Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30017944
Length (bp)1309
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30017944) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30017944) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30017944) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30017944) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017944

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30017944SMESG000080008.1 dd_Smed_v4_2907_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017944SMESG000035080.1 dd_Smed_v4_4080_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN9 (tetraspanin 9 [Source:HGNC Symbol;Acc:HGNC:21640])

HSP 1 Score: 79.337 bits (194), Expect = 3.137e-16
Identity = 63/236 (26.69%), Postives = 109/236 (46.19%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILA--FIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEF---SQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M++ C  C++  + + N   +L G  +LG  I+L     N   T SP     F  + A   ++ IG   +    +GC GA  E++ +L  +F V+L +  +++ +  L+FVY D   E    +LK  +  Y        +  + N +Q  ++CCGV    D+      + +P  CC      C  +      +  GC +K K +   ++H LG + M I++M   + LGM FS+ L
Sbjct:    1 MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFA-TFSP----SFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAW-NIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGC-GRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIM---QILGMAFSMTL 226          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN9 (tetraspanin 9 [Source:HGNC Symbol;Acc:HGNC:21640])

HSP 1 Score: 79.337 bits (194), Expect = 3.137e-16
Identity = 63/236 (26.69%), Postives = 109/236 (46.19%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILA--FIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEF---SQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M++ C  C++  + + N   +L G  +LG  I+L     N   T SP     F  + A   ++ IG   +    +GC GA  E++ +L  +F V+L +  +++ +  L+FVY D   E    +LK  +  Y        +  + N +Q  ++CCGV    D+      + +P  CC      C  +      +  GC +K K +   ++H LG + M I++M   + LGM FS+ L
Sbjct:    1 MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFA-TFSP----SFPSLSAANLVIAIGTIVMVTGFLGCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAW-NIIQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGC-GRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIM---QILGMAFSMTL 226          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD81 (CD81 molecule [Source:HGNC Symbol;Acc:HGNC:1701])

HSP 1 Score: 79.337 bits (194), Expect = 3.472e-16
Identity = 65/241 (26.97%), Postives = 109/241 (45.23%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLY--TRTSNH---DLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLK----ISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVE-KKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            + C  CI+  + V NF  +L G  ILG +++L    +T+N    +L   P   T +  I   I  +G   + +  +GC+GA  ESQ +LG +F+ ++ LFA +VA G   FV KD+ +  ++K     ++Q  +        +  + +  + L CCG  ++         +N+           C +      N F + C  K  +    KL +I +  IV+  I    MI S+ LC  IR
Sbjct:    4 EGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILI-AVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQ-IAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNL-----------CPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIR 231          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD82 (CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210])

HSP 1 Score: 76.2554 bits (186), Expect = 5.924e-15
Identity = 54/205 (26.34%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  270 MGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFV----YKDE--KLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIP---FSC-CDYEIHE----------CKAKVEKKNA---------FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            +G+G  T+ +  +GC GA +E + +LG+YF+ +L +  +QV  G+L++      K E   + T L   I++Y +S+    ++ + + VQ  +KCCG  S  ++       N P   + C C+ +  E          C+A   +  +         + +GC +K + + Q  LG+I  + + +  IE LGM+ S+ LC  +   D
Sbjct:   60 IGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTEL---IRDYNSSREDSLQDAW-DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSED 260          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD9 (CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709])

HSP 1 Score: 73.1738 bits (178), Expect = 3.063e-14
Identity = 63/232 (27.16%), Postives = 104/232 (44.83%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDL--TRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDE--KLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGV-DSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFT-KGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            CI+  +   NF  +L GIA+L   ++L   +    +    + ++ + F   +  ++G G   + +  +GC GA  ESQ +LG++F  +L +FA ++A     + +KDE  K          N + +K   Q E  L ++   L CCG+   V  +I    P                 K +    FT K C D  KE   +K  +I  + I +  +   GMIFS+ LC +IR
Sbjct:    9 CIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRET-LKAIHYALNCCGLAGGVEQFISDICP-----------------KKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-6 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0])

HSP 1 Score: 70.0922 bits (170), Expect = 1.633e-13
Identity = 64/231 (27.71%), Postives = 105/231 (45.45%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLY---------TRTSNHDLTR--SPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEI--FLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFS 764
            C++ F  ++NF  F++G  I+G SI++            T   DL++  S  +  +    L   + IG   + L   GC G+  ES   + IYF ++L LF  +V    LYFV K   L    +   ++ + SK   Q++I   L+ +Q  L+CCG    +DYI        P SC      +C A +++      GC        +  L  ++ + I++  +E L MIFS
Sbjct:    9 CVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSFLYVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKT-NLQQGFQTIWRDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPYGA---FPTSC------QC-ATIQQ-----AGCATVIWNSFESSLIYVAFVGIIILFVELLAMIFS 223          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-8 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q19983])

HSP 1 Score: 70.4774 bits (171), Expect = 2.650e-13
Identity = 59/273 (21.61%), Postives = 113/273 (41.39%), Query Frame = 3
Query:   99 KCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDL-TRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEI--FLNSVQKMLKCCGVDSVNDYIKKD---TPS-----------------------------NIPFSCCDYE-----IHEC-----KAKVEKKNAF--TKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALC 776
             C + +RI   + NF  +L G+ + G  I+L    +  D       H   F+ +  F++G G   I +   GC GA+  +Q  L  +  +++  F  ++A     F +K E +   ++ S+ + + ++ + +       ++VQ+  +CCGV +  D++       PS                              +P SCC+        + C     +A +     F  T+GC D   E     L +I  + +V+C ++ LG++ S+ LC
Sbjct:    3 SCVNALRIVTFLFNFAFWLSGVVVFGLGIWLLFDPAASDFFALHSTHPGAFRYVGWFLVGAGAIIILVGYFGCIGAWKMNQCALAFFCCILILAFFLELAAAVTLF-HKQEHIKHYVESSMYDTIRNRYSSETAFKDAFDTVQEKFECCGVKTYTDWLSARWDAEPSTQLEVNEEDAGRIEHGIGAFGGNKGTGYGRVPSSCCNEHGKLSYPNNCGRSFSQAPLNTYAQFINTRGCADAVYESVSSSLSLIVGVCVVLCIVQLLGIVLSMTLC 274          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-13 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.738e-7
Identity = 42/180 (23.33%), Postives = 80/180 (44.44%), Query Frame = 3
Query:  126 VVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRS------PDHYTEFKKILAF---IMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK----DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY--IKKDTPSNIPFSC--CDYEI 614
            +   N    ++G  +L   ++L T +   +           + + E   + AF   I+ +G   + ++++GC G    S+P L IY  V+  L  + ++ G +Y +YK    D +L+  L   +Q+Y       QE   L+ +Q   +CCG    +D+   ++D P +    C  C + I
Sbjct:   61 IFTANIVFLIVGGLLLAMGVWLRTDSRFRNFISERYRQAVQEAFWEAPTLFAFSYIIIVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCG-IYLLYKKDGLDVELSDALNYMVQHYYQGPGVVQES--LDHLQTAFRCCGNAGCSDFRVFRQDIPRSCDIRCDGCHFRI 237          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-21 (Tetraspanin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q5WRN1])

HSP 1 Score: 52.7582 bits (125), Expect = 1.820e-7
Identity = 55/222 (24.77%), Postives = 106/222 (47.75%), Query Frame = 3
Query:  132 VVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKI-LAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFS-VMLFLFASQVA--VGSLYFVYKDEKLTTNLKISIQNYMNS-----KITKQEEIFL--NSVQKMLKCCGVDSVNDY-IKKDTPSNI--PFSCCDYE-------IHEC-KAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVM 731
            + N    + G++ L   ++LY+ + N+ +  +P  Y+      L    G+ IF I    VG  G    ++ +L  Y   V+L +    +A   GSL+     E+   NL+ S+ + +N+     KI ++ ++ L  + +Q+ L+CCGVD+  D+      P+N+  P SCCD +          C K   E+   + KGC  K+ ++  H + +++ +  ++
Sbjct:   19 LANVCFLISGLSSLIVGVWLYS-SKNNFIELTPTSYSALSAAGLCVFTGVTIFIIVA--VGYLGVSWSNKSLLYSYIGFVILLILVHGIARITGSLH----KEEAKENLRKSMLHNINTTAVVTKIGREIKLSLTWDHLQRELQCCGVDNYTDWHYSVHWPNNLYTPDSCCDPQHFDAENGTENCGKLPDEQSLLYQKGCFPKFSDWLYHHIILVNWVTSIL 233          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-21 (Tetraspanin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q5WRN1])

HSP 1 Score: 52.7582 bits (125), Expect = 1.820e-7
Identity = 55/222 (24.77%), Postives = 106/222 (47.75%), Query Frame = 3
Query:  132 VVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKI-LAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFS-VMLFLFASQVA--VGSLYFVYKDEKLTTNLKISIQNYMNS-----KITKQEEIFL--NSVQKMLKCCGVDSVNDY-IKKDTPSNI--PFSCCDYE-------IHEC-KAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVM 731
            + N    + G++ L   ++LY+ + N+ +  +P  Y+      L    G+ IF I    VG  G    ++ +L  Y   V+L +    +A   GSL+     E+   NL+ S+ + +N+     KI ++ ++ L  + +Q+ L+CCGVD+  D+      P+N+  P SCCD +          C K   E+   + KGC  K+ ++  H + +++ +  ++
Sbjct:   19 LANVCFLISGLSSLIVGVWLYS-SKNNFIELTPTSYSALSAAGLCVFTGVTIFIIVA--VGYLGVSWSNKSLLYSYIGFVILLILVHGIARITGSLH----KEEAKENLRKSMLHNINTTAVVTKIGREIKLSLTWDHLQRELQCCGVDNYTDWHYSVHWPNNLYTPDSCCDPQHFDAENGTENCGKLPDEQSLLYQKGCFPKFSDWLYHHIILVNWVTSIL 233          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 92.8189 bits (229), Expect = 4.314e-21
Identity = 67/260 (25.77%), Postives = 119/260 (45.77%), Query Frame = 3
Query:  102 CFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTR-TSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPS------------------NIPFSCCDYEIHECKAKVEKK--------NA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C  C++  +V++N   +LIG+ I+ TS+++ T  T    +T++ +HY      L   + IGI     +  GC G   ESQ +L  +F V+L +  +Q+A G+  F  K   D+ +   +K S+Q            +  +++QK LKCCG D   D+      +                  NIP SCC   + + + ++ ++        NA + +GC DK  E        I  +   +  +E L + F+++LC ++R
Sbjct:    6 CCSCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHY---HIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVR 262          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0084912)

HSP 1 Score: 92.8189 bits (229), Expect = 4.314e-21
Identity = 67/260 (25.77%), Postives = 119/260 (45.77%), Query Frame = 3
Query:  102 CFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTR-TSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPS------------------NIPFSCCDYEIHECKAKVEKK--------NA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C  C++  +V++N   +LIG+ I+ TS+++ T  T    +T++ +HY      L   + IGI     +  GC G   ESQ +L  +F V+L +  +Q+A G+  F  K   D+ +   +K S+Q            +  +++QK LKCCG D   D+      +                  NIP SCC   + + + ++ ++        NA + +GC DK  E        I  +   +  +E L + F+++LC ++R
Sbjct:    6 CCSCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHY---HIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVR 262          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 92.8189 bits (229), Expect = 7.317e-21
Identity = 68/260 (26.15%), Postives = 120/260 (46.15%), Query Frame = 3
Query:  102 CFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTR-TSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKK-----DTPS-------------NIPFSCCDYEIHECKAKVEKK--------NA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C  C++  +V++N   +LIG+ I+ TS+++ T  T    +T++ +HY      L   + IGI     +  GC G   ESQ +L  +F V+L +  +Q+A G+  F  K   D+ +   +K S+Q            +  +++QK LKCCG D   D+        D  +             NIP SCC   + + + ++ ++        NA + +GC DK  E        I  +   +  +E L + F+++LC ++R
Sbjct:    6 CCSCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHY---HIALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVR 262          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp5D (gene:FBgn0029837 transcript:FBtr0114466)

HSP 1 Score: 82.4185 bits (202), Expect = 2.432e-17
Identity = 64/255 (25.10%), Postives = 110/255 (43.14%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSK-----ITKQEEIFLNSVQKMLKCCGVDSVNDYIK-KDTPSN--IPFSCCD--YEIHE--------------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M    + CIR     +N  L+L   A LG  ++L    + +  T  P H       +   MGIG     +S  GC GA+ +S+ +L +YF +++ LF S+  VGS+ F+++      L   L+  I+ + NS      +        +SVQ+  +CCGV S  D+   +  P    +P SCC   Y+  +              C         + KGC    + +   +L V+  + + +  ++  G+I S+ L
Sbjct:    1 MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGY-ATLLPQHAGLSADTI--FMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLL 252          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp5D (gene:FBgn0029837 transcript:FBtr0070888)

HSP 1 Score: 82.4185 bits (202), Expect = 2.432e-17
Identity = 64/255 (25.10%), Postives = 110/255 (43.14%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSK-----ITKQEEIFLNSVQKMLKCCGVDSVNDYIK-KDTPSN--IPFSCCD--YEIHE--------------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M    + CIR     +N  L+L   A LG  ++L    + +  T  P H       +   MGIG     +S  GC GA+ +S+ +L +YF +++ LF S+  VGS+ F+++      L   L+  I+ + NS      +        +SVQ+  +CCGV S  D+   +  P    +P SCC   Y+  +              C         + KGC    + +   +L V+  + + +  ++  G+I S+ L
Sbjct:    1 MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGY-ATLLPQHAGLSADTI--FMGIGGTGFVVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLL 252          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 92.8189 bits (229), Expect = 4.781e-21
Identity = 73/253 (28.85%), Postives = 119/253 (47.04%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQ---NYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY-----IKKDTPSNIPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            M K C    + F+ + NF  F+ G  I+G    L+    N  L       +   K++++I+ G+G F++ L  +GC GA +E + +LG+YF+ +L +  +QVAV  L +  +D   T   KI  Q   NY     T ++    + +Q+ ++CCG +   D+     IK +T    P SC +Y I          C+A       +  GC +    +     G+I  I + +  IE LGMI S+ LC S+   D
Sbjct:    1 MGKGCITATKYFLFLFNFIFFIFGATIMGFG--LWILLDNQSLIAVLQESSVILKVVSYILIGVGSFSMLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQVAVSILIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQA--WDYLQRTMQCCGWNGRMDWDENHIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQED 249          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 92.8189 bits (229), Expect = 4.781e-21
Identity = 73/253 (28.85%), Postives = 119/253 (47.04%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQ---NYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY-----IKKDTPSNIPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            M K C    + F+ + NF  F+ G  I+G    L+    N  L       +   K++++I+ G+G F++ L  +GC GA +E + +LG+YF+ +L +  +QVAV  L +  +D   T   KI  Q   NY     T ++    + +Q+ ++CCG +   D+     IK +T    P SC +Y I          C+A       +  GC +    +     G+I  I + +  IE LGMI S+ LC S+   D
Sbjct:    1 MGKGCITATKYFLFLFNFIFFIFGATIMGFG--LWILLDNQSLIAVLQESSVILKVVSYILIGVGSFSMLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQVAVSILIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQA--WDYLQRTMQCCGWNGRMDWDENHIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQED 249          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82a (CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2818])

HSP 1 Score: 92.8189 bits (229), Expect = 4.781e-21
Identity = 73/253 (28.85%), Postives = 119/253 (47.04%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQ---NYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY-----IKKDTPSNIPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            M K C    + F+ + NF  F+ G  I+G    L+    N  L       +   K++++I+ G+G F++ L  +GC GA +E + +LG+YF+ +L +  +QVAV  L +  +D   T   KI  Q   NY     T ++    + +Q+ ++CCG +   D+     IK +T    P SC +Y I          C+A       +  GC +    +     G+I  I + +  IE LGMI S+ LC S+   D
Sbjct:    1 MGKGCITATKYFLFLFNFIFFIFGATIMGFG--LWILLDNQSLIAVLQESSVILKVVSYILIGVGSFSMLLGFLGCLGAIYEIRCLLGLYFTCLLLILLAQVAVSILIYFQRDLLKTEADKIVSQVVANYPGQNKTAEQA--WDYLQRTMQCCGWNGRMDWDENHIIKNNTVPLYPCSCHNYSIQAPIVPDNGFCQASSSDWPIYQTGCLEHVGSWLFTNYGIILGICLGVAVIELLGMILSMGLCKSVHQED 249          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan2a (tetraspanin 2a [Source:ZFIN;Acc:ZDB-GENE-050522-511])

HSP 1 Score: 87.8113 bits (216), Expect = 1.305e-19
Identity = 62/233 (26.61%), Postives = 102/233 (43.78%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEE--IFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            + C  C++  + V NF  +L G  +L   ++L        L    D    F   +  ++G G   + +   GCFGA  ESQ +LG +F+ +L +F ++VA G   F+ KD+ +       +QNY  S  TK E   +  ++   +L CCG +S                          + +E      K C    ++F   KL +I  + I +  +  +GMIFS+ LC +IR
Sbjct:    5 QGCMKCVKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENFFIAVYILIGAGGIMMIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQIIK-----EVQNYYESA-TKMENGTVITSAFHSVLDCCGTES--------------------------SPIETCTEGNKDCVQAIEDFFNEKLFIIGYVGIGIAGVMVIGMIFSMVLCCAIR 205          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan2a (tetraspanin 2a [Source:ZFIN;Acc:ZDB-GENE-050522-511])

HSP 1 Score: 87.8113 bits (216), Expect = 1.305e-19
Identity = 62/233 (26.61%), Postives = 102/233 (43.78%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEE--IFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            + C  C++  + V NF  +L G  +L   ++L        L    D    F   +  ++G G   + +   GCFGA  ESQ +LG +F+ +L +F ++VA G   F+ KD+ +       +QNY  S  TK E   +  ++   +L CCG +S                          + +E      K C    ++F   KL +I  + I +  +  +GMIFS+ LC +IR
Sbjct:    5 QGCMKCVKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENFFIAVYILIGAGGIMMIVGFFGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFLNKDQIIK-----EVQNYYESA-TKMENGTVITSAFHSVLDCCGTES--------------------------SPIETCTEGNKDCVQAIEDFFNEKLFIIGYVGIGIAGVMVIGMIFSMVLCCAIR 205          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 85.8853 bits (211), Expect = 2.307e-18
Identity = 63/230 (27.39%), Postives = 116/230 (50.43%), Query Frame = 3
Query:  153 LIGIAILGTSIF-LYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLK------ISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY----IKKDTPSNIPFSCCDYEIHE---CKAKVEKKNA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            ++G  ILG  I+ L  +TS   + ++   Y      +  ++ +G FT+ +  +GC GA +E + +LG+YFS +L +  +QVA G L ++ +D  L T +       I   +Y + K T  E  + + +Q  L+CCG  +  ++    + +++ +  P SC   +      C+     ++A +  GC    + + Q  LG+I  + + +  IE LG+I S+ LC SI+  D
Sbjct:   36 ILGAVILGFGIWILVDKTSFIAVLQTSSSYLRTGSYI--LIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRD-TLKTEMSSIIHELIVTYDYEDGKNTSAETTW-DYIQTNLRCCGWTNYQNWTANTVVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSED 261          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 85.1149 bits (209), Expect = 3.748e-18
Identity = 63/228 (27.63%), Postives = 114/228 (50.00%), Query Frame = 3
Query:  159 GIAILGTSIF-LYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLK------ISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDY----IKKDTPSNIPFSCCDYEIHE---CKAKVEKKNA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            G  ILG  I+ L  +TS   + ++   Y      +  ++ +G FT+ +  +GC GA +E + +LG+YFS +L +  +QVA G L ++ +D  L T +       I   +Y + K T  E  + + +Q  L+CCG  +  ++    + +++ +  P SC   +      C+     ++A +  GC    + + Q  LG+I  + + +  IE LG+I S+ LC SI+  D
Sbjct:   25 GAVILGFGIWILVDKTSFIAVLQTSSSYLRTGSYI--LIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRD-TLKTEMSSIIHELIVTYDYEDGKNTSAETTW-DYIQTNLRCCGWTNYQNWTANTVVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSED 248          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd9 (CD9 protein [Source:NCBI gene;Acc:549743])

HSP 1 Score: 83.9593 bits (206), Expect = 5.223e-18
Identity = 62/234 (26.50%), Postives = 103/234 (44.02%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            K    CI+  +   NF  +L G A+LG  ++L        +  +  +   F   +  ++G G   + +  +GC GA  ES+ +LG++F+ +L +FA ++A G   F  KD   ++L T  K +   YM S     ++  L ++   L CCG+  V +    D   N            C A +E  + FT             K  ++  + I +  I   GMIFS+ LC +IR
Sbjct:    4 KGGIKCIKYLLFAFNFIFWLAGTAVLGIGLWLRFDPQTKAMFEADQNTGAFYTGVYILIGAGALMMLVGFLGCCGAIQESECMLGLFFAFLLVIFAVEIAAGIWGFTNKDKVVDELKTFYKDTYTKYMKSNDNALKDT-LKAIHLALNCCGMTGVLEATVTDICPNNQGIVGALSAQSCPAAIE--DVFTT------------KFHIVGAVGIGIAVIMIFGMIFSMVLCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 83.1889 bits (204), Expect = 1.878e-17
Identity = 62/239 (25.94%), Postives = 113/239 (47.28%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQ-EEIFLNSVQKM---LKCCGVDSVNDY---IKKDTPSN----IPFSCCDYEIHECKAKVEKKNAFTK--GCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C++  +   NF  +L G+A++   I+   + S++      + Y     IL     I + T    ++GC   + E + +L +YF ++L +F  +V  G L ++Y  ++L   LK S++  M +K  +  EE   N+V K+    KCCG ++  D+   I  ++P      +P SCC      C  +    N +    GC  K + F +  L +I  + I +  ++  GMIF+  L  S++
Sbjct:   15 CLKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMIT---GILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYY-QQLNAELKQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLK 249          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 81.2629 bits (199), Expect = 7.531e-17
Identity = 62/245 (25.31%), Postives = 113/245 (46.12%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDE------KLTTNLKISIQNYMNSKITKQ-EEIFLNSVQKM---LKCCGVDSVNDY---IKKDTPSN----IPFSCCDYEIHECKAKVEKKNAFTK--GCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C++  +   NF  +L G+A++   I+   + S++      + Y     IL     I + T    ++GC   + E + +L +YF ++L +F  +V  G L ++Y  +      +L   LK S++  M +K  +  EE   N+V K+    KCCG ++  D+   I  ++P      +P SCC      C  +    N +    GC  K + F +  L +I  + I +  ++  GMIF+  L  S++
Sbjct:   15 CLKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMIT---GILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLK 256          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd9 (CD9 antigen [Source:MGI Symbol;Acc:MGI:88348])

HSP 1 Score: 87.4261 bits (215), Expect = 2.524e-19
Identity = 59/228 (25.88%), Postives = 103/228 (45.18%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNY--MNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            CI+  +   NF  +L GIA+L   ++L   +    +    ++++ F   +  ++G G   + +  +GC GA  ESQ +LG++F  +L +FA ++A     + +KDE +    +     Y  + SK   Q E  L ++   L CCG+    +    DT               C  K   ++   K C +   E   +K  +I  + I +  +   GMIFS+ LC +IR
Sbjct:    9 CIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRET-LKAIHMALDCCGIAGPLEQFISDT---------------CPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 79.7221 bits (195), Expect = 2.493e-16
Identity = 57/212 (26.89%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  270 MGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKD-----TPSNIPFSCCDYEIHECKAKVEKKNAF-------------------TKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTR 824
            +G+G  TI +  +GC GA +E + +LG+YF  +L +  +QV VG L++   D   +++   +   I+NY  +  + +EE + + VQ  +KCCG  S  ++ + +     T +  P SC   +I E   ++  K  F                   T+GC +K + + Q   G++  +   +  IE LG+  S+ LC   RY  +  Y  V +
Sbjct:   60 IGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAW-DYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSC--EKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLC---RYIHSEDYSKVPK 265          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 79.7221 bits (195), Expect = 2.493e-16
Identity = 57/212 (26.89%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  270 MGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKD-----TPSNIPFSCCDYEIHECKAKVEKKNAF-------------------TKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTR 824
            +G+G  TI +  +GC GA +E + +LG+YF  +L +  +QV VG L++   D   +++   +   I+NY  +  + +EE + + VQ  +KCCG  S  ++ + +     T +  P SC   +I E   ++  K  F                   T+GC +K + + Q   G++  +   +  IE LG+  S+ LC   RY  +  Y  V +
Sbjct:   60 IGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAW-DYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSC--EKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLC---RYIHSEDYSKVPK 265          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 79.7221 bits (195), Expect = 2.493e-16
Identity = 57/212 (26.89%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  270 MGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKD-----TPSNIPFSCCDYEIHECKAKVEKKNAF-------------------TKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTR 824
            +G+G  TI +  +GC GA +E + +LG+YF  +L +  +QV VG L++   D   +++   +   I+NY  +  + +EE + + VQ  +KCCG  S  ++ + +     T +  P SC   +I E   ++  K  F                   T+GC +K + + Q   G++  +   +  IE LG+  S+ LC   RY  +  Y  V +
Sbjct:   60 IGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAW-DYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSC--EKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLC---RYIHSEDYSKVPK 265          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 79.7221 bits (195), Expect = 2.493e-16
Identity = 57/212 (26.89%), Postives = 101/212 (47.64%), Query Frame = 3
Query:  270 MGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKD-----TPSNIPFSCCDYEIHECKAKVEKKNAF-------------------TKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTR 824
            +G+G  TI +  +GC GA +E + +LG+YF  +L +  +QV VG L++   D   +++   +   I+NY  +  + +EE + + VQ  +KCCG  S  ++ + +     T +  P SC   +I E   ++  K  F                   T+GC +K + + Q   G++  +   +  IE LG+  S+ LC   RY  +  Y  V +
Sbjct:   60 IGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAW-DYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSC--EKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELLGLFLSICLC---RYIHSEDYSKVPK 265          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40240|CD9_MOUSE (CD9 antigen OS=Mus musculus OX=10090 GN=Cd9 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.766e-18
Identity = 59/228 (25.88%), Postives = 103/228 (45.18%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNY--MNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            CI+  +   NF  +L GIA+L   ++L   +    +    ++++ F   +  ++G G   + +  +GC GA  ESQ +LG++F  +L +FA ++A     + +KDE +    +     Y  + SK   Q E  L ++   L CCG+    +    DT               C  K   ++   K C +   E   +K  +I  + I +  +   GMIFS+ LC +IR
Sbjct:    9 CIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQENNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRET-LKAIHMALDCCGIAGPLEQFISDT---------------CPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P30932|CD9_BOVIN (CD9 antigen OS=Bos taurus OX=9913 GN=CD9 PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 2.084e-18
Identity = 60/228 (26.32%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKI--SIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            CI+  +   NF  +L GIA+L   ++L   +    +    ++ + F   +  ++G G   + +  +GC GA  ESQ +LG++FS +L +FA +VA     + +K+E +    K      N + +K   Q E  L ++   L CCG+  V +    DT               C  K    +  T+ C +   E  + K  +I  + I +  +   GM+FS+ LC +IR
Sbjct:    9 CIKYLLFGFNFIFWLAGIAVLSVGLWLRFDSQTKSIFEQENNDSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQKFYEDTYNKLKNKDEPQRET-LKAIHIALDCCGLTGVPEQFLTDT---------------CPPKNLIDSLKTRPCPEAIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40241|CD9_RAT (CD9 antigen OS=Rattus norvegicus OX=10116 GN=Cd9 PE=1 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 6.512e-18
Identity = 62/230 (26.96%), Postives = 105/230 (45.65%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDE---KLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGV-DSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            CI+  +   NF  +L GIA+L   ++L   +    +     +++ F   +  ++G G   + +  +GC GA  ESQ +LG++F  +L +FA ++A     + +KDE   +L    K + Q   N    ++E   L ++   L CCG+   V  +I     S+I           C  K   ++   K C D   E    K  +I  + I +  +   GMIFS+ LC +IR
Sbjct:    9 CIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRET--LKAIHMALNCCGIAGGVEQFI-----SDI-----------CPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q6GMK6|TSN9_DANRE (Tetraspanin-9 OS=Danio rerio OX=7955 GN=tspan9 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.501e-16
Identity = 64/237 (27.00%), Postives = 119/237 (50.21%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILA--FIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNS---VQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAF-TKGCKDKYKEF---SQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M++ C  C++  + + N   +L G  +LG  I+L     +   T SP     F  + A   ++ +G   +    +GC GA  E++ +L  +F V+L +  +++ +  L+FVY  EK++ N K  +++ +    T       N+   +Q   +CCGV  ++D+ +     ++P  CC     EC       N F ++GC +K +E+   ++H LG I+M ++V+   + LGM FS+ L
Sbjct:    1 MARGCLCCVKYMMFLFNLLFWLSGCGLLGVGIWLSVSQGSFA-TFSPS----FPSLSAANLVITLGSVVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYT-EKVSENAKQDLKDGLRLYNTDNNVGLRNAWNIIQAEWQCCGVTGLSDWHEALQEKSVPDRCCQEHYTECGRNT--TNVFWSQGCYEKVEEWLNDNKHLLGTIAMCVLVL---QLLGMAFSMTL 226          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q9N0J9|CD81_SAGOE (CD81 protein OS=Saguinus oedipus OX=9490 GN=CD81 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.389e-16
Identity = 66/240 (27.50%), Postives = 109/240 (45.42%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLY--TRTSNH---DLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLK----ISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            + C  CI+  + V NF  +L G  ILG +++L    +T+N    +L   P   T +  I   I  +G   + +  +GC+GA  ESQ +LG +F+ ++ LFA +VA G   FV KD+ +  ++K     ++Q  +        +  + +  + L CCG  +++        +N+  S                N F + C  K  E    KL +I +  IV+  I    MI S+ LC  IR
Sbjct:    4 EGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILI-AVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQ-IAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLNCCGSSTLSALTTSMLKNNLCPS----------GSSIISNLFKEDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIR 231          
BLAST of Tetraspanin vs. TrEMBL
Match: C1L5Z0 (Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.376e-44
Identity = 82/243 (33.74%), Postives = 144/243 (59.26%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKL---TTNLKISIQNYMNSKITKQEEI-FLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHEC-KAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            K C  C+R+ +VV NF + LIG+A+LG S+++Y      D+  +       + +L  +MGIG  T+ ++L GC GAYHESQ +LG YF++++ +FA+QV   +L ++Y++E +      ++  I+ Y   +  ++  + F++S+Q+ML+CCGV+   DY       +IP +CCD+ I  C  A ++ +  +  GCKDKYK   + KL +I +  + +   E   ++FS+ +C +IR   ++ Y
Sbjct:    2 KGCVQCLRVILVVFNFLVVLIGLAVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDY-----RESIPIACCDHHISTCLNALLKPEEVYKDGCKDKYKAMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSDYY 239          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A095A6B6 (Tetraspanin OS=Schistosoma haematobium OX=6185 GN=MS3_09698 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.293e-44
Identity = 81/243 (33.33%), Postives = 144/243 (59.26%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKL---TTNLKISIQNYMNSKITKQEEI-FLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHEC-KAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            K C  C+R+ +VV NF + LIG+A+LG S+++Y      D+  +       + +L  +MGIG  T+ ++L GC GAYHESQ +LG YF++++ +FA+QV   +L ++Y++E +      ++  I+ Y   +  ++  + F++S+Q+ML+CCGV+   DY       +IP +CCD+ +  C  A +  +  + +GCKDKYK   + KL +I +  + +   E   ++FS+ +C +IR   ++ Y
Sbjct:    2 KGCIQCLRVILVVFNFLVVLIGLAVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDY-----RESIPIACCDHHVSTCLNALLSPEEVYKEGCKDKYKVMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSDYY 239          
BLAST of Tetraspanin vs. TrEMBL
Match: Q86D97 (Tetraspanin OS=Schistosoma mansoni OX=6183 GN=Smp_095630 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.073e-43
Identity = 80/243 (32.92%), Postives = 144/243 (59.26%), Query Frame = 3
Query:   96 KKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKL---TTNLKISIQNYMNSKITKQEEI-FLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHEC-KAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            K C  C+R+ +VV NF + LIG+++LG S+++Y      D+  +       + +L  +MGIG  T+ ++L GC GAYHESQ +LG YF++++ +FA+QV   +L ++Y++E +      ++  I+ Y   +  ++  + F++S+Q+ML+CCGV+   DY       +IP +CCD+ +  C  A +  +  + +GCKDKYK   + KL +I +  + +   E   ++FS+ +C +IR   ++ Y
Sbjct:    2 KGCIQCLRVILVVFNFLVVLIGLSVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDY-----RESIPIACCDHHVSTCLNALLSPEEVYKEGCKDKYKVMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSDYY 239          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A0X3PRD7 (Tetraspanin (Fragment) OS=Schistocephalus solidus OX=70667 GN=CD9 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.114e-39
Identity = 77/244 (31.56%), Postives = 135/244 (55.33%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLT---TNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECK-AKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            M   C  C+RIF+V+ NF + LIG+ ILG ++F Y   +  +L  +         ++  +MGIG  T+ ++L GC GAYHES  +L  YF+ ++ +F  QV   +L +VY+D+ L      ++  +  Y        +  F++SVQK+LKCCGV    DY      ++IP +CC+     C+   +E+++ +++GC  KYK+ ++  L +  ++I+ +   E  G+  S+ +C S+R  + + Y
Sbjct:   23 MGSACPQCLRIFLVIYNFLVVLIGLVILGFAVFAYLEPAAQELIEASGSRVIATTVIFILMGIGALTLIVALFGCCGAYHESAGLLATYFTFLIIIFTVQVVGATLGYVYRDQLLVDAEPTMRRGVDEYFQQLNPNTKVRFMDSVQKLLKCCGVTHPRDY-----RNHIPLACCNITTSSCQTTPIEEEHVYSEGCIRKYKQVAEEFLHIFFLVIVGITVFEIFGLFTSIIMCCSVRKYNTDYY 261          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A4E0S3E5 (Tetraspanin OS=Fasciola hepatica OX=6192 GN=D915_000412 PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.519e-37
Identity = 89/245 (36.33%), Postives = 140/245 (57.14%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNY-MNSKITKQEE---IFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKA-KVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            M   C  C+R+ +VV NF + L+G+ ILG S+++       D+  +  HY   + IL  +MGIG  T+  +L GC GAYHESQ +LG YF+V++ +FA+QV   +L +V+++E L    +  +Q    +S +  Q E    F+ S+Q+MLKCCG    +DY        IP +CCD  +  C + K+E    + +GC DKYK   + KL +I +I + +   E L ++FS+A+C  IR   ++ Y
Sbjct:    1 MMMGCVQCLRLLLVVFNFFVVLVGLFILGFSVYVSQEPEAQDIIIATGHYHAVQVILYVLMGIGGITLITALFGCCGAYHESQCLLGAYFAVLIVIFAAQVTGATLGYVFREELLNYVDERMLQGVEEHSTLRDQRERPTTFMESIQRMLKCCGFSGPSDY-----KYAIPVACCDRHVSNCDSWKIELTEVYKEGCGDKYKAMLKDKLVIIFLITVSIAAFEILCILFSMAMCCLIRQYHSDYY 240          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: zgc:64051 (leukocyte surface antigen CD53-like [Source:NCBI gene;Acc:103036604])

HSP 1 Score: 91.2781 bits (225), Expect = 7.502e-21
Identity = 66/227 (29.07%), Postives = 112/227 (49.34%), Query Frame = 3
Query:  102 CFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            C  C++  + VVNF  F+ G  I G  IFL +  +   +  S         +  FI+GI  F   +S +G  GA  E++ +L  +F ++  +  +++ V     +Y+   D+ +   L  S++  M +  +  E    ++VQK  KCCGV +  D+      +N+P SCC  E   C+ K      + +GC  K +++ +  L    + IIV+C+IE LGM FS+ L
Sbjct:    3 CLKCLKYTMCVVNFIFFICGAGIFGLGIFLKSTANLSVIAPSIPAVNVVNGL--FILGI--FITCVSFLGFLGALKENRCLLISFFILLFLVMLAELGVACFLLMYESQIDKTIEGELNKSLEEAMKNNGSNIE---WDTVQKTFKCCGVKNATDW-----KNNVPKSCCKTE--SCEEK------YNQGCYKKLQDWFEGNLLSTGIGIIVVCSIEVLGMCFSMTL 209          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82a (CD82 antigen [Source:NCBI gene;Acc:103021753])

HSP 1 Score: 85.5001 bits (210), Expect = 1.569e-18
Identity = 61/248 (24.60%), Postives = 114/248 (45.97%), Query Frame = 3
Query:  102 CFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD--EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSN-----IPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            C     +F ++ NF++ +    I+G    L+    N          ++  K+ ++I+ G+G F++ +  VGC GA +E + +LG+YF+ +L +  +QVA   L +  ++     T+N+   +    N +  K  E   + +Q+ ++CCG     D+++     N      P SC +  +          C+A+ +    +  GC    + +     GVI  I + +  IE LGMI S+ LC S+   D
Sbjct:    6 CASVALVFFLIFNFSILISCALIMGFG--LWILLDNQSFIAVLQDSSKALKVGSYILIGVGSFSMLMGFVGCLGAIYEVRCLLGLYFTCLLLILIAQVAAAVLIYFQRNLLRTETSNIVTKLLENYNGQ-NKTAEQAWDYIQRNMRCCGWTGPEDWMRNPVIVNSSQMLYPCSCRNTSVPGDNGTNSGFCEAQSDNWPNYDTGCMISVESWLFTNYGVILGICLGVAVIELLGMILSMGLCKSVHQED 250          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan9a (tetraspanin-9-like [Source:NCBI gene;Acc:103032257])

HSP 1 Score: 82.4185 bits (202), Expect = 1.390e-17
Identity = 65/238 (27.31%), Postives = 117/238 (49.16%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILA--FIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQN-----YMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEF---SQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            M++ C  C++  + + N   +L G  +LG  I+L     +   T SP     F  + A   ++ IG   +    +GC GA  E++ +L  +F V+L +  +++ +  L+FVY + K++ N K  +++     Y ++ I  +     N +Q   KCCGV    D+ +      +P  CC     +C   V  +  + +GC +K +E+   ++H LG I M I+V   ++ LGM FS+ L
Sbjct:    1 MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLAVSQGSF-ATFSP----SFPSLSAANLVIAIGAIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYSN-KVSENAKKDLKDGLALYYSDNNIGLRNA--WNIIQAEWKCCGVTGFTDWHEALKEKVVPDRCCQEHYQDCGRNVTNE-FWKRGCFEKVEEWLDDNKHLLGTIGMCILV---VQLLGMAFSMTL 226          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82a (CD82 antigen [Source:NCBI gene;Acc:103021753])

HSP 1 Score: 82.4185 bits (202), Expect = 1.808e-17
Identity = 64/252 (25.40%), Postives = 115/252 (45.63%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD--EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSN-----IPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            M K C    + F+ + N   F+ G  I+G    L+    N          ++  K+ ++I+ G+G F++ +  VGC GA +E + +LG+YF+ +L +  +QVA   L +  ++     T+N+   +    N +  K  E   + +Q+ ++CCG     D+++     N      P SC +  +          C+A+ +    +  GC    + +     GVI  I + +  IE LGMI S+ LC S+   D
Sbjct:    1 MGKGCITATKYFLFLFNLLFFIFGALIMGFG--LWILLDNQSFIAVLQDSSKALKVGSYILIGVGSFSMLMGFVGCLGAIYEVRCLLGLYFTCLLLILIAQVAAAVLIYFQRNLLRTETSNIVTKLLENYNGQ-NKTAEQAWDYIQRNMRCCGWTGPEDWMRNPVIVNSSQMLYPCSCRNTSVPGDNGTNSGFCEAQSDNWPNYDTGCMISVESWLFTNYGVILGICLGVAVIELLGMILSMGLCKSVHQED 249          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82b (CD82 antigen-like [Source:NCBI gene;Acc:107197274])

HSP 1 Score: 79.337 bits (194), Expect = 2.506e-16
Identity = 66/254 (25.98%), Postives = 119/254 (46.85%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD----EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVD-----SVNDYIKKDTPSNIPFSCCD-----YEIHE---CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYAD 797
            M K C    + F+ + N   F+ G  I+G    L+    N          +   K+ ++I+ G+G  ++ +  +GC GA +E + +LG+YF+ ++ +  +QV    L +  +D    E  T   KI +     +K T+    +L   QK ++CCG       + N +IK  +    P SC +      E+ E   C++ V +   +TKGC    +++     GVI  + + +  +E LGM+ S+ LC S++  D
Sbjct:    1 MGKGCITATKYFLFLFNLLFFIFGALIMGFG--LWVLLDNQSFIAVLQESSSTLKVGSYILIGVGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLVLILIAQVTAAVLIYFQRDLLKREISTVVNKILVGYTGQNKTTEHAWDYL---QKTIQCCGWTGPSNWTENVWIKNSSQILYPCSCRNESIPGSEVQESGLCQSLVPEWPVYTKGCMSSVEDWLLSNCGVILGVCVGVAVLELLGMMLSMCLCKSVQQED 249          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005284.1 (pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 gene:ENSPMAG00000004798.1 transcript:ENSPMAT00000005284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.706e-13
Identity = 66/258 (25.58%), Postives = 124/258 (48.06%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFL--IGIAILGTSIFLYT---RTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFL-FASQVAVGSLYFVYKDE---KLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIK--------KDTPSNIPFSCCDYEIHEC-KAKVEKKNA----FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAV 818
            CI+  V++ N   +L  +G+ I+G    ++         +L+ +P            I+ +G+    ++  GC GA+ ES  ++   FSV LFL F +++A G   +++KD+    + T  K+ I +Y     TK ++  ++++QK L+CCGV    D+           + P+++P SCC      C +  +  KNA    +TKGC +K +   +  + ++  + I +   + +G+I +  L   I+    N Y AV
Sbjct:   17 CIKYLVLLFNLLFWLSGLGLIIVGAMAQMHIGAFSVVTGNLSGAP----------YVIIAVGVVIFVVAAFGCCGAHKESYFMVAT-FSVFLFLIFVAELAAGIGAYIFKDQLRDVVETKAKVVINDYP----TKNKDP-VDNMQKELQCCGVVHYQDWFNSTNWVTSDPNNPNSVPDSCCLNVTSGCGQDDIRFKNATAIIYTKGCVEKLEATMKENIVLVGGVAIGIGFAQLIGIILACCLMRGIK----NSYQAV 254          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan4a (tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38])

HSP 1 Score: 67.781 bits (164), Expect = 2.801e-13
Identity = 54/225 (24.00%), Postives = 105/225 (46.67%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDE---KLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCC-DYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            CIR F+ ++  + + +G   +       + T  +  T SP  +  F      ++  G   + +  +GC GA  E + +L  +F  +L +F  ++    L+F+Y+D+       +LK  ++ Y +         + N VQ    CCGV +  D+        +P SCC +Y + +C  + +    +  GC DK + + +  L V+ + I+ +  I+ LGM FS+++
Sbjct:    2 CIRGFLCLLLLSFWCLGGCGILGIGIWLSVTQGNFATLSPS-FPSFSAA-NILISTGTIMMVVGFIGCLGAIKEHKCLLLSFFVCLLIIFVLEMICVILFFMYRDQIDGHAKDDLKEGLRLYGSEGNVGLTNAW-NIVQTDFHCCGVVNHTDWFLAFGDKRVPDSCCMEYSV-DC-GRDKPNTWWPSGCYDKVEAWIEENLMVLGVFILCISLIQILGMAFSMSM 221          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan4a (tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38])

HSP 1 Score: 65.0846 bits (157), Expect = 2.303e-12
Identity = 59/241 (24.48%), Postives = 110/241 (45.64%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIF---LNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNN 803
            M + C +C++  + V N   +L G  +LG  I+L + T       SP+           ++ +G   + L  +GC GA  E+  +L  +F ++L +F ++   G L+FVY+  KL T  +  ++  ++   T+         N++   + CCGV +  D+        +P SCC      C   V        GC +K K + +  L  + +  + + TI+ LGM+FS+ +   +R  + +
Sbjct:    3 MGRACHYCLKYLLFVFNLVFWLGGCGVLGVGIWL-SITQGGVAAVSPN--LPLLSAANLLIALGAAAMLLGFLGCLGAIKENPCLLLTFFVLLLVVFLAEFVGGVLFFVYQG-KLETRAQDDLRQGLHLYGTEGNVGLTNAWNTLHSEVGCCGVHNHTDWFAVFGERRVPDSCCRDPASGC-GSVPSSAYARPGCYEKLKSWIKDNLAYVGIFCLGIATIQILGMVFSMTMFCHLRAEEKD 238          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 65.0846 bits (157), Expect = 3.312e-12
Identity = 49/202 (24.26%), Postives = 96/202 (47.52%), Query Frame = 3
Query:  225 SPDHYTEFKKILA---FIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDE-KLTTNLKIS-IQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTP-------SNIPFSCCDYEIHECKAKVEKK-NAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIE-FLGMIFSVALCFSIR 788
            S  H+ E + +L     ++ +GIF   + +VGC     ES+  L  +F ++L +F+ +V    L + Y+ + K      IS + N  N   +      ++ VQ  LKCCGV +  D+  KD P       +++P SCC   +  C   ++   + + +GC+   ++  +  L  +  + ++   ++ ++  I SV +C  +R
Sbjct:   42 SYRHFLEDRYVLLAPLVVVAVGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNGTDSNTASRAIDYVQHQLKCCGVKNYLDW--KDRPWFNHTGNNSVPISCCRSNVTHCDGNIKHPGDIYNEGCEAMVEKTVKDILNYVMRVALIYALVQGYILGIKSVRVCVCVR 241          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 64.6994 bits (156), Expect = 4.112e-12
Identity = 60/245 (24.49%), Postives = 106/245 (43.27%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHD--LTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITK------QEEI--FLNSVQKMLKCCGVDSVNDYIKKD-------TPSNIPFSCCDYEIHECKAKVEKKN--AFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C++  ++V NF  +L G  ++   ++      ++   L  S    T +  ILA     G   +   L+GC     E +  L  Y  ++L +F  +V  G L ++Y+ ++L+  LK    ++MN  I +      Q+ +   ++ +Q+  KCCG    ND+ + D           +P SCC      C  +    N      GC  K +   Q  L +I  + I +  ++ LGMI +  L  SI+
Sbjct:   16 CLKYVLLVFNFIFWLTGAGVMAVGVWTLVEKGDYLSLLASSTFAATAYILILA-----GSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYR-QQLSEELK----SHMNKTIVESYGQPDQQRVTDAMDKLQQEFKCCGSHDWNDWQRSDWVKVAAAEGRLVPDSCCKSPTTRCGRRDHPSNINRVEGGCITKLEVILQEHLLLIGAVGIGVACLQVLGMILTCCLYRSIK 250          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE9])

HSP 1 Score: 88.1965 bits (217), Expect = 5.614e-20
Identity = 61/231 (26.41%), Postives = 117/231 (50.65%), Query Frame = 3
Query:  108 HCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEE---IFLNSVQKMLKCCGVDSVNDYIKKDTP------SNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
             CI+  +   NF  FL G+ ++   I++  +T ++   +S  + T +  ++A     G     +S  GC GA  ES+ +L  +F+++  + A++ A  +L FVY+D K+   L+  + N ++S   K +E   +  + +QKM KCCG++   D+  + TP      + +P SCC  E  +C +   + +  TKGC     +  +  L ++  + + +  I+ L M F++ L
Sbjct:    8 KCIKRTLFFFNFIFFLAGLGLMAVGIYVQLKTGDYIDLQSVKYATGYIIVIA----AGALIALISFFGCCGAIKESRCLLAAFFTLLFIILATEAAGTALGFVYRD-KVNQKLRQDMNNTLDSYGQKGKEGITLAYDLIQKMEKCCGINGYEDW--QQTPFANGSSTLVPDSCCKKETKDCGSNFAQDDINTKGCLGTIMKLLKDNLMIVGGVGVGVAVIQILAMTFAMVL 231          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 82.0333 bits (201), Expect = 7.456e-18
Identity = 66/239 (27.62%), Postives = 108/239 (45.19%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIM-GIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFAS---QVAVGSLYFVY------KDEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYI----KKDTPSN--IPFSCCDYEIHE--CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            C++  + V NF  +L G+A+LG  I+        D       Y+    I A+ M G G F   +   GC GA  ES+ +L  +   +L +  S   QV +  LY  +        E++  NL   I+N        + E  +N++Q  LKCCG +   D++    K+D   +  +P SCC    ++  C      K  ++ GC ++ K F    + +I  I + +  ++ LGMIFS  L
Sbjct:    6 CMKYLLFVFNFFFWLSGLAVLGIGIWTKVDAGQFDSFLGSSGYS----IPAWTMIGAGAFVTFVGFFGCCGAVKESRCMLATWLKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYG--YDSEVESHINNLQIRLKCCGGERPGDWLGSKWKRDLNKDKIVPLSCCTENANKTTCYKDDTYKEVYSSGCVNELKTFVDKHMILIGAIAVGISIVQLLGMIFSCCL 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE8])

HSP 1 Score: 78.9518 bits (193), Expect = 7.944e-17
Identity = 63/229 (27.51%), Postives = 115/229 (50.22%), Query Frame = 3
Query:  108 HCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVND----YIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVAL 773
            +CI+  V + NF  FL G+ ++G  I++  +  ++   +S  + T    I+A    +G F   +S  GC GA  E + +L  +F+++  + A ++   +L +VY+   +E+L  ++  +I +Y         + + +++QK  KCCG++   D    Y  K   S +P SCC      C    ++ + +TKGC D  K   +  L +I  I I +  I+ L MIF++ L
Sbjct:    8 NCIKYMVFLFNFIFFLGGVGLMGVGIYVQLKIGDYVELQSVKYITGSIIIIA----VGAFIALVSFFGCCGAIKEHRCLLATFFALLFIILAVEITGTALGYVYRNKVEEQLGKDMNDTIVSYGEKGKEGITDAY-DAIQKKEKCCGINGFKDWQRSYYTKGNHSIVPDSCCKTVSKGCGINFKENDIYTKGCFDTVKTLLKDNLIIIGGIGIGVAVIQILAMIFAMVL 231          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 78.9518 bits (193), Expect = 8.059e-17
Identity = 66/240 (27.50%), Postives = 118/240 (49.17%), Query Frame = 3
Query:  108 HCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTT-----NLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGV-----DSVND-YIKKDTPSNIPFSCCDYEIHECK-AKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRY 791
             C++  +   NF  ++ GIA++  S+ ++TR S ++   S    + F      ++  G   + +  VGC GA  E++  L +YF ++L +F  ++A G L +  +D+ +++     N  IS+ +Y  S   K  +  ++  Q + KCCG      D  N  + K +T   +P SCC  +   C  A  +    + KGC    ++F +  +  +  I + +  I+ LGMIFS+ L  SIRY
Sbjct:    7 QCMKYLLFAFNFVFWIAGIAVM--SVGIWTRVSANEYA-SLMGQSGFTAAANIMIAAGALVMFIGFVGCCGAVKENKCFLLLYFFLLLVIFVLEIASGILAYTKRDKVISSVEKALNQSISL-DYGQSNKEKATKA-VDRAQSIFKCCGATQGPKDWANTAWAKSNTNQTVPESCCKKKAAGCNGAPADSDTYYQKGCSQGLQDFIKSHMKTLGGIGLGIAIIQILGMIFSLCLFRSIRY 241          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 77.0258 bits (188), Expect = 4.375e-16
Identity = 51/173 (29.48%), Postives = 87/173 (50.29%), Query Frame = 3
Query:  300 SLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNS-KITKQEEI--FLNSVQKMLKCCGVDSVNDYIK----KDTPSNIPFSCC-DYEIHECKAKVEKKNA--FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            + + C GA  ESQ +LG YF ++  +F  +V    L +VY+ E++  NL   I++ MN   ++  + +   ++ + +  KCCG     D+ +    K  P  +P SCC D    +C   + K     + +GC    K++  + L VIS   I +  I+ +G+IF+  LC  IR
Sbjct:   61 AFLACCGALKESQCMLGTYFGLVTAIFCLEVTAIVLAYVYR-ERIEKNLHGDIRSTMNEYHLSGHDAVTRAIDEIHRDFKCCGNAQYRDWFETKWAKTHPDMVPRSCCKDPSDSKCNENISKDPTKIYRRGCYMFVKKYLSNNLHVISGFGIWIAVIQLMGIIFATCLCCHIR 232          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan2b (tetraspanin-2 [Source:NCBI gene;Acc:101157617])

HSP 1 Score: 80.1073 bits (196), Expect = 5.468e-17
Identity = 63/228 (27.63%), Postives = 101/228 (44.30%), Query Frame = 3
Query:  108 HCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSV-QKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
             C++  +   NF  +L+G  +L   ++L        L         F   +  ++G G   + +   GC GA  ESQ +LG +F+ +L +F S+VA G   F+ KD+ +        QN+   + ++     L S+ Q MLKCCG           +P      C D E              TK C+ + KEF  +KL +I  + I +  +  +GMIFS+ LC +I 
Sbjct:    9 KCVKYLLFGFNFIFWLMGSFVLAVGLWLRFDPKTAALLTGNGAPDTFFIGVYILIGAGSLVMMVGFFGCCGAVRESQCLLGSFFACLLIIFGSEVAAGVFAFLSKDKIID-----DAQNFYKKEYSENNNSTLISIYQDMLKCCGT--------AQSP------CPDSEPD------------TKNCETEIKEFLSNKLFIIGCVGIGIAGVMTIGMIFSMVLCCAIH 205          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan36 (tetraspanin-36 [Source:NCBI gene;Acc:101167371])

HSP 1 Score: 80.8777 bits (198), Expect = 5.712e-17
Identity = 55/189 (29.10%), Postives = 99/189 (52.38%), Query Frame = 3
Query:  267 IMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSV---QKMLKCCGVDSVNDYIK----KDTPSNIPFSCCDYEIHECKAKVEKKNA-FTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGY 809
            I+ I +  +   LVGC     ES+  L ++F +++ +FA++VA   L F+Y   K+  NL+ S+ +   SK T +E+    +V   QK L+CCGV +   +          +++P SCC   + +C  ++++ N  +T+GC+ K + F Q  L    ++++    I+F GM+ SV +      +  NGY
Sbjct:   56 IICISVVMLIFGLVGCCSTLRESKFGLTLFFIIIMVIFAAEVAALVLTFIYHG-KINQNLEHSMNDTF-SKYTGEEDAATKAVDLLQKQLQCCGVLNYTSWTSTTWFASHNNSVPISCCRSNVSQCTGRLDQPNLIYTEGCEVKLERFLQDALTYAMLVVLGFAIIKFFGML-SVCVITCKSKSRRNGY 241          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd9a (CD9 antigen [Source:NCBI gene;Acc:101173781])

HSP 1 Score: 77.0258 bits (188), Expect = 7.571e-16
Identity = 62/229 (27.07%), Postives = 98/229 (42.79%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEI--FLNSVQKMLKCCGVDSVNDYIKKDT-PSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C++  +   N   +L G  +L   ++L     N  L    +    F   +  ++G G   + +  +GC GA  ES  +LG++F  +L LFA +VA G   F  + + +       +Q Y +   T  E +   L  +Q  LKCCG     D   K+T P   P                 +    K C D  +E    KL +I+++ I M  +   GMIFS+ LC +IR
Sbjct:   10 CVKYLMFAFNLVFWLAGTTVLAIGLWLRLDPQNKVLLEEENSPYAFYAGVYVLIGAGALIMVVGFLGCCGAIRESPCMLGVFFFFLLILFAIEVAAGIWGFSNQTKVVEDISSFYMQTYKDYTSTGDERVKETLRLIQAQLKCCGPGKDTDESFKETCPRGEPL----------------EELLIKSCPDAIEEVFDSKLHIIAVVGITMGVVMVFGMIFSMLLCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000000775.2 (CD82 antigen [Source:NCBI gene;Acc:101156312])

HSP 1 Score: 77.411 bits (189), Expect = 8.731e-16
Identity = 58/226 (25.66%), Postives = 106/226 (46.90%), Query Frame = 3
Query:  159 GIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYM-NSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSN-----IPFSCCDYEIHE--------CKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSI 785
            G  ILG  ++L     N       ++ T+ K     ++ +G F++ L L GC GA  + + +LG+YF+ +L +  +Q+A G L ++ K+   E+++  +   + +Y  NS  T+Q     + +QK ++CCG     D+       N      P SC +  +          C+A+      +  GC    + +    +GV+  I + +  IE LGMI S+ LC ++
Sbjct:   24 GGVILGFGLWLLL--DNQSFIVIINNSTDVKVACYVLISVGAFSMLLGLFGCLGAIFQIKCLLGLYFTCLLVILVAQIAAGVLVYLQKEKVNEQMSKIVDKVLGSYAGNSSRTEQA---WDLIQKKMQCCGWMGQEDWNNNAVILNSSQLLFPCSCQNLTLTVQNRSDSGFCEAQTPDWPVYNVGCSASVENWLITNIGVVLGICLTVALIELLGMILSICLCRNV 244          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 76.2554 bits (186), Expect = 2.151e-15
Identity = 63/233 (27.04%), Postives = 114/233 (48.93%), Query Frame = 3
Query:  111 CIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEK---LTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSN-IPFSCCDYEIHECKAKVEKKNAFT---KGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 788
            C++  +V  NF  +L G+A++   I +  + S H+  +  D       I   I+ +G     ++  GC GA+ E   ++  +  ++  +   ++A     FV++++    +   L   I+NY N   T   +  ++ +Q+ LKCCGV+S +D+   D+  N +P SCC  +   C  K   KNA T   KGC D  +   +  +  + +  IV+  ++ LG++FS  L  SIR
Sbjct:    9 CVKFSLVFFNFICWLCGLALVVVGIMV--QVSLHNTLKIKD--VSMSGIPIVIIAVGALIFFIAFFGCCGAWKEHYCMVTTFAVLLTLIIIIEIAAAIAGFVFRNKISPIVNEGLTKMIENYKNG--TDDFKATVDQIQENLKCCGVNSSSDWSYLDSDGNSVPDSCCINKTKGC-GKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAAIVIALVQILGVVFSCLLMKSIR 234          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000035080.1 (SMESG000035080.1)

HSP 1 Score: 508.064 bits (1307), Expect = 0.000e+0
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTRSMVI 836
            MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTRSMVI
Sbjct:    1 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTRSMVI 249          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000043678.1 (SMESG000043678.1)

HSP 1 Score: 115.931 bits (289), Expect = 7.594e-30
Identity = 81/248 (32.66%), Postives = 130/248 (52.42%), Query Frame = 3
Query:   90 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQE--EIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTRS 827
            M K C  CIRI +++ NF   L G+ + G  ++ Y  +   ++       T F       MGIG FT+ +   GC GAYHES  +LG YF  +L +FA+++A G L  +YKD K+ + + +  Q       +K +  E ++N VQ+ +KCCG    +DY K      +P SCC        +K E  + +T+GC+  + E  Q+   + + I++ +  IE LG+IFS+ LC + R  + +  M  TR+
Sbjct:    1 MCKACHSCIRILMMIFNFIFVLCGLGLFGLGLYFYLTSFFKNMGAEG---TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYFIFLLLIFAAEIAAGVLVVLYKD-KVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK------VPGSCCS------TSKCE--DPYTRGCESAWTELIQNNWVIFASILLGIPLIELLGLIFSMCLCCTARSIEYD--MVETRA 228          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000020341.1 (SMESG000020341.1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.988e-17
Identity = 51/177 (28.81%), Postives = 94/177 (53.11%), Query Frame = 3
Query:  258 LAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKD---EKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCF 779
            + F++ IGI  IA+SL+G F    E   +L ++  +++ +   Q +     FVYK+   ++    +  + +N +N    K  + F + +Q+  KCCG+++ NDYI  +  + IP SCC   I  C     +  AF KGC+   + F  + L  +++++I +C I+ + +IF+   CF
Sbjct:   51 VTFVLAIGIIVIAISLLGLFAGCSERNCLLTVFGVLLILILLIQFSAAVTTFVYKNNIVKEFDNTMNTTFKNALNGN--KGSKDFFDKIQQKYKCCGLNNANDYIFNN--AEIPKSCCG-NIKNC----TELEAFKKGCEKPTEAFVSYVLTTMALVVICLCIIDVIQIIFT--FCF 216          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021627.1 (SMESG000021627.1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.286e-15
Identity = 67/240 (27.92%), Postives = 116/240 (48.33%), Query Frame = 3
Query:  117 RIFVVVVNFTLFLIG-IAILGTSIFLYTRTSNHDLTRSPDHYTEFKK----ILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYM-----NSKITKQEEIFLNSVQKMLKCCGVDSVND------YIKKDTPSNI-PFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALC 776
            +  +++ N   +L G I I+  SI+L     +++ T+  +   +F      I   ++GI IF IA    GC GA  ES+ +LG+Y   ++ +   QVA+G     YK   ++ ++  LK +I         N KIT       +++Q++L CCG++   D      YI+K   S + P SCC  +  EC  K+    AF++GC  + +E+ Q    +   +I+ +   E   +I +  LC
Sbjct:   11 KCLLIIFNVVFWLSGLILIVIPSIYL-----SNEKTKIVEKLDKFNSRGLFIGVLVLGIIIFVIAFC--GCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKIT-------DNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCR-DNAECYNKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 235          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000008659.1 (SMESG000008659.1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.416e-15
Identity = 69/225 (30.67%), Postives = 106/225 (47.11%), Query Frame = 3
Query:  138 NFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYK---DEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCC-DYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADN 800
            N   F+ GI I   S+ +Y R S   L+   +H+T       FI  IG+     S +GC+GA  ES  +L ++  V+ F+F   +A G     +K   D+K+  +L   +     +  TK +   ++ +Q  L+CCGV S  DY++K      P SC  DY     K          KGC +  KEF +  +  I  + I +  I  LGMI S+ LC +I+ A+ 
Sbjct:   21 NLISFIFGIVIF--SVGIYARISEQYLSID-EHFT---GAYLFIF-IGLIITITSFLGCYGAISESPCLLILFSMVIFFIFVVLMAAGLWAIAHKQKIDKKIGNSLSEIVGKISVNTATKDQIKIMDKIQNELQCCGVISHIDYVEKP-----PLSCGNDYITISTK----------KGCHESIKEFLKVNINKIIGLAIFVGIIMLLGMICSIMLCCAIKEAEK 223          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPAN93.137e-1626.69tetraspanin 9 [Source:HGNC Symbol;Acc:HGNC:21640][more]
TSPAN93.137e-1626.69tetraspanin 9 [Source:HGNC Symbol;Acc:HGNC:21640][more]
CD813.472e-1626.97CD81 molecule [Source:HGNC Symbol;Acc:HGNC:1701][more]
CD825.924e-1526.34CD82 molecule [Source:HGNC Symbol;Acc:HGNC:6210][more]
CD93.063e-1427.16CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsp-61.633e-1327.71Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0][more]
tsp-82.650e-1321.61Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q19983][more]
tsp-131.738e-723.33Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3][more]
tsp-211.820e-724.77Tetraspanin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-211.820e-724.77Tetraspanin-21 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp96F4.314e-2125.77gene:FBgn0027865 transcript:FBtr0330164[more]
Tsp96F4.314e-2125.77gene:FBgn0027865 transcript:FBtr0084912[more]
Tsp96F7.317e-2126.15gene:FBgn0027865 transcript:FBtr0330163[more]
Tsp5D2.432e-1725.10gene:FBgn0029837 transcript:FBtr0114466[more]
Tsp5D2.432e-1725.10gene:FBgn0029837 transcript:FBtr0070888[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd82a4.781e-2128.85CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82a4.781e-2128.85CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82a4.781e-2128.85CD82 molecule a [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
tspan2a1.305e-1926.61tetraspanin 2a [Source:ZFIN;Acc:ZDB-GENE-050522-51... [more]
tspan2a1.305e-1926.61tetraspanin 2a [Source:ZFIN;Acc:ZDB-GENE-050522-51... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd822.307e-1827.39CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd823.748e-1827.63CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd95.223e-1826.50CD9 protein [Source:NCBI gene;Acc:549743][more]
cd1511.878e-1725.94CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
cd1517.531e-1725.31CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd92.524e-1925.88CD9 antigen [Source:MGI Symbol;Acc:MGI:88348][more]
Cd822.493e-1626.89CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd822.493e-1626.89CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd822.493e-1626.89CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd822.493e-1626.89CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40240|CD9_MOUSE1.766e-1825.88CD9 antigen OS=Mus musculus OX=10090 GN=Cd9 PE=1 S... [more]
sp|P30932|CD9_BOVIN2.084e-1826.32CD9 antigen OS=Bos taurus OX=9913 GN=CD9 PE=2 SV=2[more]
sp|P40241|CD9_RAT6.512e-1826.96CD9 antigen OS=Rattus norvegicus OX=10116 GN=Cd9 P... [more]
sp|Q6GMK6|TSN9_DANRE2.501e-1627.00Tetraspanin-9 OS=Danio rerio OX=7955 GN=tspan9 PE=... [more]
sp|Q9N0J9|CD81_SAGOE4.389e-1627.50CD81 protein OS=Saguinus oedipus OX=9490 GN=CD81 P... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1L5Z03.376e-4433.74Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 ... [more]
A0A095A6B66.293e-4433.33Tetraspanin OS=Schistosoma haematobium OX=6185 GN=... [more]
Q86D972.073e-4332.92Tetraspanin OS=Schistosoma mansoni OX=6183 GN=Smp_... [more]
A0A0X3PRD72.114e-3931.56Tetraspanin (Fragment) OS=Schistocephalus solidus ... [more]
A0A4E0S3E52.519e-3736.33Tetraspanin OS=Fasciola hepatica OX=6192 GN=D915_0... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:640517.502e-2129.07leukocyte surface antigen CD53-like [Source:NCBI g... [more]
cd82a1.569e-1824.60CD82 antigen [Source:NCBI gene;Acc:103021753][more]
tspan9a1.390e-1727.31tetraspanin-9-like [Source:NCBI gene;Acc:103032257... [more]
cd82a1.808e-1725.40CD82 antigen [Source:NCBI gene;Acc:103021753][more]
cd82b2.506e-1625.98CD82 antigen-like [Source:NCBI gene;Acc:107197274][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005284.12.706e-1325.58pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 ... [more]
tspan4a2.801e-1324.00tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38... [more]
tspan4a2.303e-1224.48tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38... [more]
tspan3a3.312e-1224.26tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
CD1514.112e-1224.49CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475935.614e-2026.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359387.456e-1827.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475927.944e-1727.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359178.059e-1727.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468874.375e-1629.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan2b5.468e-1727.63tetraspanin-2 [Source:NCBI gene;Acc:101157617][more]
tspan365.712e-1729.10tetraspanin-36 [Source:NCBI gene;Acc:101167371][more]
cd9a7.571e-1627.07CD9 antigen [Source:NCBI gene;Acc:101173781][more]
ENSORLT00000000775.28.731e-1625.66CD82 antigen [Source:NCBI gene;Acc:101156312][more]
cd632.151e-1527.04CD63 molecule [Source:NCBI gene;Acc:101174188][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035080.10.000e+0100.00SMESG000035080.1[more]
SMESG000043678.17.594e-3032.66SMESG000043678.1[more]
SMESG000020341.12.988e-1728.81SMESG000020341.1[more]
SMESG000021627.15.286e-1527.92SMESG000021627.1[more]
SMESG000008659.16.416e-1530.67SMESG000008659.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017944 ID=SMED30017944|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1309bp
CTAAAACAAATCATTATTGGAGGAAAATTTAAATATGTTTACAAATATTC
GCCATTAACTTACCCAGCTGATTTCAATATTAAATTTTGATGTCAAAAAA
GTGCTTTCATTGCATTCGAATTTTCGTTGTAGTGGTGAATTTTACTCTTT
TTTTAATTGGAATTGCTATTCTTGGTACATCGATCTTTTTATACACAAGA
ACTTCCAATCATGATTTAACCAGATCACCAGACCACTATACGGAATTTAA
AAAAATATTGGCTTTTATAATGGGAATTGGAATATTTACTATAGCCCTGT
CTTTAGTTGGATGTTTTGGGGCATATCATGAATCTCAACCTATTCTTGGT
ATATACTTTAGTGTCATGTTATTTTTATTTGCAAGCCAAGTAGCAGTGGG
ATCACTGTATTTTGTTTATAAAGATGAAAAATTAACAACCAACCTCAAAA
TTAGTATACAAAATTATATGAATTCAAAAATCACAAAACAAGAAGAAATA
TTTCTTAATTCTGTACAGAAAATGTTGAAATGTTGTGGTGTCGACAGTGT
GAATGATTATATTAAAAAAGATACTCCTTCCAATATACCATTTTCATGTT
GTGATTATGAAATTCACGAATGTAAAGCTAAAGTTGAGAAAAAAAATGCA
TTTACCAAAGGTTGCAAAGACAAATACAAAGAATTCTCTCAACACAAACT
TGGTGTAATTTCAATGATCATTATCGTAATGTGCACCATTGAATTTCTCG
GTATGATTTTTTCAGTCGCTCTTTGTTTTTCCATTCGTTACGCAGACAAC
AATGGTTATATGGCAGTCACTCGTAGTATGGTAATATAAAAGCCATCGAC
TTTTTATTTCACCTTGACACCATGAATTCTTTCAAATATGAACTGGTTTA
TTATTATAATAAAAACAAACAAAAATCCTATAGTCAAAATTGCAATATTT
CAAACATAGGCGCGTGCGCGCGCTTCTCGTGTTGTGTTTAATCCGAATTT
CTGTTGTGATACTGCGCGCTGTACATGGTTTCTTGTTGAGATATCACGAT
AGAAATGGCCCGGTTCATGCGACACTGTGCAACAGACACACTCAGATGTT
TTGATTTCTTTGCCTAAACTAACAAATTTATTGATATATATATATATATA
TATACTATTGATTTCCAATGGTGAAGGTGGAATGATTATAATTATTAAAC
ACTTATTTGCAGTATTTTTAATGCTTAATTAATGTTGACTTTACGTGGTT
CATATGGCTTGCTTTTGTATTTTATTATTTTTGAAATGTCATGAAAAAAA
GATAACGGC
back to top

protein sequence of SMED30017944-orf-1

>SMED30017944-orf-1 ID=SMED30017944-orf-1|Name=SMED30017944-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHY
TEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQ
VAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQEEIFLNSVQKMLKCCG
VDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFS
QHKLGVISMIIIVMCTIEFLGMIFSVALCFSIRYADNNGYMAVTRSMVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 206..232
score: 27.74
coord: 11..34
score: 24.11
coord: 80..108
score: 27.07
coord: 53..79
score: 24.43
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..246
e-value: 3.5E-50
score: 168.1
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 111..203
e-value: 3.9E-10
score: 41.4
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 110..203
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 10..230
e-value: 4.4E-43
score: 147.6
NoneNo IPR availablePANTHERPTHR19282:SF263LEUKOCYTE ANTIGEN CD37coord: 2..233
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 2..233
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 108..204
e-value: 3.98693E-13
score: 61.3663
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 210..232
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 86..108