Metabotropic glutamate receptor 8

Overview
NameMetabotropic glutamate receptor 8
Smed IDSMED30017942
Length (bp)490
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 50.8322 bits (120), Expect = 2.288e-7
Identity = 43/144 (29.86%), Postives = 63/144 (43.75%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYIGLCPRMST-IDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 48.1358 bits (113), Expect = 1.840e-6
Identity = 43/144 (29.86%), Postives = 63/144 (43.75%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQ---TSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYIGLCPRMS-TIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Match: GRM8 (glutamate metabotropic receptor 8 [Source:HGNC Symbol;Acc:HGNC:4600])

HSP 1 Score: 48.1358 bits (113), Expect = 1.840e-6
Identity = 43/144 (29.86%), Postives = 63/144 (43.75%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQ---TSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYIGLCPRMS-TIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 46.595 bits (109), Expect = 6.145e-6
Identity = 41/161 (25.47%), Postives = 68/161 (42.24%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAP 467
            E F C      S  ++  +KC   ++I +        ++   I  +Y ++ + + ++K  C    G+  E+     GK LL+Y++ VNF G A   + FN+ GD    Y IFQ QT+    P    +G W  +  L +        V       C + C P
Sbjct:  370 ENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQA-GGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKP 529          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 46.595 bits (109), Expect = 6.270e-6
Identity = 41/161 (25.47%), Postives = 68/161 (42.24%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAP 467
            E F C      S  ++  +KC   ++I +        ++   I  +Y ++ + + ++K  C    G+  E+     GK LL+Y++ VNF G A   + FN+ GD    Y IFQ QT+    P    +G W  +  L +        V       C + C P
Sbjct:  370 ENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQA-GGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKP 529          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Match: grm6b (glutamate receptor, metabotropic 6b [Source:ZFIN;Acc:ZDB-GENE-021120-2])

HSP 1 Score: 46.595 bits (109), Expect = 3.793e-6
Identity = 31/82 (37.80%), Postives = 44/82 (53.66%), Query Frame = 3
Query:  171 LDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLN 401
            +D C  S+G+  ++    DG++LL Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W     L+LN
Sbjct:  397 IDLCPGSMGVCDKMDPV-DGRMLLTYIRAVNFNGSAGTGVMFNENGDAPGRYDIFQYQLSNTTNPGYKLIGQW--TNHLRLN 475          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Match: grm6b (glutamate receptor, metabotropic 6b [Source:ZFIN;Acc:ZDB-GENE-021120-2])

HSP 1 Score: 46.595 bits (109), Expect = 4.380e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  171 LDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVW 374
            +D C  S+G+  ++    DG++LL Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W
Sbjct:  436 IDLCPGSMGVCDKMDPV-DGRMLLTYIRAVNFNGSAGTGVMFNENGDAPGRYDIFQYQLSNTTNPGYKLIGQW 507          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Match: grm6b (glutamate receptor, metabotropic 6b [Source:ZFIN;Acc:ZDB-GENE-021120-2])

HSP 1 Score: 46.595 bits (109), Expect = 4.380e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  171 LDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVW 374
            +D C  S+G+  ++    DG++LL Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W
Sbjct:  436 IDLCPGSMGVCDKMDPV-DGRMLLTYIRAVNFNGSAGTGVMFNENGDAPGRYDIFQYQLSNTTNPGYKLIGQW 507          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Match: grm6b (glutamate receptor, metabotropic 6b [Source:ZFIN;Acc:ZDB-GENE-021120-2])

HSP 1 Score: 46.595 bits (109), Expect = 4.382e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  171 LDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVW 374
            +D C  S+G+  ++    DG++LL Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W
Sbjct:  440 IDLCPGSMGVCDKMDPV-DGRMLLTYIRAVNFNGSAGTGVMFNENGDAPGRYDIFQYQLSNTTNPGYKLIGQW 511          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Match: grm6b (glutamate receptor, metabotropic 6b [Source:ZFIN;Acc:ZDB-GENE-021120-2])

HSP 1 Score: 46.595 bits (109), Expect = 4.382e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  171 LDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVW 374
            +D C  S+G+  ++    DG++LL Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W
Sbjct:  440 IDLCPGSMGVCDKMDPV-DGRMLLTYIRAVNFNGSAGTGVMFNENGDAPGRYDIFQYQLSNTTNPGYKLIGQW 511          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Xenopus
Match: ENSXETT00000053241.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:79464981:79849474:-1 gene:ENSXETG00000017572.1 transcript:ENSXETT00000053241.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 4.220e-7
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLN 401
            + F C    +S       KKC + ++I          ++   I  +Y ++ + + + K  C  S+GL S +    DG  LL+Y+++VNF G+A   + FN+ GD    Y I+Q Q    STE   +G W     LK++
Sbjct:  358 DNFHCRLSRNSLRRGGHGKKCTNQERIGVGSAYEQEGKVQFVIDAVYSMAYALHTMHKTVCPGSVGLCSRMDPV-DGVELLKYIRSVNFTGIAGTPVTFNENGDAPGRYEIYQYQINNGSTEYRVIGQWADHLHLKID 494          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Xenopus
Match: ENSXETT00000053239.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:79387181:79787707:-1 gene:ENSXETG00000017572.1 transcript:ENSXETT00000053239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 4.269e-7
Identity = 40/138 (28.99%), Postives = 66/138 (47.83%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLN 401
            + F C    +S       KKC + ++I          ++   I  +Y ++ + + + K  C  S+GL S +    DG  LL+Y+++VNF G+A   + FN+ GD    Y I+Q Q    STE   +G W     LK++
Sbjct:  351 DNFHCRLSRNSLRRGGHGKKCTNQERIGVGSAYEQEGKVQFVIDAVYSMAYALHTMHKTVCPGSVGLCSRMDPV-DGVELLKYIRSVNFTGIAGTPVTFNENGDAPGRYEIYQYQINNGSTEYRVIGQWADHLHLKID 487          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Xenopus
Match: GRM8 (glutamate receptor, metabotropic 8 [Source:NCBI gene;Acc:100497088])

HSP 1 Score: 47.3654 bits (111), Expect = 3.705e-6
Identity = 43/162 (26.54%), Postives = 65/162 (40.12%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEI--IKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            E F C   +      +F KKC   ++I    +     ++  + D V     +++    D C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y I+Q Q    + E   +G W     L +         +      C + C P E
Sbjct:  370 ENFGCKLGSHGKRNNHF-KKCTGLERIGRHSSFEQEGKVQFVIDAVYSMAHALNNMHKDLCPGYIGLCPRMK-TIDGKELLSYIRAVNFNGSAGTPVTFNENGDAPGRYDIYQYQMTNKTAEYKVIGQWTNQLHLNVEDMQWTSREHTQPTSVCSLPCKPGE 529          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Xenopus
Match: GRM8 (glutamate receptor, metabotropic 8 [Source:NCBI gene;Acc:100497088])

HSP 1 Score: 46.9802 bits (110), Expect = 3.741e-6
Identity = 43/162 (26.54%), Postives = 65/162 (40.12%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEI--IKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            E F C   +      +F KKC   ++I    +     ++  + D V     +++    D C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y I+Q Q    + E   +G W     L +         +      C + C P E
Sbjct:  372 ENFGCKLGSHGKRNNHF-KKCTGLERIGRHSSFEQEGKVQFVIDAVYSMAHALNNMHKDLCPGYIGLCPRMKT-IDGKELLSYIRAVNFNGSAGTPVTFNENGDAPGRYDIYQYQMTNKTAEYKVIGQWTNQLHLNVEDMQWTSREHTQPTSVCSLPCKPGE 531          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 51.2174 bits (121), Expect = 9.943e-8
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   + +  DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYIGLCPRM-VTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINNKSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 51.2174 bits (121), Expect = 9.943e-8
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   + +  DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYIGLCPRM-VTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINNKSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Match: Grm8 (glutamate receptor, metabotropic 8 [Source:MGI Symbol;Acc:MGI:1351345])

HSP 1 Score: 51.2174 bits (121), Expect = 1.023e-7
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   + +  DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYIGLCPRM-VTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINNKSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 45.8246 bits (107), Expect = 7.398e-6
Identity = 41/161 (25.47%), Postives = 68/161 (42.24%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAP 467
            E F C      S  ++  +KC   ++I +        ++   I  +Y ++ + + ++K  C    G+  E+     GK LL+Y++ VNF G A   + FN+ GD    Y IFQ QT+    P    +G W  +  L +        V       C + C P
Sbjct:  370 ENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQA-GGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPPSVCTLPCKP 529          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Match: Grm7 (glutamate receptor, metabotropic 7 [Source:MGI Symbol;Acc:MGI:1351344])

HSP 1 Score: 45.8246 bits (107), Expect = 8.767e-6
Identity = 41/161 (25.47%), Postives = 68/161 (42.24%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAP 467
            E F C      S  ++  +KC   ++I +        ++   I  +Y ++ + + ++K  C    G+  E+     GK LL+Y++ VNF G A   + FN+ GD    Y IFQ QT+    P    +G W  +  L +        V       C + C P
Sbjct:  370 ENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYRGVCPEMEQA-GGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIFQYQTTNTTNPGYRLIGQWTDELQLNIEDMQWGKGVREIPPSVCTLPCKP 529          
BLAST of Metabotropic glutamate receptor 8 vs. UniProt/SwissProt
Match: sp|P70579|GRM8_RAT (Metabotropic glutamate receptor 8 OS=Rattus norvegicus OX=10116 GN=Grm8 PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 6.759e-7
Identity = 42/144 (29.17%), Postives = 65/144 (45.14%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYIL--DKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + +  ++C   IGL   + +  DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKERCPGYIGLCPRM-VTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINNKSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. UniProt/SwissProt
Match: sp|P47743|GRM8_MOUSE (Metabotropic glutamate receptor 8 OS=Mus musculus OX=10090 GN=Grm8 PE=1 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 7.157e-7
Identity = 43/144 (29.86%), Postives = 64/144 (44.44%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   + +  DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKELCPGYIGLCPRM-VTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQINNKSTEYKIIGHWTNQLHLKVEDMQWANREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. UniProt/SwissProt
Match: sp|O00222|GRM8_HUMAN (Metabotropic glutamate receptor 8 OS=Homo sapiens OX=9606 GN=GRM8 PE=1 SV=2)

HSP 1 Score: 50.8322 bits (120), Expect = 1.099e-6
Identity = 43/144 (29.86%), Postives = 63/144 (43.75%), Query Frame = 3
Query:   60 KKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDK--CNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQT---STELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLE 473
            KKC   ++I    +     ++   I  +Y ++ + + + K  C   IGL   +    DGK LL Y++AVNF G A   + FN+ GD    Y IFQ Q    STE   +G W     LK+         +      C + C P E
Sbjct:  382 KKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMHKDLCPGYIGLCPRMST-IDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGE 524          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Cavefish
Match: grm6b (metabotropic glutamate receptor 6-like [Source:NCBI gene;Acc:111195348])

HSP 1 Score: 50.0618 bits (118), Expect = 2.182e-7
Identity = 38/130 (29.23%), Postives = 58/130 (44.62%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEI--IKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVW 374
            ++FKC        L    +KC   ++I          ++  + D V     ++    +D C  S G+   +    +GKLLL+Y++AVNF G A   + FN+ GD    Y IFQ Q S    P    +G W
Sbjct:  373 DDFKCKLTRPGIKLDGGQRKCTGEERIGRHSPYEQEGKVQFVIDAVYAMAHALHSMHIDMCPGSTGICDSMDPV-EGKLLLKYIRAVNFNGSAGTGVMFNEDGDAPGRYDIFQYQLSNTTNPGYKNIGQW 501          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Cavefish
Match: GRM7 (glutamate metabotropic receptor 7 [Source:HGNC Symbol;Acc:HGNC:4599])

HSP 1 Score: 45.8246 bits (107), Expect = 6.491e-6
Identity = 41/139 (29.50%), Postives = 67/139 (48.20%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKI-TERKTDLL-NAEIIKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLN 401
            E F C   + SS  ++ S+KC   ++I T+ K +     + + D V     ++     D C    G+ +E+ +   GK LL+Y++ VNF G A   + FN  GD    Y +FQ Q +   +P    +G W   + L+LN
Sbjct:  368 ENFNCKLMS-SSKKEDTSRKCTGQERIGTDSKYEQEGKVQFVIDAVYAMAHALHNMQKDLCPEHSGVCAEMEVA-GGKKLLKYIRNVNFNGSAGTSVTFNHNGDAPGRYDLFQYQMNNNSSPGYKVIGQW--TENLQLN 502          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Cavefish
Match: grm6a (glutamate receptor, metabotropic 6a [Source:ZFIN;Acc:ZDB-GENE-060208-1])

HSP 1 Score: 45.8246 bits (107), Expect = 6.612e-6
Identity = 40/140 (28.57%), Postives = 64/140 (45.71%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLN---AEIIKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLN 401
            ++F+C        L    KKC   ++I  R T        + + D V     ++     D C  +IG+  ++    +G+LLL Y+++VNF G A   + FN+ GD    Y IFQ Q +    P    +G W  +  L+LN
Sbjct:  384 DDFRCKLTRPGIKLDPEKKKCTGNERIG-RDTPYEQEGKVQFVIDAVYAMAHALHNMHQDLCPGAIGVCDKMDPV-EGRLLLSYIRSVNFNGSAGTGVLFNENGDAPGRYDIFQYQMTNTSNPGYRVIGQWTNN--LRLN 519          
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Medaka
Match: ENSORLT00000024870.2 (metabotropic glutamate receptor 6-like [Source:NCBI gene;Acc:101165214])

HSP 1 Score: 48.9062 bits (115), Expect = 5.460e-7
Identity = 40/139 (28.78%), Postives = 68/139 (48.92%), Query Frame = 3
Query:    6 EEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYIL--DKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLA-RKIYFNQFGDTDPIYSIFQQQTSTELTP----VGVWYGDQGLKLN 401
            ++F+C        L    KKC   ++I +  +     ++   I  +Y ++ + + +  D C  S G+ S +    +G+LLL+Y++AVNF G A   + FN+ GD    Y IFQ Q +    P    +G W  +  L+LN
Sbjct:  374 DDFRCKLTRPGVKLDPEKKKCTGDERIGQDSSYEQEGKVQFVIDAVYAVAHALHNMHQDLCPGSHGVCSNMDPV-EGRLLLDYIRAVNFNGSAGTSVLFNENGDAPGRYDIFQFQMTNHSHPGYHVIGQWTNN--LRLN 509          
BLAST of Metabotropic glutamate receptor 8 vs. Planmine SMEST
Match: SMESG000064459.1 (SMESG000064459.1)

HSP 1 Score: 332.798 bits (852), Expect = 1.986e-110
Identity = 162/162 (100.00%), Postives = 162/162 (100.00%), Query Frame = 3
Query:    3 REEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLARKIYFNQFGDTDPIYSIFQQQTSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLEVMIRL 488
            REEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLARKIYFNQFGDTDPIYSIFQQQTSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLEVMIRL
Sbjct:  347 REEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGISISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLARKIYFNQFGDTDPIYSIFQQQTSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCIMHCAPLEVMIRL 508          
The following BLAST results are available for this feature:
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM82.288e-729.86glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM81.840e-629.86glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM81.840e-629.86glutamate metabotropic receptor 8 [Source:HGNC Sym... [more]
GRM76.145e-625.47glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
GRM76.270e-625.47glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm6b3.793e-637.80glutamate receptor, metabotropic 6b [Source:ZFIN;A... [more]
grm6b4.380e-638.36glutamate receptor, metabotropic 6b [Source:ZFIN;A... [more]
grm6b4.380e-638.36glutamate receptor, metabotropic 6b [Source:ZFIN;A... [more]
grm6b4.382e-638.36glutamate receptor, metabotropic 6b [Source:ZFIN;A... [more]
grm6b4.382e-638.36glutamate receptor, metabotropic 6b [Source:ZFIN;A... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000053241.14.220e-728.99pep primary_assembly:Xenopus_tropicalis_v9.1:2:794... [more]
ENSXETT00000053239.14.269e-728.99pep primary_assembly:Xenopus_tropicalis_v9.1:2:793... [more]
GRM83.705e-626.54glutamate receptor, metabotropic 8 [Source:NCBI ge... [more]
GRM83.741e-626.54glutamate receptor, metabotropic 8 [Source:NCBI ge... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm89.943e-829.86glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm89.943e-829.86glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm81.023e-729.86glutamate receptor, metabotropic 8 [Source:MGI Sym... [more]
Grm77.398e-625.47glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
Grm78.767e-625.47glutamate receptor, metabotropic 7 [Source:MGI Sym... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|P70579|GRM8_RAT6.759e-729.17Metabotropic glutamate receptor 8 OS=Rattus norveg... [more]
sp|P47743|GRM8_MOUSE7.157e-729.86Metabotropic glutamate receptor 8 OS=Mus musculus ... [more]
sp|O00222|GRM8_HUMAN1.099e-629.86Metabotropic glutamate receptor 8 OS=Homo sapiens ... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
grm6b2.182e-729.23metabotropic glutamate receptor 6-like [Source:NCB... [more]
GRM76.491e-629.50glutamate metabotropic receptor 7 [Source:HGNC Sym... [more]
grm6a6.612e-628.57glutamate receptor, metabotropic 6a [Source:ZFIN;A... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000024870.25.460e-728.78metabotropic glutamate receptor 6-like [Source:NCB... [more]
back to top
BLAST of Metabotropic glutamate receptor 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064459.11.986e-110100.00SMESG000064459.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017942 ID=SMED30017942|Name=Metabotropic glutamate receptor 8|organism=Schmidtea mediterranea sexual|type=transcript|length=490bp
GGAGAGAAGAGTTTAAATGTTTCTTTCAGAATGACAGCAGTAATTTGAAA
AACTTCTCAAAAAAATGTGAAGATTTTAAGAAAATAACCGAAAGGAAAAC
CGATTTGTTAAACGCGGAAATAATTAAAGACATAGTCAAACTATATGGGA
TCTCTATTTCGAAATATATTCTTGACAAATGCAATTATTCTATTGGTTTA
AAAAGCGAATTATATTTGTGCTTTGATGGGAAATTGCTGTTGGAATATTT
GAAAGCAGTTAATTTTCAAGGACTCGCCAGAAAGATCTACTTCAATCAGT
TCGGTGACACTGATCCTATATATTCGATTTTTCAACAACAAACATCAACT
GAATTGACTCCTGTCGGAGTTTGGTATGGGGATCAAGGATTGAAATTAAA
TAGCGCTTTAATAGAACCCTCTGTTAATATCACAATTAAAATTAAATGTA
TAATGCACTGTGCTCCCTTAGAAGTTATGATAAGATTAAG
back to top

protein sequence of SMED30017942-orf-1

>SMED30017942-orf-1 ID=SMED30017942-orf-1|Name=SMED30017942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
REEFKCFFQNDSSNLKNFSKKCEDFKKITERKTDLLNAEIIKDIVKLYGI
SISKYILDKCNYSIGLKSELYLCFDGKLLLEYLKAVNFQGLARKIYFNQF
GDTDPIYSIFQQQTSTELTPVGVWYGDQGLKLNSALIEPSVNITIKIKCI
MHCAPLEVMIRL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: molecular function
TermDefinition
GO:0004871signal transducer activity
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 9..114
e-value: 3.6E-6
score: 26.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 1..104
e-value: 8.2E-10
score: 40.1
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 4..132