WASP like actin nucleation promoting factor b

Overview
NameWASP like actin nucleation promoting factor b
Smed IDSMED30017937
Length (bp)1795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WASP like actin nucleation promoting factor b (SMED30017937) t-SNE clustered cells

Violin plots show distribution of expression levels for WASP like actin nucleation promoting factor b (SMED30017937) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WASP like actin nucleation promoting factor b (SMED30017937) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WASP like actin nucleation promoting factor b (SMED30017937) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017937

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017937SMESG000036683.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017937SMESG000036683.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017937SMESG000036683.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30017937SMESG000074788.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30017937SMESG000074788.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017937SMESG000074788.1 Contig4572GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30017937SMESG000074788.1 dd_Smed_v4_1987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017937SMESG000074788.1 dd_Smed_v4_1987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017937SMESG000074788.1 dd_Smed_v4_1987_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30017937SMESG000036683.1 Contig4572GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017937SMESG000074788.1 Contig4572GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30017937SMESG000074788.1 dd_Smed_v4_1987_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Human
Match: WAS (WASP actin nucleation promoting factor [Source:HGNC Symbol;Acc:HGNC:12731])

HSP 1 Score: 106.686 bits (265), Expect = 1.006e-23
Identity = 75/287 (26.13%), Postives = 127/287 (44.25%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIR-KAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNE-------------------PRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            L+ D E +R  E++  +C  L+TAV +LY         W     G +   KD+ +++YFI+L+ +       E E+     Y       HT +   C A L+F+D  E++ F   ++  IQ R + Q   +RQ     +  N      +P   + P  ++                   P  + ++    P+      D K S G KKI+K DI  P  F+H+ H+G +    F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++E
Sbjct:   26 LLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRS-GKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQE 311          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Human
Match: WASL (WASP like actin nucleation promoting factor [Source:HGNC Symbol;Acc:HGNC:12735])

HSP 1 Score: 105.145 bits (261), Expect = 2.887e-23
Identity = 72/268 (26.87%), Postives = 130/268 (48.51%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNV----IPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++  R+ + EK+R           ++D+K P         P  N   H+  K              K     K++TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L D+ + + IYDF++K GG+  ++NE++++
Sbjct:   21 LLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEK-------------KKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQ 275          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Human
Match: WAS (WASP actin nucleation promoting factor [Source:HGNC Symbol;Acc:HGNC:12731])

HSP 1 Score: 64.6994 bits (156), Expect = 3.381e-11
Identity = 36/132 (27.27%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ 501
            L+ D E +R  E++  +C  L+TAV +LY         W     G +   KD+ +++YFI+L+ +       E E+     Y       HT +   C A L+F+D  E++ F   ++  IQ R  ++   R+
Sbjct:   26 LLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRR 157          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Fly
Match: WASp (gene:FBgn0024273 transcript:FBtr0085353)

HSP 1 Score: 77.411 bits (189), Expect = 1.164e-14
Identity = 69/273 (25.27%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQ-IHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINY-SIDVKVPY-----------------NNVIPITNEPRHSVTKVEA-KPSKTKKNTDAKSSQG------AKKITKNDISIPMNFQHLDHMGLNDH----FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFV 831
            L+T EE +   +L+  +C+ L+TAV ++Y  + ++   W+   TG++   KDS  R+YF++ + +       E EI Y+    +K    + T      +  L+F    E + F   +   I+ R  ++++KR  Q +  + +  +P                   + + + N   +SVT   A  P+++K    +    G       +K+TK DIS P NF HL H+G +         N +DE + +F   AG+ ++ L D+++   IYDF+
Sbjct:   21 LLTQEENEAVFKLLGKKCQTLNTAVVQIYKTEGSAHAHWKKRHTGVVCFVKDSAIRSYFMRAYCLIKNELIWEHEI-YDGMEVVKSRPFLLTFEGSDGHVGLNFVSEEECDSFFRIVDATIETRNRKRQEKRNRQKSQQAPNAPLPQVQREPARPPPMQGGLSSTDGVQLRNNKINSVTLTPAPAPAQSKNFLSSSFGLGNNAKDKKRKVTKADISRPTNFVHLSHVGWDAQKGFDLAGNENDEVLNEFFVKAGVSEVELKDRDTRAFIYDFI 292          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Fly
Match: WASp (gene:FBgn0024273 transcript:FBtr0085352)

HSP 1 Score: 77.411 bits (189), Expect = 1.164e-14
Identity = 69/273 (25.27%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQ-IHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINY-SIDVKVPY-----------------NNVIPITNEPRHSVTKVEA-KPSKTKKNTDAKSSQG------AKKITKNDISIPMNFQHLDHMGLNDH----FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFV 831
            L+T EE +   +L+  +C+ L+TAV ++Y  + ++   W+   TG++   KDS  R+YF++ + +       E EI Y+    +K    + T      +  L+F    E + F   +   I+ R  ++++KR  Q +  + +  +P                   + + + N   +SVT   A  P+++K    +    G       +K+TK DIS P NF HL H+G +         N +DE + +F   AG+ ++ L D+++   IYDF+
Sbjct:   21 LLTQEENEAVFKLLGKKCQTLNTAVVQIYKTEGSAHAHWKKRHTGVVCFVKDSAIRSYFMRAYCLIKNELIWEHEI-YDGMEVVKSRPFLLTFEGSDGHVGLNFVSEEECDSFFRIVDATIETRNRKRQEKRNRQKSQQAPNAPLPQVQREPARPPPMQGGLSSTDGVQLRNNKINSVTLTPAPAPAQSKNFLSSSFGLGNNAKDKKRKVTKADISRPTNFVHLSHVGWDAQKGFDLAGNENDEVLNEFFVKAGVSEVELKDRDTRAFIYDFI 292          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Fly
Match: WASp (gene:FBgn0024273 transcript:FBtr0336768)

HSP 1 Score: 77.411 bits (189), Expect = 1.164e-14
Identity = 69/273 (25.27%), Postives = 127/273 (46.52%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQ-IHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINY-SIDVKVPY-----------------NNVIPITNEPRHSVTKVEA-KPSKTKKNTDAKSSQG------AKKITKNDISIPMNFQHLDHMGLNDH----FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFV 831
            L+T EE +   +L+  +C+ L+TAV ++Y  + ++   W+   TG++   KDS  R+YF++ + +       E EI Y+    +K    + T      +  L+F    E + F   +   I+ R  ++++KR  Q +  + +  +P                   + + + N   +SVT   A  P+++K    +    G       +K+TK DIS P NF HL H+G +         N +DE + +F   AG+ ++ L D+++   IYDF+
Sbjct:   21 LLTQEENEAVFKLLGKKCQTLNTAVVQIYKTEGSAHAHWKKRHTGVVCFVKDSAIRSYFMRAYCLIKNELIWEHEI-YDGMEVVKSRPFLLTFEGSDGHVGLNFVSEEECDSFFRIVDATIETRNRKRQEKRNRQKSQQAPNAPLPQVQREPARPPPMQGGLSSTDGVQLRNNKINSVTLTPAPAPAQSKNFLSSSFGLGNNAKDKKRKVTKADISRPTNFVHLSHVGWDAQKGFDLAGNENDEVLNEFFVKAGVSEVELKDRDTRAFIYDFI 292          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Fly
Match: WASp (gene:FBgn0024273 transcript:FBtr0085354)

HSP 1 Score: 68.5514 bits (166), Expect = 7.324e-12
Identity = 64/260 (24.62%), Postives = 118/260 (45.38%), Query Frame = 1
Query:  154 IENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQ-IHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINY-SIDVKVPY-----------------NNVIPITNEPRHSVTKVEA-KPSKTKKNTDAKSSQG------AKKITKNDISIPMNFQHLDHMGLNDH----FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFV 831
            +  + K L+TAV ++Y  + ++   W+   TG++   KDS  R+YF++ + +       E EI Y+    +K    + T      +  L+F    E + F   +   I+ R  ++++KR  Q +  + +  +P                   + + + N   +SVT   A  P+++K    +    G       +K+TK DIS P NF HL H+G +         N +DE + +F   AG+ ++ L D+++   IYDF+
Sbjct:    1 MRRKLKTLNTAVVQIYKTEGSAHAHWKKRHTGVVCFVKDSAIRSYFMRAYCLIKNELIWEHEI-YDGMEVVKSRPFLLTFEGSDGHVGLNFVSEEECDSFFRIVDATIETRNRKRQEKRNRQKSQQAPNAPLPQVQREPARPPPMQGGLSSTDGVQLRNNKINSVTLTPAPAPAQSKNFLSSSFGLGNNAKDKKRKVTKADISRPTNFVHLSHVGWDAQKGFDLAGNENDEVLNEFFVKAGVSEVELKDRDTRAFIYDFI 259          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Match: wasb (WASP actin nucleation promoting factor b [Source:ZFIN;Acc:ZDB-GENE-030131-7098])

HSP 1 Score: 103.99 bits (258), Expect = 3.433e-23
Identity = 80/273 (29.30%), Postives = 129/273 (47.25%), Query Frame = 1
Query:  130 EFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQS---------QI--------NYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            E +R QEL+  RC  ++TAV +LY    +S   W    TG++   KD+ RR+Y+I+LF++       E E+     Y       HT +   C   L+F+   E++ F N  +  I  R  ++EK++ +         QI          S+   V   N   + +  R +     A    T    D K  +   K+TK DI  P  F+H+ H+G   N  F TN  D ++KK    AG+    L DK + + IYDF+++ GGL+ ++ EM+++
Sbjct:   21 ENERLQELLGRRCVAMATAVVQLYMALPHSPTEWSLQHTGVMCFVKDNPRRSYYIRLFDIMEAKVVWEQELYNQMTYSCPLRFFHTFAADDCQVGLNFASETEADLFRNITEEKINQRTNRQEKRQHAPSEDKRPLPQIPPPNGPVSQPSVMATVDIQNPDIVASRYRSTSVPTPAPACITTGKKDKKGKKKGPKLTKADIGAPSGFKHVTHIGWDPNSGFDTNNLDPDLKKLFNIAGISDAQLADKETSKLIYDFIEQSGGLDAVKEEMRKQ 293          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Match: wasa (WASP actin nucleation promoting factor a [Source:ZFIN;Acc:ZDB-GENE-081104-419])

HSP 1 Score: 104.76 bits (260), Expect = 4.776e-23
Identity = 70/274 (25.55%), Postives = 128/274 (46.72%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVI----------QIRKAQKEKKRQSQINYSIDVKVP---YNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQ-LLDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            +L++ +E ++ ++L+  RC  LS+AV +L        N W    +G++   KDS  R++FI+L+++       E EI     Y+  +   HT     C   L+F+D +E+E F   +++ I          Q RK  + + R +         VP    N +IP  ++             + K+      ++   K+ K DI  P  F H+ H+G+  +      D ++KK L  AG+ +  ++D  + + IYD +++ GG+  L+ EM Q+E
Sbjct:   16 SLLSIQENEKLEDLLGRRCVSLSSAVVQLLMALPSDPNRWTPQQSGVVCFVKDSSLRSFFIRLYDIKAGKLVWEQEIYNQLMYQKTKPFFHTFPGDDCQVGLNFADVIEAENFFAVVEDKIMQRNNRFAEKQQRKGSETRDRGALPPLPPPNAVPSNVQNQIIPTKSK------------KEKKEKEKKSKNKKGSKLLKGDIGAPSGFTHVSHLGMAGNSI----DPDVKKLLSCAGISEAAMEDSETSQLIYDVIERSGGMEALKKEMSQQE 273          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Match: wasa (WASP actin nucleation promoting factor a [Source:ZFIN;Acc:ZDB-GENE-081104-419])

HSP 1 Score: 102.064 bits (253), Expect = 1.852e-22
Identity = 71/272 (26.10%), Postives = 129/272 (47.43%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVP---YNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQ-LLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPG 906
            +L++ +E ++ ++L+  RC  LS+AV +L        N W    +G++   KDS  R++FI+L+++       E EI     Y+  +   HT     C   L+F+D +E+E F   +++ I  R     +   S  ++S+   VP    N +IP  ++             + K+      ++   K+ K DI  P  F H+ H+G+      N  D ++KK L  AG+ +  ++D  + + IYD +++ GG+  L+ EM Q+       PG
Sbjct:   16 SLLSIQENEKLEDLLGRRCVSLSSAVVQLLMALPSDPNRWTPQQSGVVCFVKDSSLRSFFIRLYDIKAGKLVWEQEIYNQLMYQKTKPFFHTFPGDDCQVGLNFADVIEAENFFAVVEDKIMQR---NNRFAVSLTSFSMPPAVPSNVQNQIIPTKSK------------KEKKEKEKKSKNKKGSKLLKGDIGAPSGFTHVSHLGMAG----NSIDPDVKKLLSCAGISEAAMEDSETSQLIYDVIERSGGMEALKKEMSQQGPLPNVPPG 268          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Match: wasla (WASP like actin nucleation promoting factor a [Source:ZFIN;Acc:ZDB-GENE-070209-220])

HSP 1 Score: 98.2117 bits (243), Expect = 3.344e-21
Identity = 75/266 (28.20%), Postives = 136/266 (51.13%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIH--TCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E       +  +C  L +AV ++Y   + +SW     G+  L KD+ +R+YFI++F++ +  KT+  + LYN+F  I  ++ +  T +   C   L+F+   E+++F + +  ++  R+ + EK+R      +    ++D+K P      I N   H+ + V           + K     KK+TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   17 LLTPQENDCLFNYLGRKCITLCSAVVQVYGADRGSSWAKRCCGVACLVKDNPQRSYFIRVFDIKDG-KTKFEQELYNNF-AISSSRAYFITFAGDSCQMGLNFASEEEAKRFRSALNELLNRRQRKTEKRRDPPNGPTLPMATVDIKNPE-----INNMRFHNNSHVNNMVHSGLNKKEKKVKGKRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQ 275          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Match: wasla (WASP like actin nucleation promoting factor a [Source:ZFIN;Acc:ZDB-GENE-070209-220])

HSP 1 Score: 98.2117 bits (243), Expect = 3.344e-21
Identity = 75/266 (28.20%), Postives = 136/266 (51.13%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIH--TCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E       +  +C  L +AV ++Y   + +SW     G+  L KD+ +R+YFI++F++ +  KT+  + LYN+F  I  ++ +  T +   C   L+F+   E+++F + +  ++  R+ + EK+R      +    ++D+K P      I N   H+ + V           + K     KK+TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   17 LLTPQENDCLFNYLGRKCITLCSAVVQVYGADRGSSWAKRCCGVACLVKDNPQRSYFIRVFDIKDG-KTKFEQELYNNF-AISSSRAYFITFAGDSCQMGLNFASEEEAKRFRSALNELLNRRQRKTEKRRDPPNGPTLPMATVDIKNPE-----INNMRFHNNSHVNNMVHSGLNKKEKKVKGKRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQ 275          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Xenopus
Match: pld3 (phospholipase D family member 3 [Source:Xenbase;Acc:XB-GENE-1006824])

HSP 1 Score: 105.145 bits (261), Expect = 2.671e-23
Identity = 76/264 (28.79%), Postives = 130/264 (49.24%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS-WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +++AV +++    NS W     G++ L KD+ +R+YFI+++++    +  E E+ YN  Y   +   HT     C   L+F+   E+++F     ++I  R  + +KKR+     S    ++D+K P      ITN     V  +  K  K K  T  K    A      DI  P NFQH+ H+G   N  F  N  D  +KK     G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   25 LLTAQENESLFSYLGKKCVTMTSAVVQVFLSDRNSMWVKKCCGVVCLVKDNPQRSYFIRVYDIKEGRQLHEQELYYNFVYNSPRPYFHTFPGDTCQIGLNFASEEEAKRFRKATTDLISRRPRKPDKKREPPNGPSLPMATVDIKNPE-----ITNRYNAQVNNIPYKNDKKKGKTKKKKLTKA------DIGTPSNFQHIGHVGWDPNTGFDVNNLDPELKKLFDLCGISEAQLKDKETSKVIYDFIEKTGGVEAVKNELRRQ 277          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Xenopus
Match: pld3 (phospholipase D family member 3 [Source:Xenbase;Acc:XB-GENE-1006824])

HSP 1 Score: 104.76 bits (260), Expect = 3.226e-23
Identity = 76/264 (28.79%), Postives = 130/264 (49.24%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS-WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +++AV +++    NS W     G++ L KD+ +R+YFI+++++    +  E E+ YN  Y   +   HT     C   L+F+   E+++F     ++I  R  + +KKR+     S    ++D+K P      ITN     V  +  K  K K  T  K    A      DI  P NFQH+ H+G   N  F  N  D  +KK     G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   25 LLTAQENESLFSYLGKKCVTMTSAVVQVFLSDRNSMWVKKCCGVVCLVKDNPQRSYFIRVYDIKEGRQLHEQELYYNFVYNSPRPYFHTFPGDTCQIGLNFASEEEAKRFRKATTDLISRRPRKPDKKREPPNGPSLPMATVDIKNP-----EITNRYNAQVNNIPYKNDKKKGKTKKKKLTKA------DIGTPSNFQHIGHVGWDPNTGFDVNNLDPELKKLFDLCGISEAQLKDKETSKVIYDFIEKTGGVEAVKNELRRQ 277          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Xenopus
Match: cux1 (cut like homeobox 1 [Source:Xenbase;Acc:XB-GENE-853070])

HSP 1 Score: 53.1434 bits (126), Expect = 7.837e-7
Identity = 32/90 (35.56%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  649 KKITKNDISIPMNFQHLDHMGLNDHFFTNPD---DENIKKFLKNAGM-QQLLDDKNSMEAIYDFVDKHGGLNKLENE---MKQKEMKDRK 897
            +K++K+DI  P NF+HL H+G      TN D   D ++KK  K AG+ ++ L D+     I+  ++K GG+  +  E   M Q+EM D +
Sbjct:   38 RKLSKSDIGSPSNFKHLAHVGWPSG--TNLDERTDADLKKLFKLAGIKEEHLKDQEMSRKIFAVIEKKGGMEAVRKETLRMAQREMPDSR 125          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Mouse
Match: Wasl (Wiskott-Aldrich syndrome-like (human) [Source:MGI Symbol;Acc:MGI:1920428])

HSP 1 Score: 105.916 bits (263), Expect = 1.023e-23
Identity = 72/264 (27.27%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++  R+ + EK+R +         ++D+K P      IT   R   ++V    + +      K     K++TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L D+ + + IYDF++K GG+  ++NE++++
Sbjct:   18 LLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPE-----ITTN-RFYGSQVN---NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQ 272          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Mouse
Match: Was (Wiskott-Aldrich syndrome [Source:MGI Symbol;Acc:MGI:105059])

HSP 1 Score: 105.916 bits (263), Expect = 1.076e-23
Identity = 76/287 (26.48%), Postives = 125/287 (43.55%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIR-KAQKEKKRQ-----SQINYSIDVKVP-------------------YNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            L+ D E +R  EL+  +C  L+T V +LY         W     G +   KD+ +++YFI+L+ +       E E+     Y       HT +   C   L+F+D  E++ F   ++  IQ R + Q  ++RQ     + IN      +P                      V      P  + ++    P+     TD K S G KKI+K DI  P  F+H+ H+G +    F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++E
Sbjct:   28 LLQDHENQRLFELLGRKCWTLATTVVQLYLALPPGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVPPHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRS-GKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQE 313          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Mouse
Match: Wasl (Wiskott-Aldrich syndrome-like (human) [Source:MGI Symbol;Acc:MGI:1920428])

HSP 1 Score: 60.4622 bits (145), Expect = 4.007e-10
Identity = 40/158 (25.32%), Postives = 77/158 (48.73%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVT 585
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++         +RQ +      +KVP   ++      RHS T
Sbjct:   18 LLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLL--------GRRQRKSALRTVLKVPACTIL-----LRHSRT 162          
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Match: sp|P42768|WASP_HUMAN (Wiskott-Aldrich syndrome protein OS=Homo sapiens OX=9606 GN=WAS PE=1 SV=4)

HSP 1 Score: 106.686 bits (265), Expect = 4.833e-23
Identity = 75/287 (26.13%), Postives = 127/287 (44.25%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIR-KAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNE-------------------PRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            L+ D E +R  E++  +C  L+TAV +LY         W     G +   KD+ +++YFI+L+ +       E E+     Y       HT +   C A L+F+D  E++ F   ++  IQ R + Q   +RQ     +  N      +P   + P  ++                   P  + ++    P+      D K S G KKI+K DI  P  F+H+ H+G +    F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++E
Sbjct:   26 LLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPLHPGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRS-GKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQE 311          
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Match: sp|O08816|WASL_RAT (Neural Wiskott-Aldrich syndrome protein OS=Rattus norvegicus OX=10116 GN=Wasl PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 5.500e-23
Identity = 72/264 (27.27%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++  R+ + EK+R +         ++D+K P      IT   R   ++V    + +      K     K++TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L D+ + + IYDF++K GG+  ++NE++++
Sbjct:   18 LLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPE-----ITTN-RFYSSQVN---NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQ 272          
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Match: sp|Q91YD9|WASL_MOUSE (Neural Wiskott-Aldrich syndrome protein OS=Mus musculus OX=10090 GN=Wasl PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.157e-23
Identity = 72/264 (27.27%), Postives = 134/264 (50.76%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++  R+ + EK+R +         ++D+K P      IT   R   ++V    + +      K     K++TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L D+ + + IYDF++K GG+  ++NE++++
Sbjct:   18 LLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPE-----ITTN-RFYGSQVN---NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQ 272          
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Match: sp|P70315|WASP_MOUSE (Wiskott-Aldrich syndrome protein homolog OS=Mus musculus OX=10090 GN=Was PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.525e-23
Identity = 76/287 (26.48%), Postives = 125/287 (43.55%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIR-KAQKEKKRQ-----SQINYSIDVKVP-------------------YNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            L+ D E +R  EL+  +C  L+T V +LY         W     G +   KD+ +++YFI+L+ +       E E+     Y       HT +   C   L+F+D  E++ F   ++  IQ R + Q  ++RQ     + IN      +P                      V      P  + ++    P+     TD K S G KKI+K DI  P  F+H+ H+G +    F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++E
Sbjct:   28 LLQDHENQRLFELLGRKCWTLATTVVQLYLALPPGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVPPHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRS-GKKKISKADIGAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQE 313          
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Match: sp|Q95107|WASL_BOVIN (Neural Wiskott-Aldrich syndrome protein OS=Bos taurus OX=9913 GN=WASL PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 8.578e-23
Identity = 72/268 (26.87%), Postives = 130/268 (48.51%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNV----IPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  +S+AV +LY   +N  W    +G+  L KD+ +R+YF+++F++ +     E E+  N  Y   +   HT +   C   L+F++  E++KF   + +++  R+ + EK+R           ++D+K P         P  N   H+  K              K     K++TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L D+ + + IYDF++K GG+  ++NE++++
Sbjct:   21 LLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQINNISHTKEK-------------KKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQ 275          
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Match: G3VJB5 (WASP actin nucleation promoting factor OS=Sarcophilus harrisii OX=9305 GN=WAS PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.456e-27
Identity = 77/263 (29.28%), Postives = 126/263 (47.91%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVK---NNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPI-TNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
             L+ D E +R   L+  +C  L+T+VA+LY         W    +G I   KD+ RR+YFI+L+ +       E EI     Y       HT     C A L+F+D  E++ F   ++      K QK  ++Q+ +  S  +  P   ++ +    P  + ++    P+ T    D K S G KKI+K DI  P  F+H+ H+G + H  F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++
Sbjct:   20 GLLQDHENQRLFGLLGRKCWTLATSVAQLYLAPPSMGGRWHKELSGAICFVKDNPRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAGLNFADETEAQAFRALVEE-----KIQKRSQKQNAVPAST-LGSPSLGLVAVDIQNPDITSSRYRGLPAPTPSPPDKKRS-GKKKISKADIGAPSGFKHVSHVGWDPHSGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVREEMRRQ 275          
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Match: F6SA08 (WASP actin nucleation promoting factor OS=Monodelphis domestica OX=13616 GN=WAS PE=4 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 6.288e-26
Identity = 81/281 (28.83%), Postives = 132/281 (46.98%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYV---KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQK-------EKKRQS---QINYSIDVKVPYNN---------VIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
             L+ D E +R   L+  +C  L+T+VA+LY         W+   +G I   KD+ RR+YFI+L+ +       E EI     Y       HT     C A L+F+D  E++ F   ++  IQ R  ++       E++  +    +  S D+ VP +           + I N P  + ++    P+ T    D K S G KKI+K DI  P  F+H+ H+G + H  F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++
Sbjct:   40 GLLQDHENQRLFALLGRKCWTLATSVAQLYLALPSTGGRWQKELSGAICFVKDNPRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAGLNFADEAEAQAFRALVEEKIQKRSQRQNAGSLGAERRGGATPLPLQPSGDLSVPASTPGSASLGLVAVDIQN-PDITSSRYRGLPAPTLPPPDKKRS-GKKKISKADIGAPSGFKHVSHVGWDPHSGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVREEMRRQ 318          
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Match: G3VJB4 (WASP actin nucleation promoting factor OS=Sarcophilus harrisii OX=9305 GN=WAS PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.598e-25
Identity = 80/291 (27.49%), Postives = 130/291 (44.67%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVK---NNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINY--------------------SIDVKVPYNNV---------IPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDH--FFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
             L+ D E +R   L+  +C  L+T+VA+LY         W    +G I   KD+ RR+YFI+L+ +       E EI     Y       HT     C A L+F+D  E++ F   ++  IQ R  ++    +  + +                    S D+ VP + +         + I N P  + ++    P+ T    D K S G KKI+K DI  P  F+H+ H+G + H  F  N  D +++     AG+ +  L D  + + IYDF++  GGL  +  EM+++
Sbjct:   20 GLLQDHENQRLFGLLGRKCWTLATSVAQLYLAPPSMGGRWHKELSGAICFVKDNPRRSYFIRLYGLQEGRLLWEQEIYTQLVYSAPTPFFHTFPGDDCQAGLNFADETEAQAFRALVEEKIQKRSQKQNAGEKGALPFTYIPFTTERRGGSTPLPSQPSGDLSVPASTLGSPSLGLVAVDIQN-PDITSSRYRGLPAPTPSPPDKKRS-GKKKISKADIGAPSGFKHVSHVGWDPHSGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLEAVREEMRRQ 308          
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Match: F7A8L8 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 1.603e-25
Identity = 85/271 (31.37%), Postives = 147/271 (54.24%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS--WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSF-YEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIP----ITNEPRHSVTKVEAKPSKTKKNTD-----AKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGM-QQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            +L+TD E K    ++  +C  L+T V ++Y    +   W+   TG+    KD+  R+YFI+++++ N  +  E E LYN F Y   ++  HT    KC A L+F++  E+ KF   ++   +IR+ Q++K+ +S++N    V+ P N+ +P    + N P+  +      P K   N +      K  +   K+TK DIS+P  F+H+ H+G   N  F TN  D ++K+   NAG+ +  + DK   + IYDF++K GG++ ++ E KQ+
Sbjct:   19 SLLTDSENKTVFHMLGRKCVTLATGVVQVYLADGSGSKWQKRCTGVCCFVKDNPMRSYFIRVYSLKNESQIWEQE-LYNQFKYNTPRSYFHTFDTDKCRAGLNFANEAEASKFKQVVEE--KIRQKQEKKQAKSRVN---SVRSP-NSALPSPPAVYNHPQIIINY--NHPQKVLNNIEDGKKAKKGKKKKGKLTKADISMPSGFKHVGHVGWDPNKGFDTNNMDPDVKELFNNAGVTEDDMHDKEKAQFIYDFIEKRGGIDAVKQEQKQR 280          
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Match: A0A3B4CM13 (Uncharacterized protein OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.975e-25
Identity = 78/285 (27.37%), Postives = 139/285 (48.77%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQS-----------------------QINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQ-QLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            L++ +E +R  +L+  RC  L+TAV +LY    +S   W    TG++   KD+ RR+YFI+ +++ +     E E+     Y   +   H+     C   L+F+   ESE F N ++  I  R ++++K++ +                       Q    + V +P  +++P  +  R     + A  S  K   D K+ +   ++TK DI  P  F+H+ H+G   N  F TN  D ++KK    AG+    L DK + + IYDF+++ GGL+ ++ EM++++
Sbjct:   16 LLSTQENERLVDLLGRRCVTLATAVVQLYMAHPHSPAHWSLQHTGVVCFVKDNPRRSYFIRFYDIKDEKMIWEQELYNQMTYTSPKQYFHSFPGDDCQVGLNFASDQESEAFRNTVEEKITQRTSRQDKRQHAPSEGTLGPPPIPPSNGPGPGPTMQPGGMVTVDIPNPDILP--SRYRSPAVPLPAPASLGKGKKDKKNKKKGPRLTKADIGAPSGFKHVSHIGWDPNAGFDTNNLDPDLKKLFSCAGISDDQLTDKETSKLIYDFIEQSGGLDAVKEEMRRQD 298          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Cavefish
Match: wasb (WASP actin nucleation promoting factor [Source:NCBI gene;Acc:103041172])

HSP 1 Score: 117.087 bits (292), Expect = 1.490e-27
Identity = 84/291 (28.87%), Postives = 140/291 (48.11%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRK-------AQKEKKR---------------------QSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQ-LLDDKNSMEAIYDFVDKHGGLNKLENEMKQKE 882
            +L+  +E +R  +L+  RC  L+TAV +LY    +S   W    TG++   KD+ RR+YFI+L+++ +     E E+     Y   +   HT     C   L+F+   ES+ F N +++ I  R        A  E+KR                     Q     ++D+  P  +++P  +  R     V A  S  K   D K  +   ++TK DI  P  F+H+ H+G   N  F TN  D ++KKF   AG+ +  L DK + + IYDF+++ GGL+ ++ EM++++
Sbjct:   15 SLLNIQENERLVDLLGRRCVSLATAVVQLYMALPHSPAHWSLQHTGVVCFVKDNPRRSYFIRLYDLKDEKMIWEQELYNQMTYSSPKQYFHTFCADDCQVGLNFASEQESDAFRNTVEDKISQRSNRQDKRPASNEEKRAPPPLPPSNGPGPGPGPGQAMQPGGMSTVDIANP--DILP--SRYRSPTVPVPAPASLGKGKKDKKGKKKGPRLTKADIGAPSGFKHISHVGWDPNAGFDTNNLDPDLKKFFSYAGISEDQLTDKETSKVIYDFIEQSGGLDAVKEEMRKQD 301          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Cavefish
Match: wasa (wiskott-Aldrich syndrome protein-like [Source:NCBI gene;Acc:103022907])

HSP 1 Score: 99.7525 bits (247), Expect = 1.575e-21
Identity = 76/280 (27.14%), Postives = 136/280 (48.57%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSF-YEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPY-----NNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKND-----ISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPG 906
            AL++ +E ++ Q+L+  RC  L TAVA+L+    +S   W    +G++   KD+ +R+YFI+L+++       E E LYN   Y   +   HT  +  C   L+F+D  E+E F   +   +  R  + E  RQS+I    D   P       N  P+      +   ++ +P+ TK   + K  +   K   +      I  P  F H+ HMG++++  ++  D ++ K    AG+ +  L+D  + + IYD +++ GGL  ++ E+ Q++      PG
Sbjct:   16 ALLSLQENEKVQDLLGRRCVSLCTAVAQLFMALPHSPFNWSLQHSGVLCFVKDNPQRSYFIRLYDIKAGKMLWEQE-LYNQLTYHRARAFFHTFPSDDCQVGLNFADEQEAESFYIIVDEKMNQRVNRME-NRQSKIRSRDDALPPLPPNGSGNCSPLP----LATLSIQNEPAPTKSKKEKKEKEKKGKKKGSKLSKALIGAPSGFTHVTHMGMDNN--SSSMDPDLMKLFSRAGISEADLNDSETSQMIYDIIERSGGLEAVKKEVNQQDRALPPLPG 287          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Cavefish
Match: ENSAMXT00000000927.2 (neural Wiskott-Aldrich syndrome protein [Source:NCBI gene;Acc:103034777])

HSP 1 Score: 92.8189 bits (229), Expect = 1.436e-19
Identity = 74/265 (27.92%), Postives = 129/265 (48.68%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNG-KCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ-----SQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  L +AV ++Y   +  SW     G+  L KD+ +R+YFI++F++ +     E E LYN+F             G  C   L+F+   E+++F   +  ++  R+ + EK+R      +    ++D+K P  N +   N   H    V +    +    + K     KK+TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   17 LLTPQENECLFSYLGRKCITLCSAVVQVYVADRGPSWTKRCCGVACLVKDNPQRSYFIRVFDIKDGKPKFEQE-LYNNFSSSSSRPYFIAFAGDTCQVGLNFASEEEAKRFRATLNELLSRRQKKTEKRRDPPNGPTLPMATVDIKNPEINNVRFHNS--HMNNMVHS----SFNKKEKKVKGKRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKILFDMCGISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQ 274          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Cavefish
Match: ENSAMXT00000048339.1 (neural Wiskott-Aldrich syndrome protein [Source:NCBI gene;Acc:103034777])

HSP 1 Score: 87.8113 bits (216), Expect = 5.585e-18
Identity = 70/260 (26.92%), Postives = 126/260 (48.46%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNG-KCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E +     +  +C  L +AV ++Y   +  SW     G+  L KD+ +R+YFI++F++ +     E E LYN+F             G  C   L+F+   E+++F   +  ++  R   ++K   +    ++D+K P  N +   N   +++         +    + K     KK+TK DI  P NFQH+ H+G   N  F  N  D  +K      G+ +  L DK + + IYDF++K GG+  ++NE++++
Sbjct:   17 LLTPQENECLFSYLGRKCITLCSAVVQVYVADRGPSWTKRCCGVACLVKDNPQRSYFIRVFDIKDGKPKFEQE-LYNNFSSSSSRPYFIAFAGDTCQVGLNFASEEEAKRFRATLNELLSRR---QKKTGPTLPMATVDIKNPEINNVRFHNSHMNNMVH------SSFNKKEKKVKGKRKKLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKILFDMCGISEAQLKDKETSKVIYDFIEKKGGVEAVKNELRRQ 266          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Sea Lamprey
Match: waslb (WASP like actin nucleation promoting factor b [Source:ZFIN;Acc:ZDB-GENE-040426-718])

HSP 1 Score: 100.523 bits (249), Expect = 8.269e-23
Identity = 72/269 (26.77%), Postives = 130/269 (48.33%), Query Frame = 1
Query:  151 LIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQ--IHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----------------YSIDVKVPYNNVIPITNEP----RHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGM-QQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            ++  +C  ++TAV ++++ +N  W+    G++   KD+ RR+YFI+++ M +       + LYN F E KQ +   HT    KC   L+F +  E++ F + +++ +++R  + E+KR                       ++D+K P    I +   P        + +   P     +   K     KK+TK DI  P NFQH+ H+G   N  F  N  D  +K     AG+ +  L DK + + IYDF++  GG+  +++EM+++
Sbjct:    1 MLGRKCLSMATAVVQVFFSENGVWQKRHCGVVCFVKDNPRRSYFIRVYEMRDTGHLCYEQELYNKF-EYKQPRPFFHTFLGDKCQVGLNFCNEKEAKTFRDAVEDKLRLRHQKSERKRNDPTPPISRRDSTGPMLPNLKMQAMDIKNPD---ITVNRYPINSSSTPTSTITNSPFNMIMDRTKKGKGKKKKLTKADIGAPSNFQHVGHIGWDPNTGFDLNNLDPELKSLFDMAGITESQLKDKETSKTIYDFIENFGGVEAVKSEMRRQ 265          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010196.1 (pep scaffold:Pmarinus_7.0:GL476398:3:6998:-1 gene:ENSPMAG00000009227.1 transcript:ENSPMAT00000010196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 4.844e-15
Identity = 59/253 (23.32%), Postives = 118/253 (46.64%), Query Frame = 1
Query:  172 VLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNM-DNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHF-FTNPD--DENIKKFLKNAGM-QQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQ---KEMKDRKAPG 906
             L++ V +L Y  +  W+    G++   KD+ +R++FI ++++     K  E E+  +  Y   +   HT    KC   L+F+D  E+  F N ++  +     QK+++ +S    +    +P  + +P+      +     A     K+ T +K+      +TK+ I  P +F+H+ H+G + +  FT  +  D ++K+    AG+    L DK     I   +  +GG+  ++ E++Q    +   +K PG
Sbjct:    1 TLASTVVQLLYGVSGKWDKQCCGVVCFVKDNSKRSFFITIYDICTENCKLWEQELYTDFVYYAPKADFHTFIGDKCQVGLNFTDVEEAHFFYNSVQAKLD---KQKQRQTKSATKLTEQPSMPEMHPVPLPVMKVPNAAPAPALAKYHKQKTKSKTP-----LTKDQIGEPSHFKHIGHVGWDPNCGFTVAENVDPHLKQLFYMAGINDSHLQDKRLTRKISQIIKDYGGMEGIKQEIQQVPVPKQPAQKVPG 245          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006956.1 (pep scaffold:Pmarinus_7.0:GL476458:178519:198596:-1 gene:ENSPMAG00000006264.1 transcript:ENSPMAT00000006956.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 5.589e-11
Identity = 53/191 (27.75%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  166 CKVLSTAVARLYYVKNNS--WEFSDTGIISLTKDSERRNYFIQLFNM--DNFVKTQEFEILYNSF-YEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQK--EKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLN 717
            C  L++AV +++    +   W     G+  L KD+ +R+YFI+++++     V  QE   LY+ F Y +++T  HT     C A LSF+   E+  F   I   +Q R  +K  +++  S       + +  N  I I    R+S+  +             K     KK  K DI +P NFQH+ H+G +
Sbjct:    1 CLTLASAVVQVHVALGDGRRWTKRCVGVACLVKDNPQRSYFIRVYSLKEGKLVWEQE---LYSQFKYNVQRTHFHTFEADDCQAGLSFASDEEARLFQEAIMEKLQRRHQRKAYQERPTSGCFLRQRLVLLRNEEINIGEFSRYSINSI------IYTQEKLKGCAKKKKFCKADIGMPSNFQHVGHVGWD 182          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Nematostella
Match: EDO43865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK9])

HSP 1 Score: 75.0998 bits (183), Expect = 2.511e-14
Identity = 73/295 (24.75%), Postives = 127/295 (43.05%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSF-YEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKND-----------------ISIPMNFQHLDHMGLNDHF--------FTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGI 909
            AL+++EE      ++   C  L+TAVA+L      S   W    TG +   KD  +++YFI+++++       E E LYN F Y       HT +   CNA L+FS   E++ F  +I+  +Q ++ +++ +R    N            + ++  P      +   PS+T   +    S   K  + N+                 I  P NFQH+ HMG +            +   DE +K F K  G+ +   D ++   + +FV++ GG+  +  E+ +KE     + GI
Sbjct:   16 ALLSNEENDSVFNMLGRGCTTLATAVAQLLIALPESRTKWTKKATGAVCFVKDCSKKSYFIRVYDIIQKCMVWEQE-LYNQFKYFTSLPFFHTFAADNCNAALNFSSNSEADAFKTQIEIKLQEKQKRRQDRRNQHKNREPAPPPALGGNVELSGRPASGT--MTHSPSQTSLTSIDSLSSKKKSTSGNNKKDKKDKKGKKKFSKDDIGNPENFQHVGHMGWDPQKGFDVKNVDLSKHGDEWVKLF-KLFGVSENQMDDSTKAFVVNFVNERGGIEAVTKEI-EKEYDTTASLGI 305          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Match: wasa (WASP actin nucleation promoting factor [Source:NCBI gene;Acc:101169454])

HSP 1 Score: 100.908 bits (250), Expect = 4.549e-22
Identity = 75/277 (27.08%), Postives = 131/277 (47.29%), Query Frame = 1
Query:  106 KPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNS-FYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQ------SQINY------SIDVKVP------YNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENE 867
            + +L++ +E ++ +EL+  RC  ++TAVA+L+    +S   W    TG++   KD+ +R+YFI++F+M   V  QE   LYN   Y   +T  HT +   C   L+FSD  E+E F N +   I  R  +++KK++      +  N+      ++D++ P      Y  + P    P  +   V       K          A      DI  P  F H+ H+G +     N  D N+ K    AG+ +  L D+ + + IY+ +++ GG+  ++ E
Sbjct:   13 RSSLLSQQENEKLEELLGRRCSSMATAVAQLFMALPHSPTMWSMQHTGVVCFVKDNPQRSYFIRMFDMKKMVWEQE---LYNQIIYSTPRTFFHTFTADDCQVGLNFSDEGEAEIFQNAVVEKISQRNNRQDKKQRPLPTPAAAGNHGSFHMATVDIQNPDIQSSRYRTMPP----PPAATAVVINNKKSKKSKKKGPKLSKA------DIGAPSGFTHVSHVGWDP----NNIDPNLLKLFSQAGISEADLKDEKTSQLIYNVIEQSGGIEAVQQE 272          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Match: wasa (WASP actin nucleation promoting factor [Source:NCBI gene;Acc:101169454])

HSP 1 Score: 96.6709 bits (239), Expect = 1.074e-20
Identity = 74/294 (25.17%), Postives = 128/294 (43.54%), Query Frame = 1
Query:  112 ALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNS---WEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTK-------------KNTDAKSSQ--------GAKKITKN-----------------DISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENE 867
            +L++ +E ++ +EL+  RC  ++TAVA+L+    +S   W    TG++   KD+ +R+YFI++F+M       E E+     Y   +T  HT +   C   L+FSD  E+E F N +   I  R  +++KK++                 P+    R S+  V   P K               +N D +SS+         A  +  N                 DI  P  F H+ H+G +     N  D N+ K    AG+ +  L D+ + + IY+ +++ GG+  ++ E
Sbjct:   15 SLLSQQENEKLEELLGRRCSSMATAVAQLFMALPHSPTMWSMQHTGVVCFVKDNPQRSYFIRMFDMKTEKMVWEQELYNQIIYSTPRTFFHTFTADDCQVGLNFSDEGEAEIFQNAVVEKISQRNNRQDKKQR-----------------PLPTPDRGSLPPV--PPDKAAGNHGSFHMATVDIQNPDIQSSRYRTMPPPPAATAVVINNKKSKKSKKKGPKLSKADIGAPSGFTHVSHVGWD----PNNIDPNLLKLFSQAGISEADLKDEKTSQLIYNVIEQSGGIEAVQQE 285          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Match: ENSORLT00000034896.1 (WASP like actin nucleation promoting factor [Source:NCBI gene;Acc:101168831])

HSP 1 Score: 93.9745 bits (232), Expect = 6.716e-20
Identity = 70/261 (26.82%), Postives = 130/261 (49.81%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHS-VTKVEAKPS-KTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E       +  +C  LS+AV ++Y   +N SW     G+  L KD+ +R+YFI++F++ +     E E+  +   ++ +T   T +   C   L+F++  E+++F   +  ++  R   + +   +    ++D+K P      I  E R+S   ++    S   ++  +       KK+TK DI  P NFQHL H+G   N  F  N  D  +K      G+ +  L DK + + IYD ++K GG+  ++NE++++
Sbjct:   17 LLTSQENDCLFNYLGRKCTTLSSAVVQVYTGDRNGSWNKRCCGVACLVKDNPQRSYFIRVFDIKDGRMMYEQELYQDFKMQMPRTYFATFAGDTCQVGLNFANEEEAKRFRGSVSELMGRR---QRRTGPALPMATVDIKNP-----EIDKEHRNSNFKQININTSFPRREKKNKGGGGKKKKLTKADIGTPSNFQHLGHVGWDPNTGFDLNNLDPELKNLFDMCGISETDLKDKETSKQIYDIIEKSGGVEAVKNELRRQ 269          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Match: ENSORLT00000041840.1 (WASP like actin nucleation promoting factor [Source:NCBI gene;Acc:101168831])

HSP 1 Score: 89.3521 bits (220), Expect = 1.890e-18
Identity = 73/266 (27.44%), Postives = 133/266 (50.00%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNVIPITNEPRHS-VTKVEAKPS-KTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E       +  +C  LS+AV ++Y   +N SW     G+  L KD+ +R+YFI++F++ +     E E+  +   ++ +T   T +   C   L+F++  E+++F   +  ++  R+ + EK+R           ++D+K P      I  E R+S   ++    S   ++  +       KK+TK DI  P NFQHL H+G   N  F  N  D  +K      G+ +  L DK + + IYD ++K GG+  ++NE++++
Sbjct:   17 LLTSQENDCLFNYLGRKCTTLSSAVVQVYTGDRNGSWNKRCCGVACLVKDNPQRSYFIRVFDIKDGRMMYEQELYQDFKMQMPRTYFATFAGDTCQVGLNFANEEEAKRFRGSVSELMGRRQRRTEKRRGPADGPALPMATVDIKNP-----EIDKEHRNSNFKQININTSFPRREKKNKGGGGKKKKLTKADIGTPSNFQHLGHVGWDPNTGFDLNNLDPELKNLFDMCGISETDLKDKETSKQIYDIIEKSGGVEAVKNELRRQ 277          
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Match: ENSORLT00000040322.1 (WASP like actin nucleation promoting factor [Source:NCBI gene;Acc:101168831])

HSP 1 Score: 89.3521 bits (220), Expect = 1.964e-18
Identity = 73/266 (27.44%), Postives = 133/266 (50.00%), Query Frame = 1
Query:  115 LVTDEEFKRFQELIENRCKVLSTAVARLYYV-KNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQIN-----YSIDVKVPYNNVIPITNEPRHS-VTKVEAKPS-KTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGL--NDHFFTNPDDENIKKFLKNAGMQQL-LDDKNSMEAIYDFVDKHGGLNKLENEMKQK 879
            L+T +E       +  +C  LS+AV ++Y   +N SW     G+  L KD+ +R+YFI++F++ +     E E+  +   ++ +T   T +   C   L+F++  E+++F   +  ++  R+ + EK+R           ++D+K P      I  E R+S   ++    S   ++  +       KK+TK DI  P NFQHL H+G   N  F  N  D  +K      G+ +  L DK + + IYD ++K GG+  ++NE++++
Sbjct:   17 LLTSQENDCLFNYLGRKCTTLSSAVVQVYTGDRNGSWNKRCCGVACLVKDNPQRSYFIRVFDIKDGRMMYEQELYQDFKMQMPRTYFATFAGDTCQVGLNFANEEEAKRFRGSVSELMGRRQRRTEKRRGPADGPALPMATVDIKNP-----EIDKEHRNSNFKQININTSFPRREKKNKGGGGKKKKLTKADIGTPSNFQHLGHVGWDPNTGFDLNNLDPELKNLFDMCGISETDLKDKETSKQIYDIIEKSGGVEAVKNELRRQ 277          
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Match: SMESG000074788.1 (SMESG000074788.1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 429/430 (99.77%), Postives = 430/430 (100.00%), Query Frame = 1
Query:  100 MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPXXXXXXXXXXXXXXWKD 1389
            MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGL+KLENEMKQKEMKDRKAPGIPPKVVPAAPQKQPPPPPPNRPPPNVYVAPSTQSNKPSVPVIGAPPPPPPPPPPPPPPAPVAPLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPNNSDDSNSESDEEDWKD
Sbjct:    1 MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLSKLENEMKQKEMKDRKAPGIPPKVVPAAPQKQPPPPPPNRPPPNVYVAPSTQSNKPSVPVIGAPPPPPPPPPPPPPPAPVAPLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPNNSDDSNSESDEEDWKD 430          
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Match: SMESG000074788.1 (SMESG000074788.1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 421/430 (97.91%), Postives = 422/430 (98.14%), Query Frame = 1
Query:  100 MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPXXXXXXXXXXXXXXWKD 1389
            MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKK        GAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGL+KLENEMKQKEMKDRKAPGIPPKVVPAAPQKQPPPPPPNRPPPNVYVAPSTQSNKPSVPVIGAPPPPPPPPPPPPPPAPVAPLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPNNSDDSNSESDEEDWKD
Sbjct:    1 MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKK--------GAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLSKLENEMKQKEMKDRKAPGIPPKVVPAAPQKQPPPPPPNRPPPNVYVAPSTQSNKPSVPVIGAPPPPPPPPPPPPPPAPVAPLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESLAVFLADRQNLMQPNNSDDSNSESDEEDWKD 422          
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Match: SMESG000054155.1 (SMESG000054155.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.277e-67
Identity = 158/364 (43.41%), Postives = 216/364 (59.34%), Query Frame = 1
Query:  130 EFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQ---KEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKAS 1209
            ++ +    + N+ K+L+ A+ +L +  + ++E SD  ++ LT+D + RNY I+ F +++F + Q++EIL  S Y I  +++H+  N K    L+F D ++SE F N++K+VI+++K +   K+   +  IN+S                      K +   S    + D K   G K   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G LS+I+KF+TKK K +
Sbjct:   11 QYSQVLNTLTNKSKILALALGKLNFNMDFNFESSDASLLLLTEDDDERNYHIRSFKLESFNQLQQYEILSESNYHIICSELHSFVNDKFILYLNFLDFIQSENFGNKVKSVIEMKKEKNGIKKTNERDNINWS----------------------KSQNSNSIFSNHLDIK---GPKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLSKILKFNTKKYKGA 339          

HSP 2 Score: 176.792 bits (447), Expect = 2.783e-48
Identity = 124/227 (54.63%), Postives = 145/227 (63.88%), Query Frame = 1
Query:  532 VPYNNVIPITNEPRHS-VTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKA 1206
            +P N  +P+  EPR   ++K+       K NT  K  +GAK   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G LS+I+KF+TKK K 
Sbjct:  308 MPANKHVPVAEEPRKGFLSKI------LKFNT--KKYKGAKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLSKILKFNTKKYKV 516          
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Match: SMESG000054155.1 (SMESG000054155.1)

HSP 1 Score: 228.794 bits (582), Expect = 4.409e-67
Identity = 158/356 (44.38%), Postives = 213/356 (59.83%), Query Frame = 1
Query:  154 IENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQ---KEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKAS 1209
            + N+ K+L+ A+ +L +  + ++E SD  ++ LT+D + RNY I+ F +++F + Q++EIL  S Y I  +++H+  N K    L+F D ++SE F N++K+VI+++K +   K+   +  IN+S                      K +   S    + D K   G K   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G LS+I+KF+TKK K +
Sbjct:   19 LTNKSKILALALGKLNFNMDFNFESSDASLLLLTEDDDERNYHIRSFKLESFNQLQQYEILSESNYHIICSELHSFVNDKFILYLNFLDFIQSENFGNKVKSVIEMKKEKNGIKKTNERDNINWS----------------------KSQNSNSIFSNHLDIK---GPKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLSKILKFNTKKYKGA 339          

HSP 2 Score: 164.081 bits (414), Expect = 1.729e-43
Identity = 117/220 (53.18%), Postives = 137/220 (62.27%), Query Frame = 1
Query:  532 VPYNNVIPITNEPRHS-VTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKF 1185
            +P N  +P+  EPR   ++K+       K NT  K  +GAK   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G L + +K 
Sbjct:  308 MPANKHVPVAEEPRKGFLSKI------LKFNT--KKYKGAKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLKKHIKL 509          
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Match: SMESG000054155.1 (SMESG000054155.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.348e-66
Identity = 158/356 (44.38%), Postives = 213/356 (59.83%), Query Frame = 1
Query:  154 IENRCKVLSTAVARLYYVKNNSWEFSDTGIISLTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCNALLSFSDRMESEKFANEIKNVIQIRKAQ---KEKKRQSQINYSIDVKVPYNNVIPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLSEIVKFDTKKLKAS 1209
            + N+ K+L+ A+ +L +  + ++E SD  ++ LT+D + RNY I+ F +++F + Q++EIL  S Y I  +++H+  N K    L+F D ++SE F N++K+VI+++K +   K+   +  IN+S                      K +   S    + D K   G K   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G LS+I+KF+TKK K +
Sbjct:   19 LTNKSKILALALGKLNFNMDFNFESSDASLLLLTEDDDERNYHIRSFKLESFNQLQQYEILSESNYHIICSELHSFVNDKFILYLNFLDFIQSENFGNKVKSVIEMKKEKNGIKKTNERDNINWS----------------------KSQNSNSIFSNHLDIK---GPKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLSKILKFNTKKYKGA 339          

HSP 2 Score: 163.31 bits (412), Expect = 7.141e-43
Identity = 120/232 (51.72%), Postives = 142/232 (61.21%), Query Frame = 1
Query:  532 VPYNNVIPITNEPRHS-VTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHLDHMGLNDHFFTNPDD-ENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGLNKLENEMKQKEMKDRKAPGIXXXXXXXXXXXXXXXXXXXXXXXXVYVAPSTQSNKXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPTISKPANKHVPVAEEPRGGLLS-EIVKFDTKKLKASSQS 1218
            +P N  +P+  EPR   ++K+       K NT  K  +GAK   +NDISIPMNFQHL HMGLNDHFFTN DD EN KKFL++  MQQL+DDKNS++AIYDFVDK+GGL+KLENE++QKEMKDRK   I              PP PNRPP N+   P T  N                 P P  PA VAPLL T S PANKHVPVAEEPR G L  EI+   ++ +  S  S
Sbjct:  308 MPANKHVPVAEEPRKGFLSKI------LKFNT--KKYKGAKTFPQNDISIPMNFQHLHHMGLNDHFFTNTDDLENFKKFLRSTKMQQLVDDKNSVDAIYDFVDKYGGLSKLENELRQKEMKDRKTSSI--PTKDLPICPPKQPPSPNRPPANICADPLTPCNN--------SSDTVIGAPLPHSPATVAPLLRTKSMPANKHVPVAEEPRKGFLKLEILTLQSELILKSHAS 521          
The following BLAST results are available for this feature:
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WAS1.006e-2326.13WASP actin nucleation promoting factor [Source:HGN... [more]
WASL2.887e-2326.87WASP like actin nucleation promoting factor [Sourc... [more]
WAS3.381e-1127.27WASP actin nucleation promoting factor [Source:HGN... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
WASp1.164e-1425.27gene:FBgn0024273 transcript:FBtr0085353[more]
WASp1.164e-1425.27gene:FBgn0024273 transcript:FBtr0085352[more]
WASp1.164e-1425.27gene:FBgn0024273 transcript:FBtr0336768[more]
WASp7.324e-1224.62gene:FBgn0024273 transcript:FBtr0085354[more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasb3.433e-2329.30WASP actin nucleation promoting factor b [Source:Z... [more]
wasa4.776e-2325.55WASP actin nucleation promoting factor a [Source:Z... [more]
wasa1.852e-2226.10WASP actin nucleation promoting factor a [Source:Z... [more]
wasla3.344e-2128.20WASP like actin nucleation promoting factor a [Sou... [more]
wasla3.344e-2128.20WASP like actin nucleation promoting factor a [Sou... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pld32.671e-2328.79phospholipase D family member 3 [Source:Xenbase;Ac... [more]
pld33.226e-2328.79phospholipase D family member 3 [Source:Xenbase;Ac... [more]
cux17.837e-735.56cut like homeobox 1 [Source:Xenbase;Acc:XB-GENE-85... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Wasl1.023e-2327.27Wiskott-Aldrich syndrome-like (human) [Source:MGI ... [more]
Was1.076e-2326.48Wiskott-Aldrich syndrome [Source:MGI Symbol;Acc:MG... [more]
Wasl4.007e-1025.32Wiskott-Aldrich syndrome-like (human) [Source:MGI ... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42768|WASP_HUMAN4.833e-2326.13Wiskott-Aldrich syndrome protein OS=Homo sapiens O... [more]
sp|O08816|WASL_RAT5.500e-2327.27Neural Wiskott-Aldrich syndrome protein OS=Rattus ... [more]
sp|Q91YD9|WASL_MOUSE7.157e-2327.27Neural Wiskott-Aldrich syndrome protein OS=Mus mus... [more]
sp|P70315|WASP_MOUSE7.525e-2326.48Wiskott-Aldrich syndrome protein homolog OS=Mus mu... [more]
sp|Q95107|WASL_BOVIN8.578e-2326.87Neural Wiskott-Aldrich syndrome protein OS=Bos tau... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3VJB55.456e-2729.28WASP actin nucleation promoting factor OS=Sarcophi... [more]
F6SA086.288e-2628.83WASP actin nucleation promoting factor OS=Monodelp... [more]
G3VJB41.598e-2527.49WASP actin nucleation promoting factor OS=Sarcophi... [more]
F7A8L81.603e-2531.37Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
A0A3B4CM131.975e-2527.37Uncharacterized protein OS=Pygocentrus nattereri O... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wasb1.490e-2728.87WASP actin nucleation promoting factor [Source:NCB... [more]
wasa1.575e-2127.14wiskott-Aldrich syndrome protein-like [Source:NCBI... [more]
ENSAMXT00000000927.21.436e-1927.92neural Wiskott-Aldrich syndrome protein [Source:NC... [more]
ENSAMXT00000048339.15.585e-1826.92neural Wiskott-Aldrich syndrome protein [Source:NC... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
waslb8.269e-2326.77WASP like actin nucleation promoting factor b [Sou... [more]
ENSPMAT00000010196.14.844e-1523.32pep scaffold:Pmarinus_7.0:GL476398:3:6998:-1 gene:... [more]
ENSPMAT00000006956.15.589e-1127.75pep scaffold:Pmarinus_7.0:GL476458:178519:198596:-... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO438652.511e-1424.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wasa4.549e-2227.08WASP actin nucleation promoting factor [Source:NCB... [more]
wasa1.074e-2025.17WASP actin nucleation promoting factor [Source:NCB... [more]
ENSORLT00000034896.16.716e-2026.82WASP like actin nucleation promoting factor [Sourc... [more]
ENSORLT00000041840.11.890e-1827.44WASP like actin nucleation promoting factor [Sourc... [more]
ENSORLT00000040322.11.964e-1827.44WASP like actin nucleation promoting factor [Sourc... [more]
back to top
BLAST of WASP like actin nucleation promoting factor b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074788.10.000e+099.77SMESG000074788.1[more]
SMESG000074788.10.000e+097.91SMESG000074788.1[more]
SMESG000054155.12.277e-6743.41SMESG000054155.1[more]
SMESG000054155.14.409e-6744.38SMESG000054155.1[more]
SMESG000054155.12.348e-6644.38SMESG000054155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017937 ID=SMED30017937|Name=WASP like actin nucleation promoting factor b|organism=Schmidtea mediterranea sexual|type=transcript|length=1795bp
TTTTAATTTAAGTTACTGAACAGGAATTTAATAGGTATTATTCCAAGTGA
AATAATTAGTTTTTAATAAAATCTTTCGTTAAATAAAAATTTTATCAAAA
TGACAAAACCAGCTTTAGTAACTGATGAAGAATTTAAACGATTTCAAGAA
CTTATTGAAAATAGATGTAAAGTTCTAAGTACAGCAGTAGCAAGATTGTA
TTATGTGAAAAATAATTCTTGGGAATTTTCGGATACTGGGATAATTTCAT
TAACTAAAGACAGTGAAAGACGAAACTATTTCATCCAATTATTTAATATG
GATAATTTCGTTAAAACCCAAGAATTTGAAATTTTATATAATTCTTTTTA
TGAAATTAAGCAGACTCAAATCCATACTTGTTCAAATGGTAAATGCAACG
CTTTGTTAAGTTTTTCAGATCGCATGGAATCAGAAAAATTCGCTAATGAA
ATTAAAAATGTGATTCAAATCAGAAAAGCACAAAAGGAAAAGAAACGACA
AAGTCAAATAAACTATTCAATTGATGTCAAAGTGCCATATAATAACGTTA
TTCCTATTACTAACGAACCGAGACATTCAGTAACAAAAGTGGAAGCAAAA
CCAAGCAAAACCAAAAAGAATACCGATGCAAAAAGTTCACAGGGTGCTAA
GAAAATTACTAAAAATGACATCAGTATCCCGATGAATTTCCAGCATCTGG
ACCACATGGGATTAAATGATCATTTTTTTACAAATCCCGATGATGAAAAT
ATTAAGAAGTTTCTTAAAAATGCTGGAATGCAACAATTACTAGATGATAA
AAATTCAATGGAGGCTATTTATGATTTTGTAGACAAACACGGAGGTTTGA
ATAAATTGGAAAACGAAATGAAGCAAAAAGAAATGAAAGATAGAAAAGCT
CCAGGTATTCCACCGAAAGTAGTACCTGCAGCTCCACAAAAGCAACCTCC
ACCACCACCACCTAATCGCCCACCTCCGAATGTTTATGTTGCTCCTTCAA
CTCAATCTAATAAGCCTTCAGTGCCAGTAATTGGTGCTCCTCCACCTCCT
CCACCACCTCCACCACCACCACCACCTCCAGCACCAGTCGCTCCACTCTT
GCCAACTATATCTAAACCAGCAAATAAGCATGTTCCGGTTGCTGAGGAAC
CTCGTGGAGGACTTCTTAGTGAAATAGTGAAATTCGATACAAAGAAATTA
AAAGCAAGCTCACAGAGTAATGGAAGACCGCCTGTCAAACCAAAAGACGG
AAACGACACGATTGGTTCATCTGAAGGAAATTCAATTTTAGAATCTTTAG
CGGTCTTTTTGGCAGATAGGCAAAATTTGATGCAACCAAACAACAGTGAC
GATTCGAATTCTGAATCAGACGAAGAAGACTGGAAAGATTGAGATAAATT
ATGTTTTCATACAAACATGATAATGAAAATATTACTTTTTATTGCGTCTA
TTTTTTTATAATTTGATAAAAAGAAATTTTTTTATTTATAACCTTATTCG
TGTGTTAATTAAATTTATTAACAGATTTTGTATAGTCCTGATAGCGATTT
TACTTTGAAATGTATTATTATCATTTGATAAACATTTATTCCGAATCGTT
TATGTTTGTTTTGTCCAAATATCTGGATAGAATTTGTCAGATTTTGTTGT
TTCATTTATGTTTCTGTAGTGCCGCAATTATACAACGCATAAATTTATAT
CGAAATCACTCTTGTGAATTAATAATTCTGTTCATATCCATTTGGCTTTA
TTAATATATGCAAATAGTAATTTTTCCATTAAATCACGCTTGGAC
back to top

protein sequence of SMED30017937-orf-1

>SMED30017937-orf-1 ID=SMED30017937-orf-1|Name=SMED30017937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=431bp
MTKPALVTDEEFKRFQELIENRCKVLSTAVARLYYVKNNSWEFSDTGIIS
LTKDSERRNYFIQLFNMDNFVKTQEFEILYNSFYEIKQTQIHTCSNGKCN
ALLSFSDRMESEKFANEIKNVIQIRKAQKEKKRQSQINYSIDVKVPYNNV
IPITNEPRHSVTKVEAKPSKTKKNTDAKSSQGAKKITKNDISIPMNFQHL
DHMGLNDHFFTNPDDENIKKFLKNAGMQQLLDDKNSMEAIYDFVDKHGGL
NKLENEMKQKEMKDRKAPGIPPKVVPAAPQKQPPPPPPNRPPPNVYVAPS
TQSNKPSVPVIGAPPPPPPPPPPPPPPAPVAPLLPTISKPANKHVPVAEE
PRGGLLSEIVKFDTKKLKASSQSNGRPPVKPKDGNDTIGSSEGNSILESL
AVFLADRQNLMQPNNSDDSNSESDEEDWKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030097hemopoiesis
GO:0030099myeloid cell differentiation
GO:0007015actin filament organization
GO:0006516glycoprotein catabolic process
GO:2000601positive regulation of Arp2/3 complex-mediated actin nucleation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036936CRIB_dom_sf
IPR000095CRIB_dom
IPR011993PH-like_dom_sf
IPR000697WH1/EVH1_dom
IPR011026WASP_C
IPR006588Peptide_N_glycanase_PAW_dom
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000697WH1/EVH1 domainPFAMPF00568WH1coord: 21..121
e-value: 5.2E-11
score: 42.5
IPR000697WH1/EVH1 domainPROSITEPS50229WH1coord: 18..125
score: 13.748
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 2..134
e-value: 7.6E-19
score: 69.7
IPR036936CRIB domain superfamilyGENE3DG3DSA:3.90.810.10coord: 195..279
e-value: 3.9E-12
score: 48.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 309..334
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 300..393
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 166..189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 407..430
NoneNo IPR availablePANTHERPTHR23202:SF34RE12101Pcoord: 1..428
NoneNo IPR availablePANTHERPTHR23202WASP INTERACTING PROTEIN-RELATEDcoord: 1..428
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 17..125
IPR000095CRIB domainPROSITEPS50108CRIBcoord: 191..204
score: 8.148
IPR011026Wiscott-Aldrich syndrome protein, C-terminalSUPERFAMILYSSF47912Wiscott-Aldrich syndrome protein, WASP, C-terminal domaincoord: 196..302