Sphingomyelin phosphodiesterase 4

Overview
NameSphingomyelin phosphodiesterase 4
Smed IDSMED30017968
Length (bp)2493
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sphingomyelin phosphodiesterase 4 (SMED30017968) t-SNE clustered cells

Violin plots show distribution of expression levels for Sphingomyelin phosphodiesterase 4 (SMED30017968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sphingomyelin phosphodiesterase 4 (SMED30017968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sphingomyelin phosphodiesterase 4 (SMED30017968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017968h1SMcG0020602 SmedASXL_006531SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017968h1SMcG0020602 SmedASXL_006531SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020604 Contig29317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020604 Contig29317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020602 Contig29317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020602 Contig29317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020603 Contig29317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020603 Contig29317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020604 Contig45905newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020604 Contig45905uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020602 Contig45905newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017968h1SMcG0020602 Contig45905uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Match: SMPD4 (sphingomyelin phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:32949])

HSP 1 Score: 156.377 bits (394), Expect = 1.204e-38
Identity = 138/509 (27.11%), Postives = 221/509 (43.42%), Query Frame = 3
Query:  126 EDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLY------SKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +D+  +I     +E++T F  +++ IF + + +   W++       N  +   ++EFL P G +  L+ K    D     F+FP+  L    + SI     C+   S LY      + T G   N L LN FEY++F F +S I  K +   L    ++D  Y  LV RYL +FL    + S    L+      S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   +             I  R HR
Sbjct:   69 QDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYK---FDFPVSYLPGPVKASI---QECILPDSPLYHNKVQFTPTGGLGLN-LALNPFEYYIFFFALSLITQKPLPVSLHVR-TSDCAYFILVDRYLSWFL--PTEGSVPPPLSSSPGGTSPSPPPRTPAIPF-ASYGLHHT------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQ-----------------PRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQHR 512          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Match: SMPD4 (sphingomyelin phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:32949])

HSP 1 Score: 154.451 bits (389), Expect = 5.150e-38
Identity = 142/518 (27.41%), Postives = 226/518 (43.63%), Query Frame = 3
Query:  126 EDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLY------SKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPH-----SAAVLIDQSEASNGV----PSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +D+  +I     +E++T F  +++ IF + + +   W++       N  +   ++EFL P G +  L+ K    D     F+FP+  L    + SI     C+   S LY      + T G   N L LN FEY++F F +S I  K +   L    ++D  Y  LV RYL +FL    + S    L+      S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+   +E  Q+  +        H     S+A+      +   +     S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   +             I  R HR
Sbjct:   69 QDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYK---FDFPVSYLPGPVKASI---QECILPDSPLYHNKVQFTPTGGLGLN-LALNPFEYYIFFFALSLITQKPLPVSLHVR-TSDCAYFILVDRYLSWFL--PTEGSVPPPLSSSPGGTSPSPPPRTPAIPF-ASYGLHHT------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYRLSVSSALYSPAQPSLQALHAYQESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQ-----------------PRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQHR 541          

HSP 2 Score: 51.2174 bits (121), Expect = 9.437e-6
Identity = 27/85 (31.76%), Postives = 43/85 (50.59%), Query Frame = 3
Query: 1950 PEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL 2204
            P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ +  R+  QM   C R DF G   RY L
Sbjct:  696 PDCIVGEDGLILTPLGRYQIINGLRRFEIEYQGDPELQPIRSYEIASLVRTLFRLSSAINHRFAGQMAALCSRDDFLGSFCRYHL 780          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Match: SMPD4 (sphingomyelin phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:32949])

HSP 1 Score: 132.109 bits (331), Expect = 5.705e-31
Identity = 116/413 (28.09%), Postives = 178/413 (43.10%), Query Frame = 3
Query:  405 ANNSSCMFISSKLY------SKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            A+   C+   S LY      + T G   N L LN FEY++F F +S I  K +   L    ++D  Y  LV RYL +FL    + S    L+      S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   +             I  R HR
Sbjct:   86 ASIQECILPDSPLYHNKVQFTPTGGLGLN-LALNPFEYYIFFFALSLITQKPLPVSLHVR-TSDCAYFILVDRYLSWFL--PTEGSVPPPLSSSPGGTSPSPPPRTPAIPF-ASYGLHHT------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQ-----------------PRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQHR 439          

HSP 2 Score: 51.2174 bits (121), Expect = 8.840e-6
Identity = 27/85 (31.76%), Postives = 43/85 (50.59%), Query Frame = 3
Query: 1950 PEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL 2204
            P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ +  R+  QM   C R DF G   RY L
Sbjct:  594 PDCIVGEDGLILTPLGRYQIINGLRRFEIEYQGDPELQPIRSYEIASLVRTLFRLSSAINHRFAGQMAALCSRDDFLGSFCRYHL 678          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Match: SMPD4 (sphingomyelin phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:32949])

HSP 1 Score: 113.235 bits (282), Expect = 3.802e-27
Identity = 71/246 (28.86%), Postives = 115/246 (46.75%), Query Frame = 3
Query:  831 SADAA--ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLN 1562
            +AD A  E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+                       S+    FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   + 
Sbjct:   64 NADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSD-----------------------SQPRAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQ 264          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Match: SMPD4 (sphingomyelin phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:32949])

HSP 1 Score: 105.145 bits (261), Expect = 1.681e-22
Identity = 87/318 (27.36%), Postives = 132/318 (41.51%), Query Frame = 3
Query:  831 SADAA--ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPH-----SAAVLIDQSEASNGV----PSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLEC-----EF----------------------LSKLHSY--------RQQV---------VPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +AD A  E++ +ET+LQ+  E WL+   +E  Q+  +        H     S+A+      +   +     S  P+ + V +VRLL+KH + F  +      SP +         EF                      +  L S         +QQV         VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   +             I  R HR
Sbjct:  116 NADPASHEIWRSETLLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYRLSVSSALYSPAQPSLQALHAYQESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHATSPLEEFKRMGLNLPEVPSALPRRSQPSLMGALGSSVSRASLLGKQQVTLPIPCRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQ-----------------PRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQHR 416          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Fly
Match: CG6962 (gene:FBgn0037958 transcript:FBtr0082516)

HSP 1 Score: 63.1586 bits (152), Expect = 7.303e-10
Identity = 51/180 (28.33%), Postives = 76/180 (42.22%), Query Frame = 3
Query: 1020 PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            PS D V  VR LVK  + F            +Q +   L  L      +V     +R+  ++      WP+D S  +V+E WLS  QPWRY  +  +N +    PS+                IS  +  F++ N  +YT      +    R+D  V RNA M+YR+A +  Q D+   L
Sbjct:  301 PSSDFVRGVRTLVKQVHFFANG---------AQHDHSSLCALRKVSLSMVK----ARIYAFIVGLIDRWPLDSSLMVVLELWLSYIQPWRYTIASLNNKT----PSLSYRP-----------PISSCFDGFIIDNLIMYTHIFMQLLPHFGRLDYTVYRNAFMLYRLATIFSQHDLVDKL 452          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:793294])

HSP 1 Score: 142.124 bits (357), Expect = 2.544e-34
Identity = 138/524 (26.34%), Postives = 224/524 (42.75%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQ---PNATGGGTSCPHSAAVLIDQSEASNGVPSGC---------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHRTGL 1628
            +  ++  +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI       C    +K+     G    +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+   +E  Q+   P           S + ++ Q  A  G  SG          PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +             I  R +R  L
Sbjct:   28 RCHELCKIIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSIHAGVLPDCPLFHNKIQFPMSG----LLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLHHYSLEMYQKLQSPQVKLALLQYRLSMSSMLCQPPAPPG--SGTLHTYQEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQSDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMIQKGEQLFLEPEHAILQRHNRVFL 501          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:793294])

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-33
Identity = 126/482 (26.14%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  141 MISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI       C    +K+     G    +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +
Sbjct:   35 IIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSIHAGVLPDCPLFHNKIQFPMSG----LLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQSDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMI 448          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:793294])

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-33
Identity = 126/482 (26.14%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  141 MISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI       C    +K+     G    +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +
Sbjct:   35 IIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSIHAGVLPDCPLFHNKIQFPMSG----LLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQSDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMI 448          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:793294])

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-33
Identity = 126/482 (26.14%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  141 MISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI       C    +K+     G    +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +
Sbjct:   35 IIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSIHAGVLPDCPLFHNKIQFPMSG----LLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQSDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMI 448          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:793294])

HSP 1 Score: 139.043 bits (349), Expect = 2.094e-33
Identity = 126/482 (26.14%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  141 MISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI       C    +K+     G    +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +
Sbjct:   35 IIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSIHAGVLPDCPLFHNKIQFPMSG----LLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQSDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMI 448          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:100127861])

HSP 1 Score: 154.836 bits (390), Expect = 1.403e-38
Identity = 171/687 (24.89%), Postives = 281/687 (40.90%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY-WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHRTGLQSIDCNWNEIRYQMSLVFAEIGSLVXXXXXXXXXXGAHCSWWRAIWDS--LINSDALSTGGSP-KRVAMCLRQSR-VLFAGLLG--IAECATDEIEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRR 2135
            + + +D+  +I     +E++  F  +I+ +F + +     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F   +  +    +  +  + DS Y  LV +YL +FL                 +  N+    S N   T      ++ S++ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+                    H +  +  + ++ N      P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F+NR  R DL  P+NA M++R AKV  Q ++   +             I  R HR                  L+   +G                 SW   I D+   + S   S  G     + M   ++R +L    LG   A C + + E           + K+  P+ + +   + LT  GR+Q++N L K +V    D   +P  ++E   LVR    TS+ L  R
Sbjct:   27 LQRCQDLVRVIEDFPAKELHAIFPWLIETVFGSLDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPSPVRASIQERVLPECPLYHNKIQFPASGGISFNLALNSFEYFMFHFAFCLLKQRSFPQGHYFSTADSAYYILVDKYLKWFL----------------PAEGNVPPPHSPNTGGTVPLPAPRSPSISFASYGSHPSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLH--------------------HYSLEMYQKMQSPNAKELFQPTEEHVLVVRLLVKHLHTFSNSLRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLNRALRSDLVNPKNALMVFRAAKVFSQQNLPEMIQNGEQLFLKPEHVIPHRQHRL-----------------LLTPNLGGSFL------------SSWQPPITDTSLKVKSHVFSLEGQDCHYMQMFGTEARNLLNPTQLGQLTANCDSSQDE-----------NGKNKLPDCIQSEDGLVLTSLGRYQIINGLRKFEVEYRGDPELQPIRSYENAMLVRYLFRTSSVLYER 612          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:100127861])

HSP 1 Score: 153.295 bits (386), Expect = 8.316e-38
Identity = 135/517 (26.11%), Postives = 223/517 (43.13%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY-WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC--------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + + +D+  +I     +E++  F  +I+ +F + +     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F   +  +    +  +  + DS Y  LV +YL +FL                 +  N+    S N   T      ++ S++ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+   +E  Q+  +        H+   +   +     +P           P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F+NR  R DL  P+NA M++R AKV  Q ++   +             I  R HR
Sbjct:   27 LQRCQDLVRVIEDFPAKELHAIFPWLIETVFGSLDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPSPVRASIQERVLPECPLYHNKIQFPASGGISFNLALNSFEYFMFHFAFCLLKQRSFPQGHYFSTADSAYYILVDKYLKWFL----------------PAEGNVPPPHSPNTGGTVPLPAPRSPSISFASYGSHPSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLHHYSLEMYQKMQSPNAKLEALHNRLSVSSATHVYPALPGSLHSYQELFQPTEEHVLVVRLLVKHLHTFSNSLRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLNRALRSDLVNPKNALMVFRAAKVFSQQNLPEMIQNGEQLFLKPEHVIPHRQHR 502          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:100127861])

HSP 1 Score: 152.525 bits (384), Expect = 1.221e-37
Identity = 136/515 (26.41%), Postives = 222/515 (43.11%), Query Frame = 3
Query:  126 EDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY---WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC--------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +D+  +I     +E++  F  +I+ +F +  +D     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F   +  +    +  +  + DS Y  LV +YL +FL                 +  N+    S N   T      ++ S++ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+   +E  Q+  +        H+   +   +     +P           P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F+NR  R DL  P+NA M++R AKV  Q ++   +             I  R HR
Sbjct:    3 QDLVRVIEDFPAKELHAIFPWLIETVFGS--LDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPSPVRASIQERVLPECPLYHNKIQFPASGGISFNLALNSFEYFMFHFAFCLLKQRSFPQGHYFSTADSAYYILVDKYLKWFL----------------PAEGNVPPPHSPNTGGTVPLPAPRSPSISFASYGSHPSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLHHYSLEMYQKMQSPNAKLEALHNRLSVSSATHVYPALPGSLHSYQELFQPTEEHVLVVRLLVKHLHTFSNSLRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLNRALRSDLVNPKNALMVFRAAKVFSQQNLPEMIQNGEQLFLKPEHVIPHRQHR 474          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:100127861])

HSP 1 Score: 152.525 bits (384), Expect = 1.451e-37
Identity = 137/517 (26.50%), Postives = 224/517 (43.33%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY-WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC--------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            I + +D+  +I     +E++  F  +I+ +F + +     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F   +  + V+    +  + DS Y  LV +YL +FL                 +  N+    S N   T      ++ S++ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+   +E  Q+  +        H+   +   +     +P           P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F+NR  R DL  P+NA M++R AKV  Q ++   +             I  R HR
Sbjct:    4 IKQCQDLVRVIEDFPAKELHAIFPWLIETVFGSLDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPSPVRASIQERVLPECPLYHNKIQFPASGGISFNLALNSFEYFMFHFAFCLLKQRVS---HYFSTADSAYYILVDKYLKWFL----------------PAEGNVPPPHSPNTGGTVPLPAPRSPSISFASYGSHPSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLHHYSLEMYQKMQSPNAKLEALHNRLSVSSATHVYPALPGSLHSYQELFQPTEEHVLVVRLLVKHLHTFSNSLRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLNRALRSDLVNPKNALMVFRAAKVFSQQNLPEMIQNGEQLFLKPEHVIPHRQHR 476          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:100127861])

HSP 1 Score: 152.525 bits (384), Expect = 1.583e-37
Identity = 135/513 (26.32%), Postives = 221/513 (43.08%), Query Frame = 3
Query:  126 EDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY-WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC--------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +D+  +I     +E++  F  +I+ +F + +     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F   +  +    +  +  + DS Y  LV +YL +FL                 +  N+    S N   T      ++ S++ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+   +E  Q+  +        H+   +   +     +P           P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F+NR  R DL  P+NA M++R AKV  Q ++   +             I  R HR
Sbjct:   11 QDLVRVIEDFPAKELHAIFPWLIETVFGSLDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPSPVRASIQERVLPECPLYHNKIQFPASGGISFNLALNSFEYFMFHFAFCLLKQRSFPQGHYFSTADSAYYILVDKYLKWFL----------------PAEGNVPPPHSPNTGGTVPLPAPRSPSISFASYGSHPSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLHHYSLEMYQKMQSPNAKLEALHNRLSVSSATHVYPALPGSLHSYQELFQPTEEHVLVVRLLVKHLHTFSNSLRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLNRALRSDLVNPKNALMVFRAAKVFSQQNLPEMIQNGEQLFLKPEHVIPHRQHR 482          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Match: Smpd4 (sphingomyelin phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:1924876])

HSP 1 Score: 159.844 bits (403), Expect = 4.651e-40
Identity = 136/508 (26.77%), Postives = 221/508 (43.50%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    S D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVRTS-DCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQ-----------------PRCVSEKWAPFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 472          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Match: Smpd4 (sphingomyelin phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:1924876])

HSP 1 Score: 159.844 bits (403), Expect = 5.023e-40
Identity = 136/508 (26.77%), Postives = 221/508 (43.50%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    S D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVRTS-DCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQ-----------------PRCVSEKWAPFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 472          

HSP 2 Score: 53.5286 bits (127), Expect = 1.042e-6
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query: 1938 KHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL----IGKRQPISS-QRDEVTN 2252
            K   P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ + RR+  QM   C R DF G   RY L    +  R  +S   R +VTN
Sbjct:  620 KQQLPDCIVGEEGLILTPLGRYQIINGLRRFEIEYQGDLELQPIRSYEITSLVRALFRLSSAINRRFAGQMAALCSRNDFLGSFCRYHLTEPALSNRHLLSPVGRRQVTN 729          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Match: Smpd4 (sphingomyelin phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:1924876])

HSP 1 Score: 157.532 bits (397), Expect = 3.102e-39
Identity = 140/518 (27.03%), Postives = 225/518 (43.44%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPS----------GCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    S D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+   +E  Q+  +        H   + +  +  S   PS            P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVRTS-DCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYR-LTVSSALHSPAQPSLQALHAYQESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQ-----------------PRCVSEKWAPFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 501          

HSP 2 Score: 53.5286 bits (127), Expect = 1.046e-6
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query: 1938 KHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL----IGKRQPISS-QRDEVTN 2252
            K   P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ + RR+  QM   C R DF G   RY L    +  R  +S   R +VTN
Sbjct:  649 KQQLPDCIVGEEGLILTPLGRYQIINGLRRFEIEYQGDLELQPIRSYEITSLVRALFRLSSAINRRFAGQMAALCSRNDFLGSFCRYHLTEPALSNRHLLSPVGRRQVTN 758          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Match: Smpd4 (sphingomyelin phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:1924876])

HSP 1 Score: 150.984 bits (380), Expect = 4.123e-37
Identity = 134/508 (26.38%), Postives = 221/508 (43.50%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    ++D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +                 P  +SE    F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVR-TSDCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQ-----------------PRCVSEK-APFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 471          

HSP 2 Score: 53.5286 bits (127), Expect = 1.124e-6
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query: 1938 KHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL----IGKRQPISS-QRDEVTN 2252
            K   P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ + RR+  QM   C R DF G   RY L    +  R  +S   R +VTN
Sbjct:  619 KQQLPDCIVGEEGLILTPLGRYQIINGLRRFEIEYQGDLELQPIRSYEITSLVRALFRLSSAINRRFAGQMAALCSRNDFLGSFCRYHLTEPALSNRHLLSPVGRRQVTN 728          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Match: Smpd4 (sphingomyelin phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:1924876])

HSP 1 Score: 147.132 bits (370), Expect = 7.042e-36
Identity = 134/508 (26.38%), Postives = 221/508 (43.50%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    ++D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+                    H +  +  + ++ +   S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +   V     A  +    P         F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVR-TSDCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKMQSPHAKESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQPRCVSEKCLAPWS----PYQHRGLRAPFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 485          

HSP 2 Score: 53.5286 bits (127), Expect = 1.191e-6
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query: 1938 KHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL----IGKRQPISS-QRDEVTN 2252
            K   P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ + RR+  QM   C R DF G   RY L    +  R  +S   R +VTN
Sbjct:  633 KQQLPDCIVGEEGLILTPLGRYQIINGLRRFEIEYQGDLELQPIRSYEITSLVRALFRLSSAINRRFAGQMAALCSRNDFLGSFCRYHLTEPALSNRHLLSPVGRRQVTN 742          
BLAST of Sphingomyelin phosphodiesterase 4 vs. UniProt/SwissProt
Match: sp|Q6ZPR5|NSMA3_MOUSE (Sphingomyelin phosphodiesterase 4 OS=Mus musculus OX=10090 GN=Smpd4 PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 2.170e-38
Identity = 140/518 (27.03%), Postives = 225/518 (43.44%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN---SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPS----------GCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + +D+  +I     +E++  F  +++ IF + + +   W++       N  +    +EFL P+G +  L+ K    D    +F+FP+  L    + SI  N    S ++ +   +  T G   N L LN FEY+MF F +S I  K ++  L    S D  Y  LV RYL +FL    + S    L       S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+   +E  Q+  +        H   + +  +  S   PS            P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D +F+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  F+  N  +YT+    F+NR  R DL  P+NA M++RVAKV  Q ++   +             I  R HR
Sbjct:   28 RCQDLVKVIEDFPAKELHAVFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSTAMEFLDPSGPMMKLVYKLQAED---YNFDFPVSCLPGPVKASIQENVLPDSPLYHNKVQFPPTGGLGLN-LALNPFEYYMFYFALSLISQKPMSMTLHVRTS-DCAYFTLVDRYLSWFL--PTEGSVPPPLCSSPGGSSPSPAPRTPAMPF-ASYGLHT-------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYR-LTVSSALHSPAQPSLQALHAYQESFTPTEEHVLVVRLLLKHLHAFANSLKPDQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYVFLQHCFGHWPLDATFRAVLEMWLSYLQPWRYAPEKQAQGSDPQ-----------------PRCVSEKWAPFIQENLLMYTKLFVSFLNRALRTDLVSPKNALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELIIPHRQHR 501          

HSP 2 Score: 53.5286 bits (127), Expect = 7.315e-6
Identity = 35/110 (31.82%), Postives = 54/110 (49.09%), Query Frame = 3
Query: 1938 KHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL----IGKRQPISS-QRDEVTN 2252
            K   P+ +V    + LT  GR+Q++N L + ++    D   +P  ++E+  LVR     S+ + RR+  QM   C R DF G   RY L    +  R  +S   R +VTN
Sbjct:  649 KQQLPDCIVGEEGLILTPLGRYQIINGLRRFEIEYQGDLELQPIRSYEITSLVRALFRLSSAINRRFAGQMAALCSRNDFLGSFCRYHLTEPALSNRHLLSPVGRRQVTN 758          
BLAST of Sphingomyelin phosphodiesterase 4 vs. UniProt/SwissProt
Match: sp|Q9NXE4|NSMA3_HUMAN (Sphingomyelin phosphodiesterase 4 OS=Homo sapiens OX=9606 GN=SMPD4 PE=1 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 2.473e-37
Identity = 142/518 (27.41%), Postives = 226/518 (43.63%), Query Frame = 3
Query:  126 EDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLY------SKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPH-----SAAVLIDQSEASNGV----PSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            +D+  +I     +E++T F  +++ IF + + +   W++       N  +   ++EFL P G +  L+ K    D     F+FP+  L    + SI     C+   S LY      + T G   N L LN FEY++F F +S I  K +   L    ++D  Y  LV RYL +FL    + S    L+      S      +  +P  ASY                 S+L    R    +   N+  A+ E++ +ET+LQ+  E WL+   +E  Q+  +        H     S+A+      +   +     S  P+ + V +VRLL+KH + F  +      SP +       S L  +++  VPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRY    Q   S+ +                 P  +SE W  FV  N  +YT+    F+NR  R DL  P++A M++RVAKV  Q ++   +             I  R HR
Sbjct:   69 QDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYSIVMEFLDPGGPMMKLVYKLQAEDYK---FDFPVSYLPGPVKASI---QECILPDSPLYHNKVQFTPTGGLGLN-LALNPFEYYIFFFALSLITQKPLPVSLHVR-TSDCAYFILVDRYLSWFL--PTEGSVPPPLSSSPGGTSPSPPPRTPAIPF-ASYGLHHT------------SLLK---RHISHQTSVNADPASHEIWRSETLLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYRLSVSSALYSPAQPSLQALHAYQESFTPTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHAT--SPLEEFKRAAVPRFVQQKLYLFLQHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQ-----------------PRCVSEKWAPFVQENLLMYTKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQHR 541          
BLAST of Sphingomyelin phosphodiesterase 4 vs. UniProt/SwissProt
Match: sp|Q5XHG1|NSMA3_XENLA (Sphingomyelin phosphodiesterase 4 OS=Xenopus laevis OX=8355 GN=smpd4 PE=2 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 3.354e-35
Identity = 137/518 (26.45%), Postives = 224/518 (43.24%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSY-WDIISRNNYKN--DNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSF-ISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC--------PSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYV-DSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHR 1619
            + + +D+  +I     +E++  F  +I+ +F + +     W++   +   N  +    LEFL P+G +  L+ K   +      ++FP+  L    + SI       C    +K+     G  S  L LN+FEYFMF F    +  +N  + L ++ + DS Y  LV +YL +FL                    N+    S N   T      ++ SL+ ++     S+L    R    +   N+  AA E++ TET+LQ+  E WL+   +E  Q+  +        H+   +         +P           P+ + V +VRLLVKH + F  +     +SP +       S L   ++ VVPRF+  ++  +L+ CF +WP+D SF+ V+E WLS  QPWRYV +     S E ++ +V                  E W  FV  N   YT+    F++R  R DL  P+NA M++R AKV  Q ++   +             I  R HR
Sbjct:   27 LQRCQDLVRVIEDFPAKELHAIFPWLIETVFGSLDGSILGWNLRGLHERINPLEFHTALEFLDPSGAMMKLVYK---LQAEEYKYDFPVSFLPGPVRASIQERVLPECPLYHNKIQFPASGGVSFNLALNSFEYFMFHFAFCLLKQRNYPQGLHFS-TADSAYYILVDKYLKWFL----------------PVEGNVPPPHSPNTGGTVPSPAPRSPSLSFTSYGSHTSLLK---RHISHQHLVNADPAAQEIWRTETLLQVFVEIWLHHYSLEMYQKMQSPNAKLEALHNRLSVSSAPPIYPALPGSLHSYQELFQPTEEHVLVVRLLVKHLHTFSNSIRPEQVSPSTHSHTA--SPLEELKRVVVPRFIQQKLYIFLQHCFGHWPLDASFRAVLEMWLSYVQPWRYVLERSSPVSGEMQNRNV-----------------PEKWSTFVQENLLFYTKLFLRFLSRALRTDLVNPKNALMVFRAAKVFSQLNLPEMILNGEQLFLKPEHVIPHRQHR 502          

HSP 2 Score: 58.151 bits (139), Expect = 2.645e-7
Identity = 39/135 (28.89%), Postives = 64/135 (47.41%), Query Frame = 3
Query: 1932 DHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIG-----KRQPISSQRDEVTNNNVQLKEWVDSNTLHLRMRFLAT 2321
            D K+  P+ + +   + LT  GR+Q++N L K D+    D   +P  ++E   LVR     S+ + +R+ + M   C R DF G+L R+ L       K+ PI+S                +    H+R+RFLA+
Sbjct:  651 DGKNKLPDCIQSEDGVVLTSLGRYQIINGLRKFDIEYQGDPELQPIRSYENAMLVRYLYRLSSVINKRFANSMGALCARKDFLGKLCRHHLTSSSRKCKKSPITSVSPS------------EPAAPHIRLRFLAS 773          
BLAST of Sphingomyelin phosphodiesterase 4 vs. UniProt/SwissProt
Match: sp|Q6PFJ7|NSMA3_DANRE (Sphingomyelin phosphodiesterase 4 OS=Danio rerio OX=7955 GN=smpd4 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.681e-32
Identity = 125/480 (26.04%), Postives = 210/480 (43.75%), Query Frame = 3
Query:  141 MISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQS-FSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK----LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYL 1559
            +I     +E++  F  +++ +F + + I + W++        +    +EFL P+G +  L+ K   +      +EFPI  L    ++SI  ++  +      ++K     S +LFLN FEY+MF+F S +       + +   S+DS Y  LV  YL +FL                 +  N+  S FS      AS   +      +       S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F      ++L P+S             L   ++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY      N+++ + P+                 + + W  FV  N  +YT+    F+NR  R DL   +NA M++RVAKV  Q  +   +
Sbjct:   35 IIDDYPAKELHAIFPWLVECVFGSLDGILTGWNLRFLQARSAEYSIAMEFLDPSGPMMKLVYK---LQAEEYKYEFPISYLPGPIKSSI--HAGVLPDCPLFHNKIQFPMSGLLFLNPFEYYMFNFASSLIAPKNYPQGQHGSSSDSAYFVLVDTYLKYFL----------------PTEGNVPPSPFSDTRGTVASPAPRSTNVPYVGYGGHSTSLLK---RHITHQSSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFMPSEEHVLVVRLLVKHLHTFS-----SSLKPESISSSPSAHSHSSPLEELKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRYTGD--KNNTQTDGPN---------------RTVPDKWASFVQENLLLYTKLFQGFLNRAMRTDLVNAKNALMVFRVAKVFAQPSLSEMI 448          
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Match: A0A3Q3LQY8 (Sphingomyelin phosphodiesterase 4 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.363e-42
Identity = 188/789 (23.83%), Postives = 323/789 (40.94%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVP--------SGC---------PSVDQVCLVRLLVKHCYHFCYA-KSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICR--------------------------------YLNXXXXXXXXXXXXIESRFHRTGLQSIDCNWN-----EIR---YQMSLVFAEIGSLVXXXXXXXXXXGAHCSW--WRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDEIEGQRLVERQDFLDHKH----CQ--PEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQRDEVTNNNVQLK 2270
            + + +D+  +I     +E++  F  +++ +F + + I + W++   +   +D + ++ FL+PNG +  L+ K   +      +E P+  L    +  I       C    +KL     G  +  L LN FE+FMF+F   +       +     STDS Y  LV  YL +FL   P        ++     S+   S +   P  ++     + SL   +   + S+              N+  AA E++ +ET+LQ+  E WL+   +E  Q+          P     L+    + + +P        SG          P+ + V +VRLLVKH + F  + K     S  S       S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY     +   +                      + + W  FV  N  IYT+   +F+NR  R DL   +NA M++RV+KV  Q ++                                  YL++           ++S  H   L+  DC +      E+R    ++  + A+      R+     E  ++ S+  W  +  S +N+    T G P     CLR++       L    C   ++   +L +    LD       C+  P+ +     + LTD GR Q++N L + D+    D   +P  ++E   LVRL    S+ +  R+  QM   C RPDF GRL R+ L   +  I  ++  ++   ++ K
Sbjct:   33 LQRCQDLVRIIDEYPAKELHLIFPWLVESVFGSLDGIIAGWNLRLLHARSSDYNIVMNFLNPNGPMMKLVYK---LQAEEYKYEIPVNYLPGPVKACIQQGVLPDCPLFHNKLQFPLSGLLTVNLALNPFEFFMFNFAYCLITPKNCPQGHQESSTDSAYFVLVDTYLQYFL---PTEG-----SVPPSPFSDSRGSVTAPSPRPSTGYGVHSPSLLKHHIFHQPSV--------------NADPAAQEIWRSETLLQMFVEIWLHHYSLEMYQK-------LQSPQVKLALLQYRLSMSSMPCQPHVPPGSGTLHTYQEPFTPTEEHVLVVRLLVKHLHAFSNSLKPEQLTSSPSAHSHTHTSPLEEFKRVVVQRFVQQKLYLFLQHCFSHWPLDASFRAVLETWLSYVQPWRYTREKTNPQPDQNR------------------TVPDKWESFVQENLLIYTKLFQVFLNRAIRTDLVNAKNALMVFRVSKVFAQLNLAEMIQKGEQLFLEPEHVLHHRQPRGYLTPSQGGSYLSSRQRVVTDMVFRVKS--HVYALEGQDCQYKQMFGTELRGAVMKLIQIIAQARQTAKRISDHSSEVASNSSFLSWFGLGSSDLNNTF--TSGEPDESGECLRKTHEFLDKALENL-CQIFKLNQGQLTQLMSNLDSSQDDGNCKQLPDCIHGENGLMLTDLGRRQIINGLRRFDIQYQGDPELQPIRSYENALLVRLLYRISSLVNERFGEQMNALCSRPDFLGRLGRHYLTDPKSTIKLRQSPMSQRTLERK 766          
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Match: A0A3Q3LZF2 (Sphingomyelin phosphodiesterase 4 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.399e-42
Identity = 182/772 (23.58%), Postives = 316/772 (40.93%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYA-KSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICR--------------------------------YLNXXXXXXXXXXXXIESRFHRTGLQSIDCNWN-----EIR---YQMSLVFAEIGSLVXXXXXXXXXXGAHCSW--WRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDEIEGQRLVERQDFLDHKH----CQ--PEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQRDEVTNNNVQLK 2270
            + + +D+  +I     +E++  F  +++ +F + + I + W++   +   +D + ++ FL+PNG +  L+ K   +      +E P+  L    +  I       C    +KL     G  +  L LN FE+FMF+F   +       +     STDS Y  LV  YL +FL   P        ++     S+   S +   P  ++     + SL   +   + S+              N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        P+ + V +VRLLVKH + F  + K     S  S       S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY     +   +                      + + W  FV  N  IYT+   +F+NR  R DL   +NA M++RV+KV  Q ++                                  YL++           ++S  H   L+  DC +      E+R    ++  + A+      R+     E  ++ S+  W  +  S +N+    T G P     CLR++       L    C   ++   +L +    LD       C+  P+ +     + LTD GR Q++N L + D+    D   +P  ++E   LVRL    S+ +  R+  QM   C RPDF GRL R+ L   +  I  ++  ++   ++ K
Sbjct:   26 LQRCQDLVRIIDEYPAKELHLIFPWLVESVFGSLDGIIAGWNLRLLHARSSDYNIVMNFLNPNGPMMKLVYK---LQAEEYKYEIPVNYLPGPVKACIQQGVLPDCPLFHNKLQFPLSGLLTVNLALNPFEFFMFNFAYCLITPKNCPQGHQESSTDSAYFVLVDTYLQYFL---PTEG-----SVPPSPFSDSRGSVTAPSPRPSTGYGVHSPSLLKHHIFHQPSV--------------NADPAAQEIWRSETLLQMFVEIWLH--------------------HYSLEMYQKLQSPQVKEPFTPTEEHVLVVRLLVKHLHAFSNSLKPEQLTSSPSAHSHTHTSPLEEFKRVVVQRFVQQKLYLFLQHCFSHWPLDASFRAVLETWLSYVQPWRYTREKTNPQPDQNR------------------TVPDKWESFVQENLLIYTKLFQVFLNRAIRTDLVNAKNALMVFRVSKVFAQLNLAEMIQKGEQLFLEPEHVLHHRQPRGYLTPSQGGSYLSSRQRVVTDMVFRVKS--HVYALEGQDCQYKQMFGTELRGAVMKLIQIIAQARQTAKRISDHSSEVASNSSFLSWFGLGSSDLNNTF--TSGEPDESGECLRKTHEFLDKALENL-CQIFKLNQGQLTQLMSNLDSSQDDGNCKQLPDCIHGENGLMLTDLGRRQIINGLRRFDIQYQGDPELQPIRSYENALLVRLLYRISSLVNERFGEQMNALCSRPDFLGRLGRHYLTDPKSTIKLRQSPMSQRTLERK 729          
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Match: A0A3Q3LZD0 (Sphingomyelin phosphodiesterase 4 OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.669e-42
Identity = 188/789 (23.83%), Postives = 323/789 (40.94%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVP--------SGC---------PSVDQVCLVRLLVKHCYHFCYA-KSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICR--------------------------------YLNXXXXXXXXXXXXIESRFHRTGLQSIDCNWN-----EIR---YQMSLVFAEIGSLVXXXXXXXXXXGAHCSW--WRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDEIEGQRLVERQDFLDHKH----CQ--PEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQRDEVTNNNVQLK 2270
            + + +D+  +I     +E++  F  +++ +F + + I + W++   +   +D + ++ FL+PNG +  L+ K   +      +E P+  L    +  I       C    +KL     G  +  L LN FE+FMF+F   +       +     STDS Y  LV  YL +FL   P        ++     S+   S +   P  ++     + SL   +   + S+              N+  AA E++ +ET+LQ+  E WL+   +E  Q+          P     L+    + + +P        SG          P+ + V +VRLLVKH + F  + K     S  S       S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY     +   +                      + + W  FV  N  IYT+   +F+NR  R DL   +NA M++RV+KV  Q ++                                  YL++           ++S  H   L+  DC +      E+R    ++  + A+      R+     E  ++ S+  W  +  S +N+    T G P     CLR++       L    C   ++   +L +    LD       C+  P+ +     + LTD GR Q++N L + D+    D   +P  ++E   LVRL    S+ +  R+  QM   C RPDF GRL R+ L   +  I  ++  ++   ++ K
Sbjct:   26 LQRCQDLVRIIDEYPAKELHLIFPWLVESVFGSLDGIIAGWNLRLLHARSSDYNIVMNFLNPNGPMMKLVYK---LQAEEYKYEIPVNYLPGPVKACIQQGVLPDCPLFHNKLQFPLSGLLTVNLALNPFEFFMFNFAYCLITPKNCPQGHQESSTDSAYFVLVDTYLQYFL---PTEG-----SVPPSPFSDSRGSVTAPSPRPSTGYGVHSPSLLKHHIFHQPSV--------------NADPAAQEIWRSETLLQMFVEIWLHHYSLEMYQK-------LQSPQVKLALLQYRLSMSSMPCQPHVPPGSGTLHTYQEPFTPTEEHVLVVRLLVKHLHAFSNSLKPEQLTSSPSAHSHTHTSPLEEFKRVVVQRFVQQKLYLFLQHCFSHWPLDASFRAVLETWLSYVQPWRYTREKTNPQPDQNR------------------TVPDKWESFVQENLLIYTKLFQVFLNRAIRTDLVNAKNALMVFRVSKVFAQLNLAEMIQKGEQLFLEPEHVLHHRQPRGYLTPSQGGSYLSSRQRVVTDMVFRVKS--HVYALEGQDCQYKQMFGTELRGAVMKLIQIIAQARQTAKRISDHSSEVASNSSFLSWFGLGSSDLNNTF--TSGEPDESGECLRKTHEFLDKALE-NLCQIFKLNQGQLTQLMSNLDSSQDDGNCKQLPDCIHGENGLMLTDLGRRQIINGLRRFDIQYQGDPELQPIRSYENALLVRLLYRISSLVNERFGEQMNALCSRPDFLGRLGRHYLTDPKSTIKLRQSPMSQRTLERK 759          
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Match: A0A4S2MGJ0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001568 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.629e-41
Identity = 148/522 (28.35%), Postives = 237/522 (45.40%), Query Frame = 3
Query:   60 FKYILSYRICTMNRISNN----IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSYWDIISRNNYKNDN--DKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLYSKTPGFQSN--VLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPL-TASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATG--GGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYH--FCYAKSVAALSPDSQLECEFLSKLHSY------------RQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPS-VXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADI 1547
            F + L +  C+  R+ ++      ++ ++ S ++  SLQE+  +FTSI+D IF   +    WD+   N   N    +++ +FLSP+G L   I+ R+T++     ++FP+  LS  +QN I  +               GF S    + LNAFEY+MF F ++  H    K L+ N    S+Y  +   YL F+ +  P        AL S S       F+  + +   SY                ++  NP+  +   + Q + +D   L+ TE  LQ I EF L+          ++TG  G T  P  AA ++     S+   S  P+   + LVR  +K+ Y+  F +    +  SP  QL    ++  H +                    L+ ++   +  CF++WP+D SF+IV+ETWL+  QPWRY D+ Q   S    PS +   +    +    P   +  W  F      +Y  PL LF+ R  RMDL VP+NAHM+YRVAK++ Q  +
Sbjct:   24 FSFRLFHTFCSSFRMGSSEHALSARINELSSFLAQSSLQELQGAFTSIVDSIFGFSDAHCGWDLHELNESNNARLFNEVRKFLSPSGRLLSCIVNRITLEGVACKYDFPVSLLSTNSQNMIQCH---------------GFTSTSCTVPLNAFEYYMFHFHAYPVHPKRRKNLKLNVIEHSLYAAVFTDYLAFYFYVEPT-------ALASLSNHLQLAKFAPQITMYQRSY----------------FTDHNPQYPVDTMEFQAHVSDKNFLWQTEVFLQAIFEFLLSWR--------SSTGLLGITEFP--AARILPVIPQSHAELSFKPTSAHLFLVRCFIKYLYYTAFHHTPPESFQSPFQQLIYARIACYHRFLCNMLCLPPTDLSATTTHHNLMVQLKHLIIYCFQHWPMDLSFEIVIETWLTSIQPWRYADTPQPRGSA---PSPLAQQSPPLCSPKKEPTDTAHSWVSFATQQYSLYVIPLLLFLQRSLRMDLRVPQNAHMVYRVAKILSQPGL 494          
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Match: A0A4S2MG04 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001568 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 6.147e-41
Identity = 150/524 (28.63%), Postives = 239/524 (45.61%), Query Frame = 3
Query:   60 FKYILSYRICTMNRISNN----IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSYWDIISRNNYKNDN--DKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLYSKTPGFQSN--VLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPL-TASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATG--GGTSCPHSAAV-LIDQSEASN-GVPSGCPSVDQVCLVRLLVKHCYH--FCYAKSVAALSPDSQLECEFLSKLHSY------------RQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPS-VXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADI 1547
            F + L +  C+  R+ ++      ++ ++ S ++  SLQE+  +FTSI+D IF   +    WD+   N   N    +++ +FLSP+G L   I+ R+T++     ++FP+  LS  +QN I  +               GF S    + LNAFEY+MF F ++  H    K L+ N    S+Y  +   YL F+ +  P        AL S S       F+  + +   SY                ++  NP+  +   + Q + +D   L+ TE  LQ I EF L+          ++TG  G T  P +  + +I QS A    V S  P+   + LVR  +K+ Y+  F +    +  SP  QL    ++  H +                    L+ ++   +  CF++WP+D SF+IV+ETWL+  QPWRY D+ Q   S    PS +   +    +    P   +  W  F      +Y  PL LF+ R  RMDL VP+NAHM+YRVAK++ Q  +
Sbjct:   24 FSFRLFHTFCSSFRMGSSEHALSARINELSSFLAQSSLQELQGAFTSIVDSIFGFSDAHCGWDLHELNESNNARLFNEVRKFLSPSGRLLSCIVNRITLEGVACKYDFPVSLLSTNSQNMIQCH---------------GFTSTSCTVPLNAFEYYMFHFHAYPVHPKRRKNLKLNVIEHSLYAAVFTDYLAFYFYVEPT-------ALASLSNHLQLAKFAPQITMYQRSY----------------FTDHNPQYPVDTMEFQAHVSDKNFLWQTEVFLQAIFEFLLSWR--------SSTGLLGITEFPAARILPVIPQSHAELLSVLSFKPTSAHLFLVRCFIKYLYYTAFHHTPPESFQSPFQQLIYARIACYHRFLCNMLCLPPTDLSATTTHHNLMVQLKHLIIYCFQHWPMDLSFEIVIETWLTSIQPWRYADTPQPRGSA---PSPLAQQSPPLCSPKKEPTDTAHSWVSFATQQYSLYVIPLLLFLQRSLRMDLRVPQNAHMVYRVAKILSQPGL 498          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Cavefish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:103046315])

HSP 1 Score: 172.94 bits (437), Expect = 2.377e-44
Identity = 193/779 (24.78%), Postives = 315/779 (40.44%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIE---PPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGC---------PSVDQVCLVRLLVKHCYHFCYA-KSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESR------------------------------FHRTGLQSIDCNW-----NEIR---YQMSLVFAEIGSLVXXXXXXXXXXGAHCSWWRAIWDSLINSDALST--GGSPKRVAMCLRQSRVLFAGLLGIAECATDEI-EGQ------RLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIG--------KRQPISSQ 2234
            + + +++  +I     +E++  F  +I+ IF + + +   W++       N+ + +++FL PNG +  L+ K    D     +E PI  L    + SI       C    +KL     G  S  + LN FEY++F+F S +         +    +DS Y  LV  YL  FL          +  +     S+   S +   P + S         +        S+L    R    +   N+  AA E++ +ET+LQ+  E WL+   +E     Q P           + + ++ Q  A  G  SG          P+ + V +VRLLVKH + F  + K     SP +       S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY       + E  +P                  + E W  FV  N  +YT+    F+NR+ R DL   +NA M++RVAKV  Q ++   +             +  R                               H  GL+  DC +      E+R    ++  + A+      R+     EA A+ S++   W  + +SD   T  GG    +  C +++       L    C    +  GQ       L   +D    K   P+ + +   + LTD GR Q++N L + ++    D   +P  ++E   LVRL    S+ L  R   QM   C R DF GR+SR+ L          +R P++ Q
Sbjct:   26 LQRCQELVKVIDDYPAKELHLVFPWLIESIFGSLDGVIVGWNLRFLQTRMNEYNIVMDFLDPNGPMMKLVYKLQAED---YKYEIPISYLPGPVKASIQEGVLPDCPLFHNKLQFPMSGLLSFSMSLNPFEYYIFNFASSLIVPKTYPPGQHGSCSDSAYFVLVDAYLKHFL--------PTEGNVPPSPFSDPRGSVAPPAPRSPSVPYVGYGVHST-------SLLK---RHISHQPSVNADPAAQEIWRSETLLQVFVEMWLHHYSLEMYQKLQSPQVKLALLQYRLNMSSMLCQPPAPPG--SGTLHTYQEPFSPTEEHVLVVRLLVKHLHAFSNSLKQEQTSSPSTHSHA---SPLEEFKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRY-------TGEKSNPQTDVQNRN----------VPEKWASFVQENLLMYTKLFQGFLNRVMRTDLVNAKNALMVFRVAKVFAQPNLSEMIQKGEQLFLEPEHVLHHRQPRVFLTPAHSGSFLSSRQPAGTDAVFKVKSHVYGLEGQDCQYKQMFGGEVRGVVLKLIQIIAQARQTAKRISDHTAEAAANSSFFS--WFGVSSSDHNHTFSGGEADDMGECFKKTHEFLDKALDYL-CQIFRLNSGQLSQLMANLASTEDDGGSKQL-PDCIPSEDGLVLTDLGRMQIINGLRRFEIEYQGDPELQPIRSYENALLVRLMFKVSSFLNDRLGDQMEMLCSRQDFVGRVSRHYLTSSSTASEHRRRSPVARQ 757          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Cavefish
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:103046315])

HSP 1 Score: 172.555 bits (436), Expect = 3.100e-44
Identity = 187/767 (24.38%), Postives = 308/767 (40.16%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAA-ELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYA-KSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESR------------------------------FHRTGLQSIDCNW-----NEIR---YQMSLVFAEIGSLVXXXXXXXXXXGAHCSWWRAIWDSLINSDALST--GGSPKRVAMCLRQSRVLFAGLLGIAECATDEI-EGQ------RLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIG--------KRQPISSQ 2234
            + + +++  +I     +E++  F  +I+ IF + + +   W++       N+ + +++FL PNG +  L+ K    D     +E PI  L    + SI       C    +KL     G  S  + LN FEY++F+F S +         +    +DS Y  LV  YL  FL   P    +          S+   S +   P + S         +        S+L    R    +   N+  AA E++ +ET+LQ+  E WL+                    H +  +  + ++        P+ + V +VRLLVKH + F  + K     SP +       S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY       + E  +P                  + E W  FV  N  +YT+    F+NR+ R DL   +NA M++RVAKV  Q ++   +             +  R                               H  GL+  DC +      E+R    ++  + A+      R+     EA A+ S++   W  + +SD   T  GG    +  C +++       L    C    +  GQ       L   +D    K   P+ + +   + LTD GR Q++N L + ++    D   +P  ++E   LVRL    S+ L  R   QM   C R DF GR+SR+ L          +R P++ Q
Sbjct:   26 LQRCQELVKVIDDYPAKELHLVFPWLIESIFGSLDGVIVGWNLRFLQTRMNEYNIVMDFLDPNGPMMKLVYKLQAED---YKYEIPISYLPGPVKASIQEGVLPDCPLFHNKLQFPMSGLLSFSMSLNPFEYYIFNFASSLIVPKTYPPGQHGSCSDSAYFVLVDAYLKHFL---PTEGNVPPSPF-----SDPRGSVAPPAPRSPSVPYVGYGVHST-------SLLK---RHISHQPSVNADPAAQEIWRSETLLQVFVEMWLH--------------------HYSLEMYQKLQSPQVKEPFSPTEEHVLVVRLLVKHLHAFSNSLKQEQTSSPSTHSHA---SPLEEFKRVVVQRFVQQKLYVFLQHCFGHWPLDASFRAVLETWLSYIQPWRY-------TGEKSNPQTDVQNRN----------VPEKWASFVQENLLMYTKLFQGFLNRVMRTDLVNAKNALMVFRVAKVFAQPNLSEMIQKGEQLFLEPEHVLHHRQPRVFLTPAHSGSFLSSRQPAGTDAVFKVKSHVYGLEGQDCQYKQMFGGEVRGVVLKLIQIIAQARQTAKRISDHTAEAAANSSFFS--WFGVSSSDHNHTFSGGEADDMGECFKKTHEFLDKALDYL-CQIFRLNSGQLSQLMANLASTEDDGGSKQL-PDCIPSEDGLVLTDLGRMQIINGLRRFEIEYQGDPELQPIRSYENALLVRLMFKVSSFLNDRLGDQMEMLCSRQDFVGRVSRHYLTSSSTASEHRRRSPVARQ 727          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004203.1 (pep scaffold:Pmarinus_7.0:GL479413:32138:45886:1 gene:ENSPMAG00000003835.1 transcript:ENSPMAT00000004203.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 2.367e-17
Identity = 95/404 (23.51%), Postives = 173/404 (42.82%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSYWDIISRNNYKNDND--KILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLYSK--TPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSA-----DAAELYYTETVLQIISEFWLN---TTIIEPPQQPNA-----------TGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCY-AKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIV 1253
            + +  D+   I   + +++   F  ++  IF  +  +  W+++   N K+  D   + +FLSP G +  L+ K L +D +   F + + +L    + ++      +   S LY      G     L LNAFEY++FSF +++     +   ++    +++Y  LV  YL +FL     +      AL        ++  S    L + Y                    +P S L     Q  S       A +++++ET+LQ+  E WL+     + +  Q P A               TS      VL      S       P+ + V +VRLL+KH ++F   A+     SP S    +  S L ++++ V+PRF+  ++  +L+ CF +WP+D+SF++V
Sbjct:   28 LYRCADLTRTIDDYTSKDLQGIFEWLVASIFGADG-EPGWNLLYIQNKKSPTDYAAVHDFLSPCGAMMRLVYK-LQVDDA--KFSYQVSKLPAPARGAL--QEGLLPTESPLYVNKLVGGGLVLSLSLNAFEYYLFSFANYLVLPKTSLSPQYAAGPNNLYTALVEDYLKYFLPTMGNAPASPTHALTKAPSPPNHRPVSC---LQSPYS-------------------SPLSALLKRPIQHQSPVTPDPAAHQIWHSETLLQVFVELWLHHYSPEVFQKMQSPQARFPDVFFFLAIISALTSLAPFQKVLESFHLLSEQF---VPTEEHVRVVRLLIKHLHYFSSSARDPPPASPSSPYHSQPTSPLDNFKRVVIPRFVQKKLYVFLQHCFSHWPLDYSFRVV 400          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001488.1 (pep scaffold:Pmarinus_7.0:GL478041:53068:54200:-1 gene:ENSPMAG00000001345.1 transcript:ENSPMAT00000001488.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 6.067e-7
Identity = 34/106 (32.08%), Postives = 53/106 (50.00%), Query Frame = 3
Query: 2004 QVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQRDEVTNNNVQLKEWVDSNTLHLRMRFLAT 2321
            Q++N L + ++  + D   +P  ++E   LVRL    ++ L  RY  QM+  C RP F GRLSRY L   R     + + V      +     ++T  L +RFLA+
Sbjct:    2 QLMNGLRRFNIQYSGDPELQPIRSYENPTLVRLLYRLTSALNLRYNSQMQALCRRPGFLGRLSRYYLCPPRVASMPRFEPV------IMAAAAAHTPRLSLRFLAS 101          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Nematostella
Match: EDO39314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI1])

HSP 1 Score: 103.605 bits (257), Expect = 8.162e-23
Identity = 110/476 (23.11%), Postives = 188/476 (39.50%), Query Frame = 3
Query:  120 KVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANNSSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADI 1547
            K E+I  +I   S++E++  F  ++  +F  +     W + +      + + +  FLSP+G LF L L +L +D   + +EF +  L                         P F SN                            W    +  Y  ++  YL++FL   P    L+     S S +NL ++ +W        Q     +          + + P  +   G        + E   +E  LQI++EFWLN          N   G TS           +  S+G     P +D V +VR+L+K  + F Y+   + + P +QL     S+   +++ ++P+ L  ++  +L  CF +WP+D SF++V+E WLS  QPWRY +       + +                     S +W  FV  N   YT  L  FV R  ++DL   ++A ++ R  KV+ Q+ +
Sbjct:   19 KCEEISRLIDDSSIKELHNFFPDLLGSVFGYDGKPD-WGLRTILPNHREFEVLRLFLSPHGPLFRL-LDKLQVDGH-LKYEFYVRLL-------------------------PAFDSN----------------------------WLNGAECPYMVILEDYLNYFL---PAKGPLVTSLFSSSSSTNLPRTNAWQTSNPYLQQSPMTNTQFAGLLKTSSTQITPPGKAHTGYGHT----SRETTQSEKFLQILTEFWLNQ---------NTLDGVTS-----------NVLSHGQQYFLPGIDLVRVVRMLIKQVHCFVYS---SGIYPLTQL---ITSQDDEFKRSLIPQMLQKKLYCFLRHCFAHWPLDPSFRVVIEAWLSYIQPWRYANQVGPTRGDQQGGE----------------PFSPEWTVFVHENLLFYTSLLREFVLRALKLDLFSVKDAFVLLRGTKVLSQSSL 389          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Medaka
Match: smpd4 (sphingomyelin phosphodiesterase 4 [Source:NCBI gene;Acc:101161548])

HSP 1 Score: 148.673 bits (374), Expect = 1.209e-36
Identity = 174/705 (24.68%), Postives = 284/705 (40.28%), Query Frame = 3
Query:  114 IMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNT-ENIDSYWDIISRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFTQNSIANN--SSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGS-TDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECE-FLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHRTGLQSIDCN---WNEIRYQMSLVFAEIGSLVXXXXXXXXXXGAHCSWWRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDEIEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYIL 2204
            + + +D+  +I     +E++  F  +++ +F + + +   W +   ++  N+ + +L+FL+P+G +  L+ K   +      +E PI  L    +  I       C    +KL     G  +  + LN FE+FMF+F   +    V    +   S TDS Y  LV  YL +FL   P    +      S SR ++        P + S+      S          S+L  +  +           A E++ +ET+LQ+  E WL+                    H +  +  + ++        PS + V +VRLLVKH + F  +     +SP    +     S L  +++ VV RF+  ++  +L+ CF +WP+D SF+ V+ETWLS  QPWRY     +   +                      I + W  F+  N  +YTR    F+NR  RMDL   +NA M++RVAKV  Q ++   +             +  R  R  L          +  R    +VF ++ S V          G  C + +     L N  AL+ G                   L+     + DE + ++L             P+ +  AG + LT+ GR Q++N   + DV    D   +P   +E   LVRL    S  L +R    M   C RPDF GRL R+ L
Sbjct:   26 LQRCQDLVKIIDEYPAKELHLIFPWLVESVFGSLDGVIMGWSLRLLHSRCNEYNVVLDFLNPSGPMMKLVYK---LQAEEYKYEIPINYLPGPVRACIQEGVLPDCPLFHNKLQFPPSGILTPNIALNPFEFFMFNFAYCLITPKVGSPPQLIRSCTDSAYFVLVDMYLKYFL---PSEGSVPP----SDSRGSVTAPSPR--PSSVSFAGYGVHSP---------SLL--KHHIFHQPSVNADPAAQEIWRSETLLQMFVEVWLH--------------------HYSLEMYQKLQSPQVKEPFSPSEELVLVVRLLVKHLHAFSNSLKSEQVSPSPPAQSHAHTSPLEEFKRVVVQRFVQQKLYLFLQHCFGHWPLDASFRAVLETWLSFIQPWRYTGEKINPQPDQNR------------------TIPDKWEPFIQENLLMYTRLFQGFLNRAVRMDLVNGKNALMVFRVAKVFSQPNLSEMIQRVEQLFLEPEHVLHHRQPRGYLTPSHGGSYLSSRQRVVTDMVF-KVKSHV------YALEGQDCQYTQMFGTELKN--ALNQGQ---------------LTQLMISVSSSQDEAQSKQL-------------PDCIQEAGGLILTELGRRQIINGQRRFDVQYQGDPELQPIRTYENALLVRLLYRLSYLLNQRLGGFMSALCSRPDFLGRLGRHYL 632          
BLAST of Sphingomyelin phosphodiesterase 4 vs. Planmine SMEST
Match: SMESG000010484.1 (SMESG000010484.1)

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 667/680 (98.09%), Postives = 667/680 (98.09%), Query Frame = 3
Query:  423 MFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYXXXXXXXXXXXXXXXEWSMLNPRSRLAGGKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVXXXXXXXXXXXXLPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNXXXXXXXXXXXXIESRFHRTGLQSIDCNWNEIRYQMSLVFAEIGSLVXXXXXXXXXXGAHCSWWRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDEIEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQRDEVTNNNVQLKEWVDSNTLHLRMRFLATKAXXXXXXXXXXXXXXTCGTGLISMVIGVALLYLLVAMVSVQILRFE 2462
            MFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYQCQQNVSLNLSNSNQEWSMLNPRSRLAG KEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATGGG SCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVGAIATAGGTSAA PVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLN AA   AC AGGIESRFHRTGLQSIDCNWNEIRYQMSLVFAEIGSLVARLELAEREAGAHCSWWRAIWDSLINSDALSTGGSPKRVAMCLRQSR LFAGLLGIAECATDEIEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQ DEVT NNVQLKEWVDSNTLHLRMRFLATKAFLFWFFVLYLVLRLTCGTGLISMV G ALLYLLVAMVSVQILRFE
Sbjct:    1 MFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNVAKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQSFSWNVPLTASYQCQQNVSLNLSNSNQEWSMLNPRSRLAGVKEQKNSADAAELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGASCPHSAAVLIDQSEASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSKLHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRYVDSYQHNSSEHEHPSVGAIATAGGTSAASPVAISEDWCEFVMGNSEIYTRPLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLN-AAAGTACAAGGIESRFHRTGLQSIDCNWNEIRYQMSLVFAEIGSLVARLELAEREAGAHCSWWRAIWDSLINSDALSTGGSPKRVAMCLRQSRALFAGLLGIAECATDEIEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPSNIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLSRYILIGKRQPISSQGDEVT-NNVQLKEWVDSNTLHLRMRFLATKAFLFWFFVLYLVLRLTCGTGLISMVTGGALLYLLVAMVSVQILRFE 678          
The following BLAST results are available for this feature:
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMPD41.204e-3827.11sphingomyelin phosphodiesterase 4 [Source:HGNC Sym... [more]
SMPD45.150e-3827.41sphingomyelin phosphodiesterase 4 [Source:HGNC Sym... [more]
SMPD45.705e-3128.09sphingomyelin phosphodiesterase 4 [Source:HGNC Sym... [more]
SMPD43.802e-2728.86sphingomyelin phosphodiesterase 4 [Source:HGNC Sym... [more]
SMPD41.681e-2227.36sphingomyelin phosphodiesterase 4 [Source:HGNC Sym... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG69627.303e-1028.33gene:FBgn0037958 transcript:FBtr0082516[more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smpd42.544e-3426.34sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd42.094e-3326.14sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd42.094e-3326.14sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd42.094e-3326.14sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd42.094e-3326.14sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smpd41.403e-3824.89sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd48.316e-3826.11sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd41.221e-3726.41sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd41.451e-3726.50sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd41.583e-3726.32sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smpd44.651e-4026.77sphingomyelin phosphodiesterase 4 [Source:MGI Symb... [more]
Smpd45.023e-4026.77sphingomyelin phosphodiesterase 4 [Source:MGI Symb... [more]
Smpd43.102e-3927.03sphingomyelin phosphodiesterase 4 [Source:MGI Symb... [more]
Smpd44.123e-3726.38sphingomyelin phosphodiesterase 4 [Source:MGI Symb... [more]
Smpd47.042e-3626.38sphingomyelin phosphodiesterase 4 [Source:MGI Symb... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6ZPR5|NSMA3_MOUSE2.170e-3827.03Sphingomyelin phosphodiesterase 4 OS=Mus musculus ... [more]
sp|Q9NXE4|NSMA3_HUMAN2.473e-3727.41Sphingomyelin phosphodiesterase 4 OS=Homo sapiens ... [more]
sp|Q5XHG1|NSMA3_XENLA3.354e-3526.45Sphingomyelin phosphodiesterase 4 OS=Xenopus laevi... [more]
sp|Q6PFJ7|NSMA3_DANRE1.681e-3226.04Sphingomyelin phosphodiesterase 4 OS=Danio rerio O... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3LQY82.363e-4223.83Sphingomyelin phosphodiesterase 4 OS=Mastacembelus... [more]
A0A3Q3LZF22.399e-4223.58Sphingomyelin phosphodiesterase 4 OS=Mastacembelus... [more]
A0A3Q3LZD02.669e-4223.83Sphingomyelin phosphodiesterase 4 OS=Mastacembelus... [more]
A0A4S2MGJ05.629e-4128.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MG046.147e-4128.63Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smpd42.377e-4424.78sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
smpd43.100e-4424.38sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004203.12.367e-1723.51pep scaffold:Pmarinus_7.0:GL479413:32138:45886:1 g... [more]
ENSPMAT00000001488.16.067e-732.08pep scaffold:Pmarinus_7.0:GL478041:53068:54200:-1 ... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO393148.162e-2323.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smpd41.209e-3624.68sphingomyelin phosphodiesterase 4 [Source:NCBI gen... [more]
back to top
BLAST of Sphingomyelin phosphodiesterase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010484.10.000e+098.09SMESG000010484.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017968 ID=SMED30017968|Name=Sphingomyelin phosphodiesterase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2493bp
TTGAATTTTACATTCGATAAATTCAACTTTGTTTTAATATTATCAAATAA
GAATTTGAATTTAAATATATTTTAAGTTATAGAATTTGTACAATGAATAG
AATATCAAATAATATCATGAAGGTTGAAGATATCAAATCTATGATTTCAA
CTCTGTCATTGCAGGAAATATATACTTCTTTTACATCGATTATAGATAAG
ATATTTAATACAGAAAACATAGATTCTTATTGGGATATAATATCCCGTAA
CAATTATAAAAATGACAATGATAAAATTTTAGAATTTTTAAGTCCAAACG
GCCACTTATTTGATTTGATATTGAAACGATTAACAATTGATAAATCAGTG
ATTCATTTTGAGTTTCCAATTTATAGATTATCGAAATTCACCCAAAATTC
CATTGCAAACAACTCGTCTTGCATGTTTATCTCATCAAAACTTTATTCCA
AAACTCCAGGCTTCCAAAGCAACGTTTTATTTCTAAACGCATTCGAGTAT
TTCATGTTCTCCTTTATCAGCTTCATCTATCACAAAAATGTTGCCAAAAA
ACTCGAATGGAACGGATCGACTGACAGCATTTATTGCCAACTTGTTTTGC
GATATTTGGATTTCTTTCTCTTCAAATCTCCTCAGTCAAGTTGTCTCATG
CAATTGGCATTGCAGTCCCGCTCACGCTCCAATCTCAACCAGTCGTTCTC
ATGGAATGTGCCCCTCACTGCCAGCTATCAATGCCAACAAAACGTCTCGC
TAAACCTCTCGAATTCCAACCAGGAATGGAGCATGCTCAATCCTCGCTCC
CGATTGGCTGGCGGGAAGGAGCAGAAGAATTCCGCCGACGCAGCGGAACT
GTATTACACTGAGACAGTGTTGCAAATCATTTCCGAGTTCTGGTTGAATA
CAACTATAATCGAGCCGCCGCAGCAGCCAAACGCGACCGGAGGGGGCACC
AGCTGCCCCCACAGCGCTGCTGTGCTCATTGACCAATCAGAAGCGAGTAA
TGGCGTCCCATCCGGCTGTCCATCAGTGGACCAAGTCTGCCTAGTGAGGT
TGCTAGTGAAGCATTGCTATCATTTCTGCTACGCCAAGTCCGTTGCAGCT
CTCTCGCCAGACAGCCAATTGGAATGCGAGTTCCTCTCCAAGCTCCATTC
GTACCGACAGCAAGTCGTTCCGCGGTTCCTCTTGTCCCGGATGCTGCCGT
ATCTCGAGTGCTGCTTCCGCAATTGGCCGATCGATTTCTCATTCAAGATC
GTCATGGAAACCTGGCTGAGTCTGGCGCAGCCCTGGCGCTATGTGGATTC
CTACCAGCACAATTCGAGTGAGCACGAGCATCCATCTGTCGGTGCTATCG
CAACCGCAGGGGGAACCTCAGCGGCATTGCCAGTGGCCATCAGTGAGGAT
TGGTGCGAATTTGTCATGGGTAACAGCGAGATTTACACTCGGCCGCTGGC
ACTGTTTGTCAATCGGCTGCAGCGGATGGATTTGGCGGTGCCTCGCAACG
CCCACATGATGTATCGGGTTGCCAAGGTGATTGGACAGGCGGATATCTGT
CGGTACCTCAATGCCGCCGCTGGCACCGCCGCCTGCACTGCCGGTGGCAT
CGAGTCGAGATTCCATCGCACTGGATTGCAATCGATTGATTGCAATTGGA
ATGAGATCCGTTATCAGATGTCGCTGGTGTTTGCTGAGATTGGCTCATTG
GTTGCTAGACTGGAACTGGCGGAACGGGAGGCGGGAGCTCATTGCAGCTG
GTGGCGGGCGATCTGGGACAGTCTAATCAATTCCGATGCCTTGTCAACCG
GAGGCAGTCCGAAACGCGTTGCGATGTGCTTGCGGCAGTCACGCGTGCTA
TTTGCGGGCTTGCTGGGCATTGCCGAGTGCGCGACAGACGAGATTGAGGG
ACAGCGATTGGTGGAGCGGCAGGATTTCCTCGATCACAAGCACTGCCAGC
CGGAGCATGTGGTGACAGCCGGCCGGATCCAGCTGACGGATTTCGGGCGG
TTCCAGGTGCTCAATAACCTCTGCAAGCTCGATGTTCCCTCGAATATCGA
TTATTACAATCGGCCGACTTGCAACTTCGAGGTGGACGGGCTCGTACGGT
TGTCAAGGGTTACATCGAATACTTTGTGTCGCCGGTACGAGCATCAGATG
CGGACTTACTGCTATCGACCGGATTTCTGGGGTCGATTATCCCGGTACAT
TCTCATTGGTAAGCGGCAGCCAATCAGCTCTCAGCGTGATGAGGTAACCA
ACAATAATGTCCAATTGAAAGAATGGGTCGACTCGAATACGCTGCATTTA
CGGATGCGTTTCCTGGCAACGAAGGCATTTTTGTTCTGGTTCTTTGTTCT
GTATCTAGTTTTACGCCTCACCTGTGGAACTGGATTGATCTCCATGGTAA
TCGGTGTGGCTTTGTTATATTTGTTGGTTGCCATGGTTTCAGTCCAAATT
CTGAGGTTTGAGTGAAAGTTGTTTTCAATATAAATGTGTTACG
back to top

protein sequence of SMED30017968-orf-1

>SMED30017968-orf-1 ID=SMED30017968-orf-1|Name=SMED30017968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=791bp
MNRISNNIMKVEDIKSMISTLSLQEIYTSFTSIIDKIFNTENIDSYWDII
SRNNYKNDNDKILEFLSPNGHLFDLILKRLTIDKSVIHFEFPIYRLSKFT
QNSIANNSSCMFISSKLYSKTPGFQSNVLFLNAFEYFMFSFISFIYHKNV
AKKLEWNGSTDSIYCQLVLRYLDFFLFKSPQSSCLMQLALQSRSRSNLNQ
SFSWNVPLTASYQCQQNVSLNLSNSNQEWSMLNPRSRLAGGKEQKNSADA
AELYYTETVLQIISEFWLNTTIIEPPQQPNATGGGTSCPHSAAVLIDQSE
ASNGVPSGCPSVDQVCLVRLLVKHCYHFCYAKSVAALSPDSQLECEFLSK
LHSYRQQVVPRFLLSRMLPYLECCFRNWPIDFSFKIVMETWLSLAQPWRY
VDSYQHNSSEHEHPSVGAIATAGGTSAALPVAISEDWCEFVMGNSEIYTR
PLALFVNRLQRMDLAVPRNAHMMYRVAKVIGQADICRYLNAAAGTAACTA
GGIESRFHRTGLQSIDCNWNEIRYQMSLVFAEIGSLVARLELAEREAGAH
CSWWRAIWDSLINSDALSTGGSPKRVAMCLRQSRVLFAGLLGIAECATDE
IEGQRLVERQDFLDHKHCQPEHVVTAGRIQLTDFGRFQVLNNLCKLDVPS
NIDYYNRPTCNFEVDGLVRLSRVTSNTLCRRYEHQMRTYCYRPDFWGRLS
RYILIGKRQPISSQRDEVTNNNVQLKEWVDSNTLHLRMRFLATKAFLFWF
FVLYLVLRLTCGTGLISMVIGVALLYLLVAMVSVQILRFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0000139Golgi membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR024129Sphingomy_SMPD4
Vocabulary: molecular function
TermDefinition
GO:0050290sphingomyelin phosphodiesterase D activity
GO:0004767sphingomyelin phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006685sphingomyelin catabolic process
GO:0006687glycosphingolipid metabolic process
GO:0046475glycerophospholipid catabolic process
GO:0046513ceramide biosynthetic process
GO:0071356cellular response to tumor necrosis factor
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024129Sphingomyelin phosphodiesterase 4PFAMPF14724mit_SMPDasecoord: 10..487
e-value: 3.7E-44
score: 150.9
coord: 616..719
e-value: 9.2E-12
score: 43.8
IPR024129Sphingomyelin phosphodiesterase 4PANTHERPTHR12988FAMILY NOT NAMEDcoord: 562..780
coord: 11..493
NoneNo IPR availableTMHMMTMhelixcoord: 762..784
NoneNo IPR availableTMHMMTMhelixcoord: 738..755