e-26
Identity = 89/282 (31.56%), Postives = 149/282 (52.84%), Query Frame = 1
Query: 1510 TKTIISDENGKKLLHIPDFKGNFPLH---IACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFL 2346
            T  II    GK +++  D  G  PLH   I C+ G  KI+Q+LI++GA     + +ER P+H AA+ G    + IL++ + ++ I + D  S T LH+AA +   +  +LLL  GA+ + R+  +L+ L + A+ G     +VLL+  A +++ DK + TPL  A   G   +   LL   ADI+   +       +G N LD A+DN +      I++ + W+  L N     K    +P++KLI ++P +A+ V  KC   ++      +Y++TY+F+ L
Sbjct:   18 TVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGG--KIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPET-INEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETS-------SGWNALDVALDNNNLDITNEIIRHESWKTLLLNT----KADGVSPLKKLIERVPCLAKVVLDKCIEHSTWVDTDKEYSVTYDFQLL 285          

HSP 2 Score: 86.6557 bits (213), Expect = 3.060e-17
Identity = 73/250 (29.20%), Postives = 119/250 (47.60%), Query Frame = 1
Query:  853 TPLHLACAHNHFEIAKMLLISSNN--LFDQEETGCIPFH---IACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGA-SVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPL 1584
            T LH+A A + F   +++L +     +  ++  G  P H   I C  G  K++ +LI+   +       + AV+ D + PLH+A + G  D   + L+    ++N V     +ALH+AA     E  +LL+   A  +  +    TPL   A       V+ L+E  AD+E+RD +  TPL+ AA +G  E  + L+ +  DI        +AL +A++++  D T  II  E+ K LL      G  PL
Sbjct:    5 TCLHVAAACSDFRTVEIILRNGGKSIINSKDSYGKTPLHYAVIRCQGG--KIIQLLIESGAN-------VLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDADLEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHESWKTLLLNTKADGVSPL 245          

HSP 3 Score: 53.5286 bits (127), Expect = 5.166e-7
Identity = 47/187 (25.13%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  679 KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEA 1239
            +   +I  L+  GAN    D     P+H+AA +G       L++     I   DN S+T LH+A A    E  ++LL     +  +++    P       G    V +L++   D       L+A +++ KTPL  A   G  +  +  L+ GA + A T +G +AL +A    ++++   ++  E+
Sbjct:   50 QGGKIIQLLIESGANVLAVDFDERLPLHHAAEQGMLDNISILLQANPETINEVDNRSLTALHIAAAAARTEACRLLLEKGAEVDYRDDERLTPLFYVASVGCPLTVKVLLEYDAD-------LEARDKNRKTPLISAAYFGRLEVFRTLLDSGADIAAETSSGWNALDVALDNNNLDITNEIIRHES 229          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:101174541])

HSP 1 Score: 330.872 bits (847), Expect = 8.899e-95
Identity = 303/1114 (27.20%), Postives = 525/1114 (47.13%), Query Frame = 1
Query:  289 NMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASAN-VNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYA-AMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM-LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVS----FEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEH--SYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDG-NEKIVQILIDAGAID-DVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDE-DEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMV---MVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF---SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEF-DSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESS 3570
            N  + A +GD+  L  L++++P    + ++  D    SPLH+AA   H+  ++ ++       +N  +++   P+H+A                                               E   P    A    L+  GA+PN+ +T   +P+H A ++R N++  + L+     D  L+ +   TPL +AC+ N+ E   +LL     L  Q + G  P H A   G  K +++++K  E+    + + +  +++   +PLH AV+ G+ +A ++C+  GA ++       + LHLA  QG+ E+VKL++S     E   N+T+   QTPLH A   +H ++ +YLI  GAD+ S D    TPLL+A S G  + + LL+    ++N+ +K   + L+LA+       +  + ++   + K LL   D +G  PLH ACR G ++ +  +L  +G +    K++++++ +H AA++GR    + L+E    S +++E DE   TPLHLA+K G+ KV+QLLL  GA  ++ +    S L  AA++G  +   +LL  N   +D  D+   T L++A + GH   V L+L   A++ +      N   T    L  A+ NG +    A++ SD+ E AL+  T         P+  +I  +P+  + +   C   +    +  DY I YNF++L+   +   ++             DES                                   LK  PL+    MV+  R +LL+H +    L MKW  +G   +  N+ +YL  LL L   ++   P         T      +   V     ++ +  S  +   ++++M +  + KE  QL   R NYF   S  N     +Y L F+  +        I       WQ GA++     +  +L++++    GIFVVMF +++ T +R + LFF  + AF+ AF+ L+ NQ  F ++  S+IQT VM +GEL + ++I +   +   P      + ++TY IF  F+++M I+ +NL++GLAV DI  VQ  A+L+R+ MQ+ L   +E  +P +  +R     + +YPNR+ S
Sbjct:   29 NAVELAEKGDLAHLENLVRKSP----EVLSEKDECGASPLHHAAAGGHVTLIQFIITVLDPKELNCSDDQGNVPLHWAV----------------------------------------------ERNKPESCRA----LLDLGADPNVLNTALLSPLHLAVSLRQNDLM-KLLLSYNATDCNLQGDLGNTPLMMACSINNCEALTILLKHGAKLCQQNKLGHFPMHAAAFAGAKKAMEVILKAGEEHGHPAAVHINYLDKSNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLSTVDQVEDFINLTDGACQTPLHRATIFDHSELAEYLISLGADLNSCDCKGNTPLLLATSCGAWKCVALLLSKGANVNLKDKCGCNFLHLAIHQPKGLKNIPEEVLQRNSVKALLSCEDNEGCTPLHYACRLGIHDSVKNMLGLSGQLGLACKSKDKKSALHFAAQYGRINTCQRLLETITDSRLLNEGDERGLTPLHLASKEGHTKVVQLLLRKGALFHS-DYKGWSCLHHAASEGYTQTMAILLSANLKLLDKTDEDGNTALHIAARAGHVAAVRLMLVKGAELVL------NKNHTSF--LHEAVQNGRKDVVNAVVDSDRCEEALQLFTPGTSQRC--PILDMIEFLPETYKHLLDCCVRESDDDHNSPDYHIEYNFQWLQAPISPQKLS-------------DES-----------------------------------LKIQPLVAVNAMVKYNRIELLNHPVCKKYLAMKWVAYGSKAHALNMFLYLLGLLPLTHLIVSLRPSM------NTTDTGDHVINMVPVSFTEQTVFKSFSM--VMVLIMNIYSIGKEIVQLSQQRWNYFRDHSNHNDWASAVYSLLFIIPL-------MINAEGSLHWQAGALAVLHYWIGFLLYLQRFENVGIFVVMFGEIMRTLVRIVMLFFFLMLAFSLAFHALMLNQSQFETVPLSVIQTFVMMVGELNYQNNILDAFLKNELP------FGILTYFIFVQFVMLMPILLVNLMIGLAVGDIAEVQRNASLKRIAMQIDLHTSLEDKLPYWFMKRVDKPSIIIYPNRKCS 1007          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 244.973 bits (624), Expect = 3.053e-65
Identity = 183/618 (29.61%), Postives = 307/618 (49.68%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR------------YRRKAR-KIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPT------KNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM-KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            VN       SPL+ AA+ NHLE VK L+E   AN ++P E+  TP+  A +            Y  K + ++   H  +R +++ T    A V   N    ++   L +   TP       +N +V   L+++GAN N     G TP+H A+ RGN +    L+ +  +ID + KD   +TPLH A  + H  I ++LL     +  + + G  P H+A    ++  V  L++ + + D+       +  D+ TPLH A   GH   AKV L+KGA  NA    G + LH+A  +  +  + LL+   A+     +   TPLH AA   H+ +V+ L+++GA   + ++   TPL +A+  GHCE  + L++N   ++   K +++ L+ A    + +  K ++  +        PD     G+ PLHIA R+G+   ++IL+DAGA      ++  TP+H+A+K+G+  + ++L+ER          ++  TPLH+A       V++LL++ G   ++   N  + L  AA +  ++ A VLLQNGA  +      ITPL+LA + G   +V +L+   A++++   G+ N    G  PL      GH   A  ++K
Sbjct:  102 VNAQSHKGFSPLYMAAQENHLEVVKFLLENG-ANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRT----AAVLLQNDPNPDV---LSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDE--LTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDD-------ITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKAN------PDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANP--NAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNL---GNKN----GLTPLHLVAQEGHVGIADTLVK 687          

HSP 2 Score: 244.973 bits (624), Expect = 3.079e-65
Identity = 185/623 (29.70%), Postives = 298/623 (47.83%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIE---EEKTP----TKNNAVILYLVSKG-----------ANPNIQDTY--GCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNE----SMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL 2088
            +H  AR  D    + L++ +P       ++L     +PLH AA + ++   ++L+    ANVN   +  +TP+H A+R R     +        Q ++ TK  L     L+ A      R+IE   E   P    TKN    +++ ++G            N  I D      TP+H AA  G+   A+ L+     D   K N       TPLH+AC  NH     +LL  S +L    E+G  P H+A   G++ +V  L+++    +       A N   +TPLH A + GHC+ A+  L+  A V+A     ++ LH AA  G  E+VKLL+  +AN +       TPLH AA + H+  ++ L++ GA         +TPL +A+ YG  +  +LL++   + N   K   + L++AV H+  D  K ++S        H     G  PLHIA +    ++  +L+  GA  + ++ +  TP+HLA++ GR  +V +L+  SKQ+ +   +++  TPLHL A+ G+  +   L+  GA   A +    + L  A   GN+K  + LLQ  A V++  +   TPL+ A + GH  +VTLLLKH A +   +  +   PL
Sbjct:  175 LHIAARNDDTRTAAVLLQNDPNP-----DVLSKTGFTPLHIAAHYENMSVAQLLLNRG-ANVNFTPKNGITPLHIASR-RGNVMMVRLLLDRGAQIDAQTKDELT---PLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLL-----DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPN-------ASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSA---HSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLI--SKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGA-LPNEITSNGTSPL 769          

HSP 3 Score: 200.675 bits (509), Expect = 1.745e-51
Identity = 165/568 (29.05%), Postives = 272/568 (47.89%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQN-PRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA---------DVGTLNSATEEMQKRLIEEEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVL 1932
            +H  AR G V  +  L++   P +AK        + +SP+H AA+ +H++CV+ L++  +A ++    + +TP+H AA    +R     +D   K N+R     T L++A         D+   +SA+ E    + E   TP    A      ++  L+ +GA+PN  +    TP+H A+  G+ EVA   L    ++D + KD++  TPLH A    H E+ K+LL    N       G  P HIA  EG+I  + +L+     Q +++K      + + TPLH A K G  D A++ LE+GA+ NA    G + LH+A H  ++++VKLLVS   + + T +   TPLH AA++N ++V   L++ GA      +   TPL +A+  G  + + +L+    ++N+   GNK+ L                                  PLH+  ++G+  I   L+  GA     +    TP+H+A  +G   +VK L++  +Q+ +  +     TPLH AA+ G+  ++ LLL +GA  N    N  S L  A   G +    VL
Sbjct:  274 LHCAARNGHVRIIEILLEHGAPIQAKT------KNGLSPIHMAAQGDHMDCVRQLLQ-YNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA---VTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQ--TPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTK------KGF-TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNL---GNKNGLT---------------------------------PLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQ--QQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 4 Score: 200.29 bits (508), Expect = 2.107e-51
Identity = 143/484 (29.55%), Postives = 237/484 (48.97%), Query Frame = 1
Query:  691 VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTP-LHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTII---SDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGH 2130
            ++L L+  G         G T +H AA+ G E    +L+     ++  + ++  +PL++A   NH E+ K LL +  N     E G  P  +A  +G+  +V +LI                    + P LH A +N     A V L+   + + ++ TG + LH+AAH  ++ + +LL++  AN N T K   TPLH A+ + +V +V+ L+++GA I+++  D  TPL  AA  GH   I++L+++   I    K   S +++A +  + D  + ++   ++ +   L H+       PLH+A   G+ ++ ++L+D GA  + +     TP+H+A K      + +L++ S     +   E   TPLH+AA  G+  +++ LL  GA  NA N    + L  A+  G+ + AQ LLQN AQVD+  K   TPL+ A + GH  LV LLL H A+              G  PL  A   GH
Sbjct:   58 MVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNY-GANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLIN------------YGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHL------TPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAV--TESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTA-------GHTPLHIAAREGH 513          

HSP 5 Score: 172.94 bits (437), Expect = 5.882e-43
Identity = 116/362 (32.04%), Postives = 187/362 (51.66%), Query Frame = 1
Query: 1078 LHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNK--SALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            LH A K GH       L  G  + A T  G +ALH+AA  G  ++V  LV++ AN N  +    +PL+ AA++NH++VV++L+E GA+      D +TPL +A   GH   + LL      IN   KG     AL++A  +  +     ++ ++    +L    F    PLHIA    N  + Q+L++ GA  +   +   TP+H+A++ G   +V++L++R  Q  I  + +D  TPLH AA++G+ ++I++LL +GA   A+  N LS +  AA   ++   + LLQ  A++D +    +TPL++A   GH R+  +LL   A  + R        L G  PL  A    H +    +LK
Sbjct:   47 LHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALL------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFT---PLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQ--IDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARA-------LNGFTPLHIACKKNHMRSMDLLLK 390          

HSP 6 Score: 136.346 bits (342), Expect = 1.103e-31
Identity = 94/307 (30.62%), Postives = 156/307 (50.81%), Query Frame = 1
Query: 1240 NFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTP-MHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            N N+ N+     LH A+++ HVK+V  L+  G ++E+      T L IAA  G  + +  L+    ++N       S LY+A + ++ +  K ++  ENG     +P   G  PL +A + G+E +V +LI+ G    V     R P +H+AA+   T    +L++      ++   +   TPLH+AA      V QLLLN GA+ N    N ++ L  A+ +GN+   ++LL  GAQ+D+  K ++TPL+ A +NGH R++ +LL+H A I  +          G +P+  A    H  C   +L+
Sbjct:   35 NINIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLL--ENGAN-QSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVL--SKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTK-------NGLSPIHMAAQGDHMDCVRQLLQ 324          

HSP 7 Score: 99.3673 bits (246), Expect = 2.108e-20
Identity = 80/257 (31.13%), Postives = 124/257 (48.25%), Query Frame = 1
Query: 1360 DSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVER-SKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNG 2127
            D+ T  L AA  G+ +     +KN  +IN+  +   + L+LA +  +    K ++   +    L     KGN  LHIA   G EK+V  L++ GA  + ++ +  +P+++AA+     +VK L+E  + QSL     ED  TPL +A + G+  V+ LL+NYG     R    L AL  AA   + + A VLLQN    D + K   TPL++A    +  +  LLL   A+++         P  G  PL  A   G
Sbjct:    9 DAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGH---VKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSL---PTEDGFTPLAVALQQGHENVVALLINYGTKGKVR----LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNF-------TPKNGITPLHIASRRG 248          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 215.312 bits (547), Expect = 5.307e-56
Identity = 177/622 (28.46%), Postives = 293/622 (47.11%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----------LHI-------------------PD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISM 2058
            +H  +  G  E +  L+K+        +N    +  +PL+ AA+ NHL+ V+ L+E    N +   E+  TP+  A +          N   S   E+ TK  +            +    I   K  TK+ A++L       N ++Q   G TP+H AA  GN  VA   L +   +D   ++   +TPLH+A    +  + ++LL   + +  +   G  P H A   G+   V++L++K          L A  ++  +PLH A +  H +  K  L+  A V+ VT    +ALH+AAH G   + KLL+   AN N       TPLH A +KN VKV++ L++ GA I++      TP+ +AA  GH   + LL++N    +V+    +++L++A     ++  + ++   NG  +          LHI                   PD     G  PLHI+ R+G  +   +L++AGA   +  ++  TP+H+ +K+G   + K+L++R  Q+      ++  TPLH+AA     KV  LLL+ GA  +    N  + L  AA K  +  A VLLQ GA+ +++ K  +TPL+LA + GH  +  LL+   A I++
Sbjct:  117 LHISSLAGQAEVVKTLVKRGAD-----INAQSQNGFTPLYMAAQENHLDVVRYLLENG-GNQSTATEDGFTPLAIALQQ-------GHNQVVSILLENDTKGKV-----------RLPALHIAARKDDTKSAALLL---QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG--ITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAP-------LLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLL--RNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQR--QAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINV 698          

HSP 2 Score: 214.927 bits (546), Expect = 8.082e-56
Identity = 166/617 (26.90%), Postives = 294/617 (47.65%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNG 2127
            +H  AR+ D +  + L+ QN   A    ++      +PLH AA + ++    +L+   +A V+      +TP+H A++               R N +  +L L     +++ T +    L    ++   + A +  L+ KGA    +   G +P+H AA   +    + L+  K P  D+ L   + +T LH+A    H+ + K+LL    N   +   G  P HIAC +  +K++++L+K           +QAV     TP+H A   GH +   + L+ GAS +     G ++LH+AA  G  E+V+ L+   A  +   +  QTPLH A+     ++VQ L++  A  ++   + YTPL I+A  G  ET  +L++     ++  K   + L++  ++   D  K ++  +        PD  G     PLH+A    N+K+  +L+D GA      +   TP+H+AAK  +  I  +L++   ++  + +     TPLHLA++ G+  +  LL++ GA  N    + L+AL  AA +  +  A++L++NGA +D   K   TPL +AC  G+ ++V+ LL++ A ++ +          G  PL  A   G
Sbjct:  212 LHIAARKDDTKSAALLL-QNDHNA----DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASK---------------RGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARS--GHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGAS-------IQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAP------PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQ--GVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTK-------NGYTPLHQAAQQG 780          

HSP 3 Score: 182.956 bits (463), Expect = 5.161e-46
Identity = 127/386 (32.90%), Postives = 199/386 (51.55%), Query Frame = 1
Query:  958 FHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            F  A   GNI  V   +K   D       +   N++    LH A K GH D  +  L++GA V++ T  G +ALH+++  G  E+VK LV   A+ N  ++   TPL+ AA++NH+ VV+YL+E G +  +   D +TPL IA   GH + + +L++N    +   K    AL++A     + +   ++ +++      +    G  PLHIA   GN  +  +L++ GA  D       TP+H+A+K G T +V++L++R  Q  I  +  D  TPLH AA+SG+   +++LL  GA   AR  N LS L  AA   +++  + LLQ+ A VD +    +T L++A   GH R+  LLL   A+ + R        L G  PL  A
Sbjct:   51 FLRAARAGNIDKVLEYLKGGVD-------ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-------LNGFTPLHIA 413          

HSP 4 Score: 159.073 bits (401), Expect = 1.194e-38
Identity = 119/420 (28.33%), Postives = 214/420 (50.95%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTP-LHAAAEKNHVKVVQYLIEK--GADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFK---GNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA--DIS 2055
            +DI   +   +  LHLA    H ++ + LL     +    + G    HI+   G  ++V  L+K+  D       + A +++  TPL+ A +  H D  +  LE G + +  T  G + L +A  QG  ++V +L+      N T   ++ P LH AA K+  K    L++    AD++S+    +TPL IAA YG+     LL+     ++ T +   + L++A +   ++  + ++  + G ++    D K   G  PLH A R G+E  V++L++ GA    + +   +P+H+AA+      VK L++   ++ + D   D  T LH+AA  G+ +V +LLL+  A+ NAR  N  + L  A  K  +K  ++L++ GA + ++ ++ +TP+++A   GH  +V LLL++ A  D+S
Sbjct:   71 VDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGAD-------INAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLL--DRGSQI----DAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQH--KAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVS 468          

HSP 5 Score: 150.214 bits (378), Expect = 6.497e-36
Identity = 130/507 (25.64%), Postives = 218/507 (43.00%), Query Frame = 1
Query:  241 YRLSRII----SGTNHRSIDN---MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK--ARKIDFNHK--NSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL 1728
            YR+++++    +  N R+++    +H   ++  V+ +  L+K         +  +    ++P+H AA   HL  V +L++   A+ +V N    T +H AAR  +    R +  N    ++R  E  T L++A              RL + E        ++  L+   A+P+   T G TP+H +A  G    A  L++       L   +  TPLH+   +   ++AK+LL          + G  P H+A    N K+  +L+ K       +K       +  TPLH A K    D A V L+ GA  NA+T  G + LHLA+ +G  +M  LL+S  A  NV  K   T LH AA+++ V V + L+  GA+++ +    YTPL++A  YG+ + +  L++N   +N   K                                     G  PLH A + GN  I+ +L+  GA  +       T + +A + G   +V  L
Sbjct:  386 YRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYG-----ASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNG-ASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIAS-------------RLGKTE--------IVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLE-AGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAK-------NGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTK------------------------------------NGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 6 Score: 54.6842 bits (130), Expect = 9.231e-7
Identity = 47/158 (29.75%), Postives = 68/158 (43.04%), Query Frame = 1
Query: 1771 DSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL---------------------------TGCNPLDAAIDNGHRQCALAILKSD 2163
            DSNT    AA++G    +   L  G D +  N N L+AL  AA +G++   Q LL  GA VDS  K   T L+++   G   +V  L+K  ADI+ + + +   PL                            G  PL  A+  GH Q    +L++D
Sbjct:   46 DSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQ-SQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEND 202          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 215.312 bits (547), Expect = 5.403e-56
Identity = 177/622 (28.46%), Postives = 293/622 (47.11%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKL----------LHI-------------------PD---FKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISM 2058
            +H  +  G  E +  L+K+        +N    +  +PL+ AA+ NHL+ V+ L+E    N +   E+  TP+  A +          N   S   E+ TK  +            +    I   K  TK+ A++L       N ++Q   G TP+H AA  GN  VA   L +   +D   ++   +TPLH+A    +  + ++LL   + +  +   G  P H A   G+   V++L++K          L A  ++  +PLH A +  H +  K  L+  A V+ VT    +ALH+AAH G   + KLL+   AN N       TPLH A +KN VKV++ L++ GA I++      TP+ +AA  GH   + LL++N    +V+    +++L++A     ++  + ++   NG  +          LHI                   PD     G  PLHI+ R+G  +   +L++AGA   +  ++  TP+H+ +K+G   + K+L++R  Q+      ++  TPLH+AA     KV  LLL+ GA  +    N  + L  AA K  +  A VLLQ GA+ +++ K  +TPL+LA + GH  +  LL+   A I++
Sbjct:  102 LHISSLAGQAEVVKTLVKRGAD-----INAQSQNGFTPLYMAAQENHLDVVRYLLENG-GNQSTATEDGFTPLAIALQQ-------GHNQVVSILLENDTKGKV-----------RLPALHIAARKDDTKSAALLL---QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG--ITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAP-------LLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLL--RNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQR--QAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINV 683          

HSP 2 Score: 214.927 bits (546), Expect = 8.373e-56
Identity = 166/617 (26.90%), Postives = 294/617 (47.65%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLM--KLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNG 2127
            +H  AR+ D +  + L+ QN   A    ++      +PLH AA + ++    +L+   +A V+      +TP+H A++               R N +  +L L     +++ T +    L    ++   + A +  L+ KGA    +   G +P+H AA   +    + L+  K P  D+ L   + +T LH+A    H+ + K+LL    N   +   G  P HIAC +  +K++++L+K           +QAV     TP+H A   GH +   + L+ GAS +     G ++LH+AA  G  E+V+ L+   A  +   +  QTPLH A+     ++VQ L++  A  ++   + YTPL I+A  G  ET  +L++     ++  K   + L++  ++   D  K ++  +        PD  G     PLH+A    N+K+  +L+D GA      +   TP+H+AAK  +  I  +L++   ++  + +     TPLHLA++ G+  +  LL++ GA  N    + L+AL  AA +  +  A++L++NGA +D   K   TPL +AC  G+ ++V+ LL++ A ++ +          G  PL  A   G
Sbjct:  197 LHIAARKDDTKSAALLL-QNDHNA----DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARNGITPLHVASK---------------RGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARS--GHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL---DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVK-------YGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAP------PDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQ--GVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTK-------NGYTPLHQAAQQG 765          

HSP 3 Score: 183.341 bits (464), Expect = 4.438e-46
Identity = 127/386 (32.90%), Postives = 199/386 (51.55%), Query Frame = 1
Query:  958 FHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAA 2115
            F  A   GNI  V   +K   D       +   N++    LH A K GH D  +  L++GA V++ T  G +ALH+++  G  E+VK LV   A+ N  ++   TPL+ AA++NH+ VV+YL+E G +  +   D +TPL IA   GH + + +L++N    +   K    AL++A     + +   ++ +++      +    G  PLHIA   GN  +  +L++ GA  D       TP+H+A+K G T +V++L++R  Q  I  +  D  TPLH AA+SG+   +++LL  GA   AR  N LS L  AA   +++  + LLQ+ A VD +    +T L++A   GH R+  LLL   A+ + R        L G  PL  A
Sbjct:   36 FLRAARAGNIDKVLEYLKGGVD-------ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA-------LNGFTPLHIA 398          

HSP 4 Score: 159.073 bits (401), Expect = 1.261e-38
Identity = 119/420 (28.33%), Postives = 214/420 (50.95%), Query Frame = 1
Query:  820 IDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTP-LHAAAEKNHVKVVQYLIEK--GADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFK---GNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNA--DIS 2055
            +DI   +   +  LHLA    H ++ + LL     +    + G    HI+   G  ++V  L+K+  D       + A +++  TPL+ A +  H D  +  LE G + +  T  G + L +A  QG  ++V +L+      N T   ++ P LH AA K+  K    L++    AD++S+    +TPL IAA YG+     LL+     ++ T +   + L++A +   ++  + ++  + G ++    D K   G  PLH A R G+E  V++L++ GA    + +   +P+H+AA+      VK L++   ++ + D   D  T LH+AA  G+ +V +LLL+  A+ NAR  N  + L  A  K  +K  ++L++ GA + ++ ++ +TP+++A   GH  +V LLL++ A  D+S
Sbjct:   56 VDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGAD-------INAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLL--DRGSQI----DAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQH--KAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVS 453          

HSP 5 Score: 150.214 bits (378), Expect = 6.469e-36
Identity = 130/507 (25.64%), Postives = 218/507 (43.00%), Query Frame = 1
Query:  241 YRLSRII----SGTNHRSIDN---MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK--ARKIDFNHK--NSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL 1728
            YR+++++    +  N R+++    +H   ++  V+ +  L+K         +  +    ++P+H AA   HL  V +L++   A+ +V N    T +H AAR  +    R +  N    ++R  E  T L++A              RL + E        ++  L+   A+P+   T G TP+H +A  G    A  L++       L   +  TPLH+   +   ++AK+LL          + G  P H+A    N K+  +L+ K       +K       +  TPLH A K    D A V L+ GA  NA+T  G + LHLA+ +G  +M  LL+S  A  NV  K   T LH AA+++ V V + L+  GA+++ +    YTPL++A  YG+ + +  L++N   +N   K                                     G  PLH A + GN  I+ +L+  GA  +       T + +A + G   +V  L
Sbjct:  371 YRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYG-----ASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNG-ASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIAS-------------RLGKTE--------IVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLE-AGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAK-------NGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTK------------------------------------NGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 6 Score: 54.6842 bits (130), Expect = 9.378e-7
Identity = 47/158 (29.75%), Postives = 68/158 (43.04%), Query Frame = 1
Query: 1771 DSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPL---------------------------TGCNPLDAAIDNGHRQCALAILKSD 2163
            DSNT    AA++G    +   L  G D +  N N L+AL  AA +G++   Q LL  GA VDS  K   T L+++   G   +V  L+K  ADI+ + + +   PL                            G  PL  A+  GH Q    +L++D
Sbjct:   31 DSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQ-SQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEND 187          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 214.927 bits (546), Expect = 7.212e-56
Identity = 170/585 (29.06%), Postives = 281/585 (48.03%), Query Frame = 1
Query:  373 VNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRK---ARKIDFNHKNSRQNESGTK----LNLADVGTLNSAT--------EEMQKRLIEEEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKL-PEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGN---FPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADI 2052
            VN       +PL+ AA+ NHLE VK L+E   AN ++P E+  TP+  A +   +   A  I +  K   +  + T     L++     L+ A         + +  R   +E TP    A      +I  L+  GA    +   G +P+H AA   +    +QL++   EID    D+  +TPLH+A    H  +AK+LL        +   G  P HIAC + +++++D+L+K S         ++AV     TPLH A   GH +  K+ L+KGAS +A      + LH+A+  G  E+ + L+   A  +   K  QTPLH AA   H ++V+ L+E  A+  S     ++PL IAA  GH +T++LL+          K   + L++A ++   D  + ++  E G      P+  G     PLH+A    N  +V +L+  G           T +H+AAK  +  +   L++    +    E     TPLHLA++ G P ++ LL++  A+ N  N + L+ L   A +G++  A +L++ GA V +  +   TPL++AC  G+ ++V  LL+  A++
Sbjct:   99 VNAQSQKGFTPLYMAAQENHLEVVKFLLENG-ANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDH--LTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSAS-------IEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLL--ERGAN----PNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANA--ESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANV 665          

HSP 2 Score: 183.341 bits (464), Expect = 3.459e-46
Identity = 140/537 (26.07%), Postives = 250/537 (46.55%), Query Frame = 1
Query:  526 YRRKARKIDFNHKNSRQNESGTKLNLADVGTLNS---ATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKS-------------------------------EDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLL 2034
            + R AR  + + K     ++G  +N A+   LN+   A++E   +++ E      +N ++L   +K  N         T +H AA+ G E    +L+     ++  +  +  TPL++A   NH E+ K LL +  N     E G  P  +A  +G+  +V +LI                                  E+ +    +L     D  TPLH A +NGH    ++ L+ GA + A T  G S +H+AA    ++ VK L+ + A  +       TPLH AA   H ++ + L++KGA   SR ++ +TPL IA    H   + LL+K+   I    +   + L++A    + +  K ++         ++   K   PLH+A R G+ ++ + L+   A  D K ++++TP+H AA+ G   +VK+L+E              ++PLH+AA+ G+ + ++LLL+  A +        + L  A+  G +  A++LL+ GA  ++  K  +TPL++A  + +  +V LL+
Sbjct:   11 FLRAARSGNLD-KALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLE----LLHNGIVLETTTKKGN---------TALHIAALAGQEQVVTELVNY-GTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNV---KVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANP--NSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLV 527          

HSP 3 Score: 172.555 bits (436), Expect = 7.178e-43
Identity = 151/550 (27.45%), Postives = 253/550 (46.00%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR---YRRKARKIDFNHK-NSRQNESGTKLNLA---------DVGTLNSATEEMQKRLIEEEKTPTKNNA------VILYLVSKGANPNIQDTYGCTPMHYAAMRGN-EVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEE---------------RTPMHLAAKFGRTYIVKILVERSKQSL--------------IIDEDEDSNTPLHL 1794
            +H  AR G    +  L+        K  N      +SP+H AA+ +H++CVK L++  +A ++    + +TP+H AA    +R     +D   K NSR     T L++A         D+   +SA+ E    + E   TP    +      ++  L+ KGA+P+  +    TP+H A+  G+ EVA   L     +D K KD++  TPLH A    H E+ K+LL    N       G  P HIA  EG+++ V +L+     Q +++K      + + TPLH A K G  D A++ LE+GA+ NA    G + LH+A H  ++++V LLVS   + +   +   T LH AA++N V+V   L++ GA   +  +   TPL +A+  G  + + LL+    ++N+  K   + L+L  +  +      ++        ++     G  PLH+AC  GN K+V+ L+   A  + K   E                TP+H     G   ++ +L   +++++              I+D  ED  T L +
Sbjct:  214 LHCAARNGHFRIIEILLDNGAPIQAKTKN-----GLSPIHMAAQGDHMDCVKQLLQ-YNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEA---VTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQ--TPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTK------KGF-TPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGAS---VYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVLKLVTEETVSMKHRMSFPETVDEILDVSEDEGTALRI 742          

HSP 4 Score: 154.066 bits (388), Expect = 3.817e-37
Identity = 105/351 (29.91%), Postives = 184/351 (52.42%), Query Frame = 1
Query: 1045 LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLL-------------MKNHC-DINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADIS 2055
            +   N++    LH A K GH       L  G  +   T  G +ALH+AA  G  ++V  LV++  N N  ++   TPL+ AA++NH++VV++L+E GA+      D +TPL +A   GH   + LL             + + C  ++VT     + L++A  +   +  + +++     +L          PLH A R+G+ +I++IL+D GA    K +   +P+H+AA+      VK L++ + +  I D   D  TPLH+AA  G+ ++ ++LL+ GA  N+R  N  + L  A  K +L+   +LL++ A ++++ ++ +TPL++A   GH  +V +LL+  A  S
Sbjct:   33 INTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVT---GFTPLHIAAHYENLNVAQLLLNRGANDELT---------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAE--IDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPS 369          

HSP 5 Score: 152.91 bits (385), Expect = 7.792e-37
Identity = 110/356 (30.90%), Postives = 182/356 (51.12%), Query Frame = 1
Query: 1087 AVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIIS-DENGK-KLLHIPDF------KGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGH 2130
            A ++G+ D A   ++ G  +N     G +ALHLA+ +G ++MV  L+        T K   T LH AA     +VV  L+  G ++ ++    +TPL +AA   H E +K L++N  + ++  +   + L +A++  + +    +IS    GK +L  + DF       G  PLHIA    N  + Q+L++ GA D      E TP+H AA+ G   I++IL++    + I  + ++  +P+H+AA+  +   ++ LL Y A+ +    + L+ L  AA  G+ + A+VLL  GA+ +S      TPL++ACK  H R++ LLLKH+A I            +G  PL  A   GH
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAND------ELTPLHCAARNGHFRIIEILLDNG--APIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTE-------SGLTPLHVASFMGH 354          

HSP 6 Score: 102.064 bits (253), Expect = 2.859e-21
Identity = 79/277 (28.52%), Postives = 129/277 (46.57%), Query Frame = 1
Query: 1360 DSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNAR-----------NCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILK 2157
            D+    L AA  G+ +     +KN  DIN   +   +AL+LA +  +    K ++   +   +L     KGN  LHIA   G E++V  L++ G   + ++++  TP+++AA+     +VK L+E      I    ED  TPL +A + G+  V+ LL++YG     R           +    + L  AA   NL  AQ+LL  GA        ++TPL+ A +NGH R++ +LL + A I  +          G +P+  A    H  C   +L+
Sbjct:    6 DAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGH---VKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSI--PTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGA------NDELTPLHCAARNGHFRIIEILLDNGAPIQAKTK-------NGLSPIHMAAQGDHMDCVKQLLQ 264          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026132.1 (SMESG000026132.1)

HSP 1 Score: 2442.54 bits (6329), Expect = 0.000e+0
Identity = 1218/1219 (99.92%), Postives = 1218/1219 (99.92%), Query Frame = 1
Query:  118 MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK 3774
            MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL ERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYLLSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLPLFFLFIFAFAFAFYILLANQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK
Sbjct:    1 MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYLLSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLPLFFLFIFAFAFAFYILLANQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK 1219          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026132.1 (SMESG000026132.1)

HSP 1 Score: 2414.8 bits (6257), Expect = 0.000e+0
Identity = 1209/1219 (99.18%), Postives = 1209/1219 (99.18%), Query Frame = 1
Query:  118 MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK 3774
            MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKI         NESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKIL ERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYLLSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLPLFFLFIFAFAFAFYILLANQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK
Sbjct:    1 MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISGTNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKI---------NESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYLLSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLPLFFLFIFAFAFAFYILLANQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLK 1210          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000035379.1 (SMESG000035379.1)

HSP 1 Score: 248.825 bits (634), Expect = 3.164e-67
Identity = 283/1107 (25.56%), Postives = 493/1107 (44.53%), Query Frame = 1
Query:  403 PLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR----KARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM--LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSF-----EANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKK----LLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVER-SKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVD----TPMRKLIRKMPDVAEEVF-KKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMV---MVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXX---------XXXXXXXXXXXXXXXXXXNQVTFNS-------------------LLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            P  +AA  N +E  K+++   S  ++  +E  +T +H+AA   R        I    KN+R +   T ++ A    LN+  + +                   YL+  GA+PNI +     P+H    +      ++L++ PE++     +   + +H+AC  ++ E    LL +   +      G  P H+A    N K ++ML++ S+++   S M  L   +++   PLH AV  G   A ++CL  GA ++       + LH A  +G +++VKL++       +    + +    TPLH A   NHV++ +YLIE+G++IE  D + +TPLL+AAS  + E  K L+K   +I   +K  ++ ++L   +  +D    ++  E  ++    +++  D  G  PLH + R G  ++  ILI  G +   +N ++ TP+H AA++GR +  + L+        +   D     P+H AA++G+ K+IQ+LL+ G   + R  +  + L +AAT G+++  Q L++ N + +D+ +    T L+ A  N    +V LLL H A I             G       +   +   A  ++ +++WE  +R         VD     P+  +I+ MP++      K  K   S+     D+ I YNF  L+ + AS          K++ + D                                          P  V   MV   R DLL H + +  L+MKW  FG  V Y  + +Y+ +L +L           L  + +K +  +   C+ +      E +K +  +   I +  ++V L+KE+  +      YF S +N M LV++    +T I +S+    + +      Q  AV+ F+   NL+L +      G+FV+MF  +L T +  L           F   I   A     +L+NQ  FN                    L + +++  VM +GE+EF + + T    Y  +   + Y  +TY    +F++ MS++ MNLL+GLAV DI+AVQ+ A L+R+ +QV+   E EG +P  IR         V+P R
Sbjct:   59 PFQFAAAGNCMEIEKLIIGN-SGIISSSDENGMTMMHYAAANSRIEVMDILMIYRADKNARDSNGNTPIHHA---VLNNEIKALT------------------YLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE-SKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--------KDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVR--------IVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR--GQKDFKIIYNFGILQRTVAS----------KEDLNSD------------------------------------------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHV-DKNISTSAE-CSNIDIFYGHETVKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLH----ITSIILSSYIIRMDINHT-TMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPL--YDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYR 1062          

HSP 2 Score: 100.138 bits (248), Expect = 7.830e-21
Identity = 90/334 (26.95%), Postives = 152/334 (45.51%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKL------KDNESMTPLHLACAHNHFEIAKMLLISSNNLFD-------QEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN 1242
            +H    +G+++ +  +++         + + D +  +PLH A  FNH+E  + L+EE S N+ V ++   TP+  AA R   +  K    +  +      T+ NL  + +LN   +++   L+  EK      ++I          N +D  GCTP+HY+  RG       L++L  I IKL      ++N+  TPLH A  +      + LL    N FD        +  G +P H A   G+ K++ ML+ +              +R Y   TPLHYA  NGH +  +  +E   S ++   + G++ALH AA      +V LL++  A+
Sbjct:  300 LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGS-NIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVN-FLMGLEKIQQSFISII----------NEKDNMGCTPLHYSTRRG-------LLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLL----NTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG----------CIFHRCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000035379.1 (SMESG000035379.1)

HSP 1 Score: 248.44 bits (633), Expect = 4.350e-67
Identity = 281/1106 (25.41%), Postives = 491/1106 (44.39%), Query Frame = 1
Query:  403 PLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR----KARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM--LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSF-----EANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKK----LLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVER-SKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVD----TPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMV---MVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXX---------XXXXXXXXXXXXXXXXXXNQVTFNS-------------------LLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNR 3561
            P  +AA  N +E  K+++   S  ++  +E  +T +H+AA   R        I    KN+R +   T ++ A    LN+  + +                   YL+  GA+PNI +     P+H    +      ++L++ PE++     +   + +H+AC  ++ E    LL +   +      G  P H+A    N K ++ML++ S+++   S M  L   +++   PLH AV  G   A ++CL  GA ++       + LH A  +G +++VKL++       +    + +    TPLH A   NHV++ +YLIE+G++IE  D + +TPLL+AAS  + E  K L+K   +I   +K  ++ ++L   +  +D    ++  E  ++    +++  D  G  PLH + R G  ++  ILI  G +   +N ++ TP+H AA++GR +  + L+        +   D     P+H AA++G+ K+IQ+LL+ G   + R  +  + L +AAT G+++  Q L++ N + +D+ +    T L+ A  N    +V LLL H A I             G       +   +   A  ++ +++WE  +R         VD     P+  +I+ MP++      K  +         D+ I YNF  L+ + AS          K++ + D                                          P  V   MV   R DLL H + +  L+MKW  FG  V Y  + +Y+ +L +L           L  + +K +  +   C+ +      E +K +  +   I +  ++V L+KE+  +      YF S +N M LV++    +T I +S+    + +      Q  AV+ F+   NL+L +      G+FV+MF  +L T +  L           F   I   A     +L+NQ  FN                    L + +++  VM +GE+EF + + T    Y  +   + Y  +TY    +F++ MS++ MNLL+GLAV DI+AVQ+ A L+R+ +QV+   E EG +P  IR         V+P R
Sbjct:   24 PFQFAAAGNCMEIEKLIIGN-SGIISSSDENGMTMMHYAAANSRIEVMDILMIYRADKNARDSNGNTPIHHA---VLNNEIKALT------------------YLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE-SKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--------KDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVR--------IVDENGICPVIGMIKDMPNILSLAMDK-SIKTEGSRGQKDFKIIYNFGILQRTVAS----------KEDLNSD------------------------------------------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHV-DKNISTSAE-CSNIDIFYGHETVKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLH----ITSIILSSYIIRMDINHT-TMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPL--YDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYR 1027          

HSP 2 Score: 99.7525 bits (247), Expect = 8.958e-21
Identity = 90/334 (26.95%), Postives = 152/334 (45.51%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKL------KDNESMTPLHLACAHNHFEIAKMLLISSNNLFD-------QEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN 1242
            +H    +G+++ +  +++         + + D +  +PLH A  FNH+E  + L+EE S N+ V ++   TP+  AA R   +  K    +  +      T+ NL  + +LN   +++   L+  EK      ++I          N +D  GCTP+HY+  RG       L++L  I IKL      ++N+  TPLH A  +      + LL    N FD        +  G +P H A   G+ K++ ML+ +              +R Y   TPLHYA  NGH +  +  +E   S ++   + G++ALH AA      +V LL++  A+
Sbjct:  265 LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGS-NIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVN-FLMGLEKIQQSFISII----------NEKDNMGCTPLHYSTRRG-------LLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLL----NTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG----------CIFHRCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 565          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 231.876 bits (590), Expect = 5.044e-62
Identity = 240/957 (25.08%), Postives = 433/957 (45.25%), Query Frame = 1
Query:  712 KGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDE-LSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAA-----SYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHI---PDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVDTPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNH-PLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNXXXXXXXXXXXXXXMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYFS--LENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATXXXXXXXXXXXXXXXXXXXXXXXXNQVTFNSLLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLT 3546
            K  + +  D  G TP+H A  RG+    + L+K  +  ++  + +S++ +H     N  ++ K+L+   + L  +   G  P  +A  EG+ ++ D+L+ + + Q E +  +L   + D  + L +AV+N + +  K+C+     ++A    G++  H AA  G  E+  L+ +   + N+T+  + TP+H A   N++K+V+ L++KGA+I   +    TP+++A      S    E IK L + + ++ + +   K+  +  +E    +  +      N + LL +    D   N PLH A + GN +I QIL+ AGA   + ++ +   +H+A   G    V IL+E SK++     D + N+ ++LAA++G  ++ + L++ G DK +++    + L FAA  G L   + LL +   ++  D+ K T L+ A + GH  +V LL K  A +S        + + G   LD AI N         L ++ W+  +  + ++  G++    + LI+   ++  E+  KC + N  +    +Y I + F  L+                                                      +DK  I K +  L  M    + DLL H +   LL+ KWN FGL  Y  +  +YL +L+ +  YM    P     + +     + S C Q    +  ++L          +V+M  +       QL L     FS  +   ME+  Y+     ++     +  + +   ++WQ      F+    L+ ++R  P+ GI V+MF  VL + I+   +FF     F F FYI+ ++Q  F +    II++  M IGELE  S F T  + Y           V+Y +   F+++M I   NL++GLAV DI  V  +A LE + ++V    E+E  +P   +R   + ++T
Sbjct:  137 KSTHIDAADVKGQTPLHTACRRGHLNVVKILLKY-QASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEASKETSYY-RDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGAKLS--------EDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHI----KVLIKYNEEITLELLDKCIIENMSNVMDPNYEIKFWFGILDSG---------------------------------------------------PDDKASISKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFLICINVYMSIYTP-----MTDTDSYTSYSGCKQTNSSVSSDKLDAPVG-----VVLMNSLIYAIITGQLLLLLLKLFSQRIRFFMEVWNYIFITNDILVFFFIKNPLQLPCLYEWQFAPGLIFVVWFLLLYYMRFFPYIGIQVMMFQKVLVSIIKAFAIFFGLFVGFGFGFYIINSSQDPFKTQGLGIIKSIAMMIGELEIVSYFVTGKKNYAN---------VSYAMIVCFMIIMPITFFNLMIGLAVGDISNVNAEAELEMIKLRVNFVWEMESQLPVRWQRILYVSEIT 1009          

HSP 2 Score: 133.65 bits (335), Expect = 3.482e-31
Identity = 147/610 (24.10%), Postives = 280/610 (45.90%), Query Frame = 1
Query:  292 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR-KARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGN----EVAAEQLMKLPEIDIKL---KDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAA-----HQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGAD------IESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRV 2064
            +H    E   + +SFL+   P      VN++  +K+ P+H AA+  H+E V++L +  S +++  + +  TP+H A R       KI   ++ S Q     KL L  +  ++         +++              LV+ G+  N+++  G TP+  AA+ G+    ++   ++ K  E  I +   KDN+  + L  A  + + EI K+ + ++ +L  ++  G   FH A   G  ++ D++       +  S  L   + +  TP+H+A+ N +    K+ L+KGA++N      ++ + LA       + + E++K L    AN  + +  M+T  H   EK ++++++Y  +          I S+D    +PL  AA  G+ E  ++L+K   D  +  + +  AL++A    + D    II  E  K+  +  D   N  +++A  +G  +I + L+D G     K++  R  +  AAK G   IV+ L+  + +  I   D+  +T LH AA+ G+  +++LL   GA K + +    + LD A         +  L N      M+           +NGH   + +L+K+N +I++ +
Sbjct:   85 LHYACLENHKDIVSFLLIFKPD-----VNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQ-----KLELDSISVMHHPVRRNDTDMVK-------------VLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLI-------ETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDC--VIILLEASKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLL--NDEVNINLYDQMKSTALHQAAERGHLDIVKLLWKQGA-KLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMN--------FRHQNGHGH-IKVLIKYNEEITLEL 650          

HSP 3 Score: 75.485 bits (184), Expect = 2.130e-13
Identity = 56/188 (29.79%), Postives = 93/188 (49.47%), Query Frame = 1
Query: 1474 LYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFP-LHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLL 2034
            L+ AV+H Y    +++      K+ L++ D K NF  LH AC + ++ IV  L+      +V    +  P+HLAA+ G   IV++L  + K + I   D    TPLH A + G+  V+++LL Y A       + +S +     + +    +VL+  G+ ++  +    TPL +A   GH  L  LLL
Sbjct:   49 LFHAVQHGYLQFLQSVPLKVWAKR-LNVIDEKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLC-KYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLL 234          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPA14.634e-10328.26transient receptor potential cation channel subfam... [more]
TRPA13.241e-9728.14transient receptor potential cation channel subfam... [more]
ANK18.068e-6229.86ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK19.661e-6229.86ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK11.082e-6129.86ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa-11.445e-14331.82Transient receptor potential cation channel subfam... [more]
trpa-12.486e-14331.82Transient receptor potential cation channel subfam... [more]
unc-441.060e-5928.16AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.060e-5928.16AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.120e-5928.16AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrpA15.751e-7925.71gene:FBgn0035934 transcript:FBtr0331823[more]
TrpA15.921e-7925.63gene:FBgn0035934 transcript:FBtr0331824[more]
TrpA16.985e-7927.19gene:FBgn0035934 transcript:FBtr0331825[more]
TrpA11.057e-7827.09gene:FBgn0035934 transcript:FBtr0331826[more]
Ank23.785e-5628.95gene:FBgn0261788 transcript:FBtr0303119[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b2.763e-10227.40transient receptor potential cation channel, subfa... [more]
trpa1b2.763e-10227.40transient receptor potential cation channel, subfa... [more]
trpa1a2.470e-10027.33transient receptor potential cation channel, subfa... [more]
trpa1b4.991e-9927.08transient receptor potential cation channel, subfa... [more]
ank1b5.326e-6629.94ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa12.940e-11428.76transient receptor potential cation channel, subfa... [more]
trpa11.347e-10828.63transient receptor potential cation channel, subfa... [more]
trpa19.528e-10728.48transient receptor potential cation channel, subfa... [more]
trpa13.136e-10527.85transient receptor potential cation channel, subfa... [more]
trpa15.523e-10529.91transient receptor potential cation channel, subfa... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpa11.937e-9526.40transient receptor potential cation channel, subfa... [more]
Trpa12.867e-8825.96transient receptor potential cation channel, subfa... [more]
Ank13.544e-6128.13ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank24.685e-6128.38ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank28.810e-6128.38ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18297|TRPA1_CAEEL1.838e-14231.82Transient receptor potential cation channel subfam... [more]
sp|O75762|TRPA1_HUMAN2.225e-10228.26Transient receptor potential cation channel subfam... [more]
sp|Q8BLA8|TRPA1_MOUSE1.355e-9426.40Transient receptor potential cation channel subfam... [more]
sp|Q6RI86|TRPA1_RAT7.621e-9426.31Transient receptor potential cation channel subfam... [more]
sp|Q7Z020|TRPA1_DROME7.002e-7827.19Transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210R3P20.000e+042.97Transient receptor potential cation channel subfam... [more]
A0A1S3J6X30.000e+040.69transient receptor potential cation channel subfam... [more]
A0A3T1DFU10.000e+041.88Transient receptor potential cation channel subfam... [more]
A0A1S3J6I30.000e+039.67transient receptor potential cation channel subfam... [more]
A0A3S1HED00.000e+040.80ANK_REP_REGION domain-containing protein OS=Elysia... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1a8.893e-10627.10transient receptor potential cation channel subfam... [more]
trpa1b3.476e-10326.94transient receptor potential cation channel subfam... [more]
trpa1b7.836e-10326.63transient receptor potential cation channel subfam... [more]
trpa1b7.836e-10326.63transient receptor potential cation channel subfam... [more]
trpa1a1.959e-9926.83transient receptor potential cation channel subfam... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.18.036e-6428.47pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.694e-6227.79pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000003991.12.794e-5529.11pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007446.13.824e-5530.18pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.19.184e-4930.56pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS64.916e-1625.97Evolutionarily conserved 19S regulatory particle a... [more]
PHO811.073e-1225.25Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
GDE19.892e-1226.36Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
HOS47.028e-1133.33Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR15.329e-1026.75Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387026.782e-7736.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273542.203e-3125.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387011.229e-2936.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331806.699e-2923.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391122.236e-2631.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b8.899e-9527.20transient receptor potential cation channel subfam... [more]
ank1b3.053e-6529.61ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000031565.15.307e-5628.46ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.15.403e-5628.46ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1a7.212e-5629.06ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026132.10.000e+099.92SMESG000026132.1[more]
SMESG000026132.10.000e+099.18SMESG000026132.1[more]
SMESG000035379.13.164e-6725.56SMESG000035379.1[more]
SMESG000035379.14.350e-6725.41SMESG000035379.1[more]
SMESG000078033.15.044e-6225.08SMESG000078033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017971 ID=SMED30017971|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3893bp
CCTTGACAAAATGGGGAATATTTAACTTTTTGAAATTATTTTGTTTTTAT
CCTAACGAATTCAGCTGAAGATTGATAAATATATAAAATATTTTCGTTAT
AGTTGAGATAATAATTAATGTCAGAAACTCCTACAAAATATCCACAAAGG
AAACACGTGTTCGGTAATAAATATGAAAATAGATATCTAAGTGAATACGA
AATGGTTGATTCCAACTTGCCTGAAGCTAACAATGAGTCGTATCGACTAA
GTCGAATAATTTCAGGCACGAATCATCGTTCAATTGATAATATGCACAAA
TTTGCCAGAGAGGGCGACGTGGAACAGCTCAGTTTCCTCATTAAACAAAA
TCCGCGAAAAGCAAAGAAATGTGTTAATCTGTTAGACATTGACAAAATGT
CACCGCTTCATTATGCGGCTCGTTTCAACCATTTGGAATGTGTCAAAATA
TTGGTCGAAGAAGCGTCGGCTAATGTCAATGTTCCGAACGAAGAGCGAGT
TACTCCGATCCATTTTGCAGCTAGATATCGACGGAAAGCAAGAAAAATTG
ATTTTAACCACAAAAACTCTAGGCAGAATGAATCTGGCACTAAATTGAAT
TTGGCCGATGTTGGTACATTGAATTCTGCTACCGAAGAAATGCAAAAGAG
ACTGATTGAAGAAGAAAAGACACCAACCAAAAACAATGCAGTCATTCTCT
ATTTGGTATCAAAAGGGGCAAATCCGAATATTCAAGATACCTACGGATGT
ACACCAATGCATTATGCAGCAATGAGAGGAAATGAAGTTGCTGCCGAGCA
ATTAATGAAGCTGCCAGAAATAGATATTAAATTGAAGGATAATGAATCCA
TGACCCCTCTACACCTGGCCTGTGCCCACAATCATTTTGAAATTGCTAAA
ATGTTACTGATCAGTTCAAACAATTTATTTGACCAAGAAGAAACAGGTTG
CATTCCATTCCACATTGCATGTGGAGAAGGAAATATAAAAATGGTTGACA
TGCTGATTAAGAAATCCGAAGATCAGGATGAACTAAGTAAAATGCTTCAA
GCCGTGAACCGAGACTACAAGACACCTCTGCACTACGCAGTTAAGAATGG
TCATTGTGATGCCGCAAAGGTTTGTTTGGAAAAAGGAGCTTCTGTCAATG
CTGTGACATATACCGGAAGAAGTGCTCTCCATTTGGCGGCGCATCAAGGC
AGTATTGAAATGGTGAAATTGCTCGTTTCTTTTGAAGCAAATTTCAATGT
CACAAACAAACTAATGCAAACTCCATTGCACGCCGCTGCTGAGAAAAACC
ACGTGAAAGTTGTCCAGTATTTAATCGAAAAAGGTGCTGATATAGAGAGT
CGGGATATAGATTCCTACACTCCGCTCTTGATTGCTGCCTCGTATGGGCA
CTGTGAGACAATCAAATTACTAATGAAAAATCATTGCGACATAAATGTCA
CAGAAAAGGGCAACAAAAGTGCGCTGTATTTGGCCGTGGAACACTCCTAT
TCCGATGCTACAAAAACAATTATTAGTGATGAAAATGGAAAAAAATTGTT
GCACATTCCCGATTTTAAAGGTAATTTCCCTTTGCATATTGCCTGCAGAG
ATGGTAATGAAAAAATTGTCCAAATATTGATTGATGCTGGTGCAATAGAC
GACGTTAAAAACGAAGAAGAACGTACACCGATGCATTTAGCGGCGAAGTT
CGGTCGAACATACATAGTGAAAATACTTGTGGAAAGATCAAAACAATCCC
TTATTATTGACGAAGACGAAGACTCTAATACGCCTCTGCATCTTGCTGCT
AAAAGCGGCTATCCAAAAGTCATTCAATTGCTCCTGAATTACGGGGCTGA
CAAAAATGCCAGAAATTGTAACAAATTATCAGCATTAGATTTCGCTGCCA
CAAAAGGTAATTTAAAGGCTGCACAAGTCCTTTTGCAAAATGGCGCTCAA
GTCGATTCTATGGATAAAGCAAAGATTACGCCATTATATTTGGCTTGCAA
GAATGGGCACGACCGCCTTGTTACGTTACTTCTCAAACACAATGCAGATA
TTTCGATGCGAGTAGCCGGAGACGCCAATGATCCCCTGACAGGATGTAAC
CCATTAGATGCTGCTATAGACAACGGCCATAGACAATGTGCTCTTGCAAT
TCTTAAATCAGATAAATGGGAAATCGCATTGCGAAATCAAACAAAATCTT
TGAAGGGTTACGTCGACACGCCAATGAGAAAACTGATACGAAAAATGCCT
GATGTCGCAGAGGAAGTTTTCAAAAAATGTAAAGTATCTAATAGTAAACA
TCCCGATCACATCGACTATGCGATAACATACAATTTCGAATTCCTTGAAG
ATTCATATGCATCTTGGGGTATGAACCATTTTGTAGAAAATGTGAAAAAA
GAATTCGACGTTGACGATGAGTCCGAGAGTGCTAGTGTCATATTAGATAC
AGTTTCTCTAGAAACTTATGATGAAAATGAGAAATTATGTCCAACTGCTC
GACTATATACCGAAGATAAAAAGATGATTTTGAAAAATCATCCTTTGATG
GTCATGGTTAGAAAACGGAGAGAAGATCTGCTGGATCATCATATTGTGTC
GAATTTATTGAGAATGAAATGGAATAATTTTGGTTTGGTCGTTTATTATT
GTAATTTAGCGATATATTTATGCTATCTCTTGTCTTTGCTCACCTATATG
ATTGAAGCTGAGCCTCCATACCTCTATTTTATAAGAAACAAAACTGTGGG
CCTTAATGGATCAATTTGTGCCCAGGTAAAGCAAATATTAGTGAAAGAAA
GATTGAAACATAGTGCAGAAATATGTAAATATATTATCGTAGTAATGACA
GTTGTTGGATTGGTGAAAGAGGCAGCTCAACTCTGTCTAAATCGTGCCAA
TTACTTTAGTTTGGAAAACATAATGGAATTGGTTATGTACGTGTTAGCAT
TTGTCACGGTGATTGACGTATCTACCTGTCAAACGGAAATAGGTGTAAGA
GAGCCTTGGCAGTGGCAAACTGGAGCCGTCTCAGCTTTTATGAGCATCAT
GAATTTAGTTTTATTCATAAGAAAAGTTCCGTTCTTTGGAATATTCGTCG
TAATGTTTACAGATGTTTTAGCGACATTTATTAGATTTTTACCGTTATTT
TTCCTGTTTATTTTTGCTTTTGCGTTCGCATTCTATATCCTATTGGCTAA
TCAAGTGACTTTTAATAGTCTTCTCAATTCCATCATTCAAACAACGGTCA
TGACCATTGGTGAATTGGAATTCGATAGTATTTTTAATACTCAATGGGAA
GAATATCCTCCTGATAATAGATTAATATTTTATGATGTTGTAACATATAC
AATCTTCGGGATCTTTCTTTTAATGATGAGCATCATCACAATGAATCTCC
TGGTTGGTCTAGCGGTTGATGATATAAAAGCTGTTCAAGAAAAAGCAACT
TTAGAAAGAATGGGAATGCAAGTTACATTGGCACTTGAAGTTGAAGGTCT
CGTCCCAGAATTCATCCGACGTCGATATATCATCCGAAAGCTGACCGTTT
ATCCAAACAGAGAAAGCAGCATATATAAAACATTGTTTGGGATTGGTAGA
GAAGTTCGTCGGCAAATGTGCAAAGATGATCAATTGGATGACATGGAGAG
ATTAAAACTCCATCAAAAGGCAACAACTGAACAATTGACCGAGATGAAGT
TTAAATTGAGAAACCTTCACAGTCAAAATCATTTAATGACAAAAATGCTG
ACAAAAATTGTTAAAAATTTAAAGATCGATTTTGAAGAAGAAGATGTTCA
AGAAGACGACGAAATTTAATAAATTATTTAATTTTAATCAATATTTTTTA
TTCGTTTAATATTGTTTGAACAGAAAATTTTATCTCTGTCAAG
back to top

protein sequence of SMED30017971-orf-1

>SMED30017971-orf-1 ID=SMED30017971-orf-1|Name=SMED30017971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1234bp
MSETPTKYPQRKHVFGNKYENRYLSEYEMVDSNLPEANNESYRLSRIISG
TNHRSIDNMHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYA
ARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKIDFNHKN
SRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKG
ANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHL
ACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKS
EDQDELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTG
RSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQ
YLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNK
SALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKI
VQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILVERSKQSLIIDED
EDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLK
AAQVLLQNGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVA
GDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVD
TPMRKLIRKMPDVAEEVFKKCKVSNSKHPDHIDYAITYNFEFLEDSYASW
GMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTED
KKMILKNHPLMVMVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIY
LCYLLSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILVKERLKHSA
EICKYIIVVMTVVGLVKEAAQLCLNRANYFSLENIMELVMYVLAFVTVID
VSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDV
LATFIRFLPLFFLFIFAFAFAFYILLANQVTFNSLLNSIIQTTVMTIGEL
EFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAV
DDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRES
SIYKTLFGIGREVRRQMCKDDQLDDMERLKLHQKATTEQLTEMKFKLRNL
HSQNHLMTKMLTKIVKNLKIDFEEEDVQEDDEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 350..365
score: 39.72
coord: 568..582
score: 40.84
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 243..272
e-value: 8.3E-4
score: 28.7
coord: 382..411
e-value: 2.4E-5
score: 33.8
coord: 658..688
e-value: 17.0
score: 14.4
coord: 618..647
e-value: 6.4E-4
score: 29.0
coord: 126..205
e-value: 1800.0
score: 3.1
coord: 448..477
e-value: 2000.0
score: 2.8
coord: 552..581
e-value: 7.7E-7
score: 38.7
coord: 276..305
e-value: 0.0098
score: 25.1
coord: 484..515
e-value: 0.02
score: 24.1
coord: 316..345
e-value: 1.2E-5
score: 34.8
coord: 92..122
e-value: 7.7E-6
score: 35.4
coord: 209..239
e-value: 0.16
score: 21.0
coord: 517..547
e-value: 18.0
score: 14.2
coord: 349..378
e-value: 3.1E-5
score: 33.4
coord: 585..614
e-value: 0.8
score: 18.7
coord: 415..444
e-value: 8.6E-4
score: 28.6
IPR002110Ankyrin repeatPFAMPF13606Ank_3coord: 417..444
e-value: 6.3E-4
score: 20.0
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 554..584
e-value: 8.0E-7
score: 29.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 552..584
score: 14.586
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 484..516
score: 12.689
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 382..414
score: 13.971
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 618..650
score: 10.606
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 316..348
score: 11.808
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 415..447
score: 10.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 276..308
score: 9.297
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 243..275
score: 9.831
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 92..125
score: 9.671
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 349..381
score: 13.304
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 585..617
score: 11.06
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 473..619
e-value: 7.9E-41
score: 141.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 263..384
e-value: 6.8E-30
score: 105.7
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 187..262
e-value: 3.1E-21
score: 78.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 32..163
e-value: 1.0E-16
score: 62.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 385..472
e-value: 2.0E-24
score: 88.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 59..299
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 319..676
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 273..345
e-value: 4.0E-10
score: 40.1
coord: 453..539
e-value: 1.4E-11
score: 44.8
coord: 191..265
e-value: 2.9E-12
score: 47.0
coord: 349..413
e-value: 1.6E-14
score: 54.2
coord: 60..139
e-value: 7.6E-9
score: 36.0
coord: 591..681
e-value: 3.6E-10
score: 40.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 92..691
score: 127.342
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 844..1109
e-value: 1.6E-13
score: 50.5
NoneNo IPR availableGENE3DG3DSA:1.25.40.960coord: 620..685
e-value: 1.3E-10
score: 43.2
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 190..472
coord: 60..138
coord: 483..680
coord: 192..303
NoneNo IPR availableTMHMMTMhelixcoord: 1004..1026
NoneNo IPR availableTMHMMTMhelixcoord: 938..960
NoneNo IPR availableTMHMMTMhelixcoord: 975..997
NoneNo IPR availableTMHMMTMhelixcoord: 1074..1096
NoneNo IPR availableTMHMMTMhelixcoord: 840..862