Fzd-5/8-3

Overview
NameFzd-5/8-3
Smed IDSMED30017913
Length (bp)2960
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fzd-5/8-3 (SMED30017913) t-SNE clustered cells

Violin plots show distribution of expression levels for Fzd-5/8-3 (SMED30017913) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fzd-5/8-3 (SMED30017913) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fzd-5/8-3 (SMED30017913) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017913

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30017913SMESG000035834.1 dd_Smed_v4_16571_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30017913SMESG000035834.1 dd_Smed_v4_16571_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017913SMESG000035834.1 SmedASXL_015746SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30017913SMESG000035834.1 dd_Smed_v4_16571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30017913SMESG000035834.1 dd_Smed_v4_16571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017913SMESG000035834.1 dd_Smed_v6_16571_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30017913SMESG000035834.1 Contig35779newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30017913SMESG000035834.1 Contig35779uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017913SMESG000035834.1 Contig35779newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017913SMESG000035834.1 Contig35779uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017913SMESG000035834.1 OX_Smed_1.0.08817ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fzd-5/8-3 vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 360/545 (66.06%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPR--PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +                     C CR+P + I + +   +N+V T  + NCA  C  P FS++ ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC           + + Y  +GPA CTIVFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+GICYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C     H    PR  P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFV-------------CKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSAD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACS-------REHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCAC---PGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSR-----CCCRPRRGHKS 547          
BLAST of Fzd-5/8-3 vs. Ensembl Human
Match: FZD7 (frizzled class receptor 7 [Source:HGNC Symbol;Acc:HGNC:4045])

HSP 1 Score: 434.106 bits (1115), Expect = 1.396e-140
Identity = 228/546 (41.76%), Postives = 330/546 (60.44%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNL---SCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            D G C+ I IP+C DI YN T++PN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C     +++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S  S       T  P      +    A     ++           R     SC +      ++    +     LG  +C   C+        +  E +++F   W+G+W+++C  ST   V T+ +D  R+ YPERPIIF+S CYFMV++  +   ++  ED A  + +  D    ++ +        CTI+F+++Y+FGMA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  VDGD +SG+CYVG +S   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R  W +     +C  +       + P   P ++VFM KY M M VG+T+GFWIWS KT+ SW+   +RL  +S
Sbjct:   45 DHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC-TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGE--ICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDG--------RGRPAFPFSCPR------QLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLL--EDRAVCVERFSDDGYRTVAQGTKK--EGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSS 568          
BLAST of Fzd-5/8-3 vs. Ensembl Human
Match: FZD2 (frizzled class receptor 2 [Source:HGNC Symbol;Acc:HGNC:4040])

HSP 1 Score: 432.565 bits (1111), Expect = 3.931e-140
Identity = 234/553 (42.31%), Postives = 328/553 (59.31%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCK------SPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN-LSCDC----FDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVE 2106
            D G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   ++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FP +   +  +C+ +N S             P  Q  A               Y              +   P      +    +     LG  +CA  C+      S FFS E + +F   W+  W+++C  STF  V T+ +D  R+RYPERPIIF+S CY MVS+ ++   V+  E + C+   ++DG    +      G   CTI+F+++Y+F MA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  +DGD +SG+C+VG  S   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLE+LM+RIGVFSVLYT PA +++AC  YE   R  W ++ +S  C         H      P ++V+M KY M + VG+TSGFWIWS KT+ SW+    RL  NS H E
Sbjct:   35 DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ---AIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQ--ICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRY-------------ATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQE-ETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL-QERVVCNERFSEDGYRTVVQGTKKEG---CTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL-TNSRHGE 562          
BLAST of Fzd-5/8-3 vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 426.402 bits (1095), Expect = 1.635e-137
Identity = 232/554 (41.88%), Postives = 320/554 (57.76%), Query Frame = 1
Query:  472 DNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAE-----INKAHFNRVSTLGMFNCAQGCKS--PFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGK-TEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWY------------QNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVC 2073
            D      GKC+ I+IPMCKDI YNMT MPN+  HENQ EA  + H+F PLV+  C   L+FFLCS+Y P+C +Q    +P CR +CE+ +  C P+++++ FKWP+ ++C + P  N+P   LCME                AP   +D  +R       L    ++  R ++++         PL D         N   F+ V      +CA  C      + S  D++F   WL +W ++C  S+   V TF IDP R+RYPERPIIF+S+CY + S+G+LIR+  G E +ACD    +D   L +++ G      CT+VFL++YYFGMA+SLWWV+LT+TWFLAAG KWG EAI   S  +H  AW +P +K+I+ L M  V GD ++G+CYVG+     L  FVL PL  YL IGT  ++SGF +LF IR ++K  TGG+ T+KLEKLM+RIG+FSVLYT PA  ++AC  YE  N   W             Q  + DC       +    P+  +FM K FM + VG+TSG WIW+ KT+ SW+ VC
Sbjct:   25 DMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDP-NYLCME----------------APNNGSDEPTRGSG----LFPPLFRPQRPHSAQ-------EHPLKDGGPGRGGCDNPGKFHHVEKSA--SCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACD----RDSGQLYVIQEGLESTG-CTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMK--TGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCL------MAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVC 535          
BLAST of Fzd-5/8-3 vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 427.172 bits (1097), Expect = 5.961e-137
Identity = 230/552 (41.67%), Postives = 333/552 (60.33%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP------FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN----------LSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            D G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   +LPPCRS+CER ++GC+ L+ K+ F+WP+ + C++FPV+   E  LC+ +N S   T   S++     E   +N +     +           +       + SC + L   + +N  HF     LG  +C   C+        +F  E + +F   W+G+W+++C  ST   V T+ +D  R+ YPERPIIF+S CY  V++ ++   ++  + + C+   A+DG+              CTI+F+++Y+F MA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P IK+I  L +  VDGD +SG+C+VG  +   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R +W ++          + C    +       P   P ++VFM KY M + VG+TSGFWIWS KT+ SW+    RL
Sbjct:  112 DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQ---ALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGE--LCVGQNTSDKGTPTPSLL----PEFWTSNPQHGGGGHRGGFPGGAGASERG-----KFSCPRALKVPSYLNY-HF-----LGEKDCGAPCEPTKVYGLMYFGPE-ELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLL-EDRVVCNDKFAEDGARTVAQGTKKE---GCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRL 637          
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Match: cfz-2 (Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ2])

HSP 1 Score: 377.481 bits (968), Expect = 2.650e-119
Identity = 204/544 (37.50%), Postives = 305/544 (56.07%), Query Frame = 1
Query:  490 KGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVIT----------------LAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIIC-LLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ--TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            + KCE I IP+CK I YNMT  PN + HE Q+EAG E HQFYPLV++ C + L+FFLC++YTPIC + Y K + PC  +C   +  C P++ KY F+WPE ++C+  P          M   +ST +   A   T                         +  +V    + NEV    +        CQC+C +P   +A   K+    V+     NCA  C SP  +       +  W+  W+I C +L++F+ + TF I+  R++YPERPI  ++ C  MV++GF+IR  +GHE++ACD ++ K     S         + C +VFLL Y+FGMAAS+WWV+L++TW L+A  KW  EAIS +S  +H + W LP I++++ +  +A+DGDP++GICYVGNT      +FVL PLLVY  +G L L+ GF +L+ IR+ ++ Q  +     K+ +LM +IG+FS+LYT P+ +I+  + YE  +R+ W Q+  C C      +  +   S  + + K      +G TSGFW+ S KT+ SWK
Sbjct:   22 RQKCEQITIPLCKGIGYNMTSFPNSYGHEKQEEAGLEVHQFYPLVEVGCFQHLKFFLCTMYTPICQENYDKPILPCMELCVEARSKCSPIMAKYGFRWPETLSCEALPK---------MSDQMSTGNICAAPPDTPKKQHKGHHHKNQNQNQNQNHNYSPDGPEVGISKIDNEVIAGPSE-------CQCTCNQPFQFVAS-EKSKVGNVT-----NCAYSCHSPALAE--SHSLVSNWMAFWSITCCVLASFTFL-TFLIETDRFQYPERPIFMLAFCQLMVAVGFMIRYFVGHEEIACDSMRIKGADDNSG--------SLCFVVFLLTYFFGMAASVWWVILSLTWVLSAASKWSPEAISSFSFHFHVVGWCLPAIQTVLVIVFNAIDGDPITGICYVGNTDLQFQRIFVLFPLLVYFIVGVLFLVIGFCNLWSIRNEVQKQHPSLESAHKITQLMSKIGIFSLLYTIPSLLIICVLFYEQNHRSLWEQSQLCSC----SPKQTIGDSSLIISLIKTCCMCILGWTSGFWVCSTKTLSSWK 528          
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 304.294 bits (778), Expect = 5.823e-92
Identity = 176/578 (30.45%), Postives = 290/578 (50.17%), Query Frame = 1
Query:  463 LKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMF-NCAQGCKS----PFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGG---KTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN-LSCDCFDSNRHQL--------------NLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS----CHVEERN 2115
            + S N      KCE I IPMCK++ YN T+ PN+  H  Q EAG    QF PL+++KCSED++ FLC++Y P+C     K + PCR +C   K GC+ L++K+ F+WP++++C++FPV            +L     +  S  +   +  ND              V++ ++   N  V     C      +   + +HF+     G    C+  C++    P       ++ +  W   W++ C + +   + TF +D  R+ YP RPI++++ CY  +S  ++I +V G +  AC    +   + ++           C+ + ++ Y+F M++  WW++L + WFLAA LKWG+E+I+  S  +H + W +P + S+  L  ++VDGD  +GIC VGN +   L+ F  +P++V L +G ++L+ G  S+ RIRS IKLQ         KLEKLM+RIG F+++Y+ P A+  A + Y+  N   W +  L   C      +L               +  P   VF+ KY   + VG+T   W+ S KT+ S+      L   S     HV++ N
Sbjct:   25 ISSMNGFSTTRKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPV-----------TDLCVGKNSSESSNSKNYRSSND--------------VTFGVSTIANEVVLSPKKCPH---HMHTTSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGVV-GEDGFACGTYGSTPTTLVTQGGEN----VGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLALSSRSPTVPAHVDQVN 568          
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 302.368 bits (773), Expect = 2.689e-91
Identity = 176/586 (30.03%), Postives = 290/586 (49.49%), Query Frame = 1
Query:  463 LKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCM-------------EKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGG---KTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN-LSCDCFDSNRHQL--------------NLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS----CHVEERN 2115
            + S N      KCE I IPMCK++ YN T+ PN+  H  Q EAG    QF PL+++KCSED++ FLC++Y P+C     K + PCR +C   K GC+ L++K+ F+WP++++C++FPV +     LC+               +++   +T+A+ + L+PK+              L  +S +L          +CS                          C    + P       ++ +  W   W++ C + +   + TF +D  R+ YP RPI++++ CY  +S  ++I +V G +  AC    +   + ++           C+ + ++ Y+F M++  WW++L + WFLAA LKWG+E+I+  S  +H + W +P + S+  L  ++VDGD  +GIC VGN +   L+ F  +P++V L +G ++L+ G  S+ RIRS IKLQ         KLEKLM+RIG F+++Y+ P A+  A + Y+  N   W +  L   C      +L               +  P   VF+ KY   + VG+T   W+ S KT+ S+      L   S     HV++ N
Sbjct:   25 ISSMNGFSTTRKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTD-----LCVGKNSSESSNSKKSSNDVTFGVSTIANEVVLSPKKCPHHMHTTSGSHFSLPLLSGRLP---------ECS------------------------LTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGVV-GEDGFACGTYGSTPTTLVTQGGEN----VGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLALSSRSPTVPAHVDQVN 566          
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 247.669 bits (631), Expect = 1.930e-71
Identity = 156/542 (28.78%), Postives = 258/542 (47.60%), Query Frame = 1
Query:  454 FYPLKSDNT--NRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEIN-KAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLW--TIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            F PL + +      KGKC  I I +CKD+ YN T  PN   H +Q         F PL++ KC   + FF+CS++ P+C     +++  C+SVCE+VK  C  +L+++   WPE +NC QFP  + PE  LCM+      +   +     AP+     +S   ++                        C   L+D+   + K+H           CA  C+S    S  +++ +  W  +W       ++ FS + TF+ID  R+R+PER + ++S+C F+ SL +L  + +     +C  +                  ++C   FLL Y+F  AA+LWW++ + T +L+ G KW  E I   S   HF+AW L  + +I+ L  + VD   ++ +C VGN +   L+ FV+ P  + + IGT  ++ GFAS+ R R   + + G  T KLEKLM+++G F  L+  P  + + C  Y+     +W + ++ DC   +        P   ++M      +  G +   W+ S KT+ +WK
Sbjct:   11 FIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP--DPPE--LCMKPTEDEITGGFS-----APRLPTKGSSSSSSKPT---------------------GCPSDLVDVDPHDPKSH-----------CAFACQSNVMFSTDNKRMVRSW-SIWFAAANAGVALFSFL-TFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDN----SYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTR-GTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTR-MTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWK 503          
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 247.669 bits (631), Expect = 1.930e-71
Identity = 156/542 (28.78%), Postives = 258/542 (47.60%), Query Frame = 1
Query:  454 FYPLKSDNT--NRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEIN-KAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLW--TIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            F PL + +      KGKC  I I +CKD+ YN T  PN   H +Q         F PL++ KC   + FF+CS++ P+C     +++  C+SVCE+VK  C  +L+++   WPE +NC QFP  + PE  LCM+      +   +     AP+     +S   ++                        C   L+D+   + K+H           CA  C+S    S  +++ +  W  +W       ++ FS + TF+ID  R+R+PER + ++S+C F+ SL +L  + +     +C  +                  ++C   FLL Y+F  AA+LWW++ + T +L+ G KW  E I   S   HF+AW L  + +I+ L  + VD   ++ +C VGN +   L+ FV+ P  + + IGT  ++ GFAS+ R R   + + G  T KLEKLM+++G F  L+  P  + + C  Y+     +W + ++ DC   +        P   ++M      +  G +   W+ S KT+ +WK
Sbjct:   11 FIPLATGSIFDQAVKGKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFP--DPPE--LCMKPTEDEITGGFS-----APRLPTKGSSSSSSKPT---------------------GCPSDLVDVDPHDPKSH-----------CAFACQSNVMFSTDNKRMVRSW-SIWFAAANAGVALFSFL-TFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDN----SYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTR-GTDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTR-MTIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWK 503          
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 516.538 bits (1329), Expect = 5.128e-171
Identity = 270/593 (45.53%), Postives = 367/593 (61.89%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLA----------PKEQNDANSRQVAEQNLLNEVSYQLTRQYNSR------------VFCQCSCRKPLIDIAE------------INKAH-------FNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ----TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-------GINSCHVEER 2112
            +CE I IPMC+ I YNMT  PN  NHE QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LP CRSVCER + GC P++Q+Y+F+WPE+M C+  P++ +P+  LCME+   T + +  S                ++Q  + S            S +  R  NS+              C CSCR PLI + +            ++  H         R++  G+ NC   CK PFFS++ ++ F G W+ LW+ +C  ST   + TF ID  R++YPERPI+F+S CYFMV++G+L R  + +E++ACD +  ++ S+          P  CT+VFLL Y+FGMA+S+WWV+L+ TWFLAAGLKWG+EAI+K+SQ +H  AW +P ++S+  L +SAVDGDP+ GICYVGN +  +L  FVL+PL VYL IGT  L++GF SLFRIRS+IK Q     G K +KLEKLMIRIG+FSVLYT PA +++ C +YE     +W + L+C C      Q+  P  +P YSV M KYFM + VG+TSG WIWS KT+ SW+    RL       G N   +++R
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDN-LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIA--GVPNCGIPCKGPFFSND-EKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTG---------PHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPC-----AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQR 637          
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 516.538 bits (1329), Expect = 5.128e-171
Identity = 270/593 (45.53%), Postives = 367/593 (61.89%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLA----------PKEQNDANSRQVAEQNLLNEVSYQLTRQYNSR------------VFCQCSCRKPLIDIAE------------INKAH-------FNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ----TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-------GINSCHVEER 2112
            +CE I IPMC+ I YNMT  PN  NHE QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LP CRSVCER + GC P++Q+Y+F+WPE+M C+  P++ +P+  LCME+   T + +  S                ++Q  + S            S +  R  NS+              C CSCR PLI + +            ++  H         R++  G+ NC   CK PFFS++ ++ F G W+ LW+ +C  ST   + TF ID  R++YPERPI+F+S CYFMV++G+L R  + +E++ACD +  ++ S+          P  CT+VFLL Y+FGMA+S+WWV+L+ TWFLAAGLKWG+EAI+K+SQ +H  AW +P ++S+  L +SAVDGDP+ GICYVGN +  +L  FVL+PL VYL IGT  L++GF SLFRIRS+IK Q     G K +KLEKLMIRIG+FSVLYT PA +++ C +YE     +W + L+C C      Q+  P  +P YSV M KYFM + VG+TSG WIWS KT+ SW+    RL       G N   +++R
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDN-LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIA--GVPNCGIPCKGPFFSND-EKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTG---------PHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPC-----AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQR 637          
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 516.538 bits (1329), Expect = 5.128e-171
Identity = 270/593 (45.53%), Postives = 367/593 (61.89%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLA----------PKEQNDANSRQVAEQNLLNEVSYQLTRQYNSR------------VFCQCSCRKPLIDIAE------------INKAH-------FNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ----TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-------GINSCHVEER 2112
            +CE I IPMC+ I YNMT  PN  NHE QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LP CRSVCER + GC P++Q+Y+F+WPE+M C+  P++ +P+  LCME+   T + +  S                ++Q  + S            S +  R  NS+              C CSCR PLI + +            ++  H         R++  G+ NC   CK PFFS++ ++ F G W+ LW+ +C  ST   + TF ID  R++YPERPI+F+S CYFMV++G+L R  + +E++ACD +  ++ S+          P  CT+VFLL Y+FGMA+S+WWV+L+ TWFLAAGLKWG+EAI+K+SQ +H  AW +P ++S+  L +SAVDGDP+ GICYVGN +  +L  FVL+PL VYL IGT  L++GF SLFRIRS+IK Q     G K +KLEKLMIRIG+FSVLYT PA +++ C +YE     +W + L+C C      Q+  P  +P YSV M KYFM + VG+TSG WIWS KT+ SW+    RL       G N   +++R
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDN-LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIA--GVPNCGIPCKGPFFSND-EKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTG---------PHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPC-----AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQR 637          
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0330194)

HSP 1 Score: 516.538 bits (1329), Expect = 5.128e-171
Identity = 270/593 (45.53%), Postives = 367/593 (61.89%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLA----------PKEQNDANSRQVAEQNLLNEVSYQLTRQYNSR------------VFCQCSCRKPLIDIAE------------INKAH-------FNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ----TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-------GINSCHVEER 2112
            +CE I IPMC+ I YNMT  PN  NHE QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LP CRSVCER + GC P++Q+Y+F+WPE+M C+  P++ +P+  LCME+   T + +  S                ++Q  + S            S +  R  NS+              C CSCR PLI + +            ++  H         R++  G+ NC   CK PFFS++ ++ F G W+ LW+ +C  ST   + TF ID  R++YPERPI+F+S CYFMV++G+L R  + +E++ACD +  ++ S+          P  CT+VFLL Y+FGMA+S+WWV+L+ TWFLAAGLKWG+EAI+K+SQ +H  AW +P ++S+  L +SAVDGDP+ GICYVGN +  +L  FVL+PL VYL IGT  L++GF SLFRIRS+IK Q     G K +KLEKLMIRIG+FSVLYT PA +++ C +YE     +W + L+C C      Q+  P  +P YSV M KYFM + VG+TSG WIWS KT+ SW+    RL       G N   +++R
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDN-LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIA--GVPNCGIPCKGPFFSND-EKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTG---------PHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPC-----AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQR 637          
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075028)

HSP 1 Score: 516.538 bits (1329), Expect = 5.128e-171
Identity = 270/593 (45.53%), Postives = 367/593 (61.89%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLA----------PKEQNDANSRQVAEQNLLNEVSYQLTRQYNSR------------VFCQCSCRKPLIDIAE------------INKAH-------FNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQ----TGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-------GINSCHVEER 2112
            +CE I IPMC+ I YNMT  PN  NHE QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LP CRSVCER + GC P++Q+Y+F+WPE+M C+  P++ +P+  LCME+   T + +  S                ++Q  + S            S +  R  NS+              C CSCR PLI + +            ++  H         R++  G+ NC   CK PFFS++ ++ F G W+ LW+ +C  ST   + TF ID  R++YPERPI+F+S CYFMV++G+L R  + +E++ACD +  ++ S+          P  CT+VFLL Y+FGMA+S+WWV+L+ TWFLAAGLKWG+EAI+K+SQ +H  AW +P ++S+  L +SAVDGDP+ GICYVGN +  +L  FVL+PL VYL IGT  L++GF SLFRIRS+IK Q     G K +KLEKLMIRIG+FSVLYT PA +++ C +YE     +W + L+C C      Q+  P  +P YSV M KYFM + VG+TSG WIWS KT+ SW+    RL       G N   +++R
Sbjct:   63 RCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDN-LCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIA--GVPNCGIPCKGPFFSND-EKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTG---------PHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPC-----AQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQR 637          
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Match: fzd5 (frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GENE-990415-218])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 279/537 (51.96%), Postives = 368/537 (68.53%), Query Frame = 1
Query:  469 SDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
             D+ ++D   CE I +PMCK I YN T MPN FNH+NQDE G E HQF+PLV+I CS DL FFLCS+YTPICL+ Y K LPPCRSVCER K+GC PL+ +Y F+WPE+M+C+Q P+  + ++ LCM++N S+ +TTL+      PK       R  A              Q   R   +C CR PL+ I +      NRV+T  + NCA  C  P+FS + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF++ CY  VSLG+++R++ GHE +AC+    +              PA CT+VFLLIY+FGMA+S+WWV+L+ TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN S   L  FVL+PL+VYL  G+L L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA ++VAC++YE   R  W + L+C C  S R +L +  P Y+VFM KYFM + VG+TSG WIWS KT+ SW+    R
Sbjct:   36 GDSASKDI-VCEPITVPMCKGIGYNHTYMPNQFNHDNQDEVGLEVHQFWPLVRIHCSPDLLFFLCSMYTPICLQDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDTDR-LCMDRN-SSETTTLSPPF---PKPTPKGTPRHRATAK-------SAPPQKCDR---ECHCRGPLVPIKKEAHPLHNRVNTGSLPNCALPCHQPYFS-QDERTFTTFWIGLWSVLCFVSTFTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHERVACEGTGDQQHILYDTTG-----PALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLEGLRGFVLAPLVVYLFTGSLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSC-PSERQRLGM-GPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFIAR 547          
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 276/540 (51.11%), Postives = 372/540 (68.89%), Query Frame = 1
Query:  466 KSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQ--CSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            +S  T   +  C+ I +P+CK I YN T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD  PV   P+  LCM+ N  T STT++ V++    +  +  S+ +   N   + S +     N    C+  C CR P++ +       +NRV T  + NCA  C +P+F+ + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS+G+++R++ GHE +AC+  +  D   +     G   PA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA +IVAC  YE  NR  W    +C C      +  + RP Y+VFM KYFM + VG+TSG W WS KT+ SW+  C R
Sbjct:   19 RSSGTTAKEITCQEIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGAPDT-LCMDYN-RTDSTTVSPVLS----KPTNYPSKAI---NPHKKKSGRPGVGPNKNKPCEPGCQCRAPMVPVNSDRHPLYNRVKTGQIPNCAMPCHNPYFT-QDERTFTAFWIGLWSVLCFISTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACN--REYDVEHIHYETTG---PALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWEITHNCSCL----LEQEIKRPDYAVFMLKYFMCLLVGITSGVWTWSGKTLESWRSFCTR 538          
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 270/527 (51.23%), Postives = 362/527 (68.69%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+C+ I YN T MPN FNH+NQDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD  PV  +P   LCM+ N + A+++ A     APK      SR        N+ S       +S    +C CR P++ +   +   +NRV T  + NCA  C +P+ S E ++ F  FW+G+W+++C LSTF+ VATF ID  R++YPERPIIF+S CY  VSLG++IR++ GHE +AC+     D             PA CT+VFLLIY+FGMA+++WWV+L+ TWFLAAGLKWG+EAI++YSQ +H  AW +P +KSI  L +S+VDGD ++GICYVGN +  NL  FVL+PL++YL IGT+ L +GF S+FRIRS+IK Q G KT+KLE+LM+RIGVF+VLYT  A +IVAC +YE  NR  W    +C+C    +     P+P Y+VFM KYFM + +G+TSG W WS KT+ SW+ +C R
Sbjct:   31 CQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNT-LCMDYNRTDATSSPA-----APK----TTSRPGKPFKRKNKSS-----PGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQE-ERTFATFWIGIWSVLCFLSTFATVATFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTG-----PALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIK-QGGTKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKK----APKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWRALCTR 531          
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 269/527 (51.04%), Postives = 361/527 (68.50%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+C+ I YN T MPN FNH+NQDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD  PV  +P   LCM+ N + A+++ A     APK      SR        N+ S       +S    +C CR P++ +   +   +NRV T  + NCA  C +P+ S E ++ F  FW+G+W+++C LSTF+ V TF ID  R++YPERPIIF+S CY  VSLG++IR++ GHE +AC+     D             PA CT+VFLLIY+FGMA+++WWV+L+ TWFLAAGLKWG+EAI++YSQ +H  AW +P +KSI  L +S+VDGD ++GICYVGN +  NL  FVL+PL++YL IGT+ L +GF S+FRIRS+IK Q G KT+KLE+LM+RIGVF+VLYT  A +IVAC +YE  NR  W    +C+C    +     P+P Y+VFM KYFM + +G+TSG W WS KT+ SW+ +C R
Sbjct:   31 CQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNT-LCMDYNRTDATSSPA-----APK----TTSRPGKPFKRKNKSS-----PGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQE-ERTFATFWIGIWSVLCFLSTFATVITFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTG-----PALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIK-QGGTKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKK----APKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWRALCTR 531          
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 443.351 bits (1139), Expect = 1.468e-144
Identity = 240/572 (41.96%), Postives = 345/572 (60.31%), Query Frame = 1
Query:  415 FILLKTVE-SSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN--------LSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            F+LL TV   + S  Y  +   +  + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS DL+FFLCS+Y P+C  L+Q   ++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S A +  ++     P+               L  +   L  + N +  C    + P        K HF     +G  +C   C+        +  E + KF   W+G+W+I+C +ST   V T+ +D  R+RYPERPIIF+S CYFMV++ +     +  ED    + K  D    ++ +        CTI+F+++Y+FGMA+S+WWV+L++TWFL+AG+KWG EAI   SQ +H  AW +P +K+I  L M  VDGD ++G+CYVG  +  +L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R +W +          +  C  +N   ++   P ++VFM KY M M VG+TSGFWIWS KT+ SW+    RL
Sbjct:   16 FLLLFTVALQTTSGQYHGEKGISIPEHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSMDLKFFLCSMYAPVCTVLEQ---AIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGE--ICVGQNTSDAGSPTSNPTPYVPE---------------LITLQPNLVVRPNQQFTCPLQLKVP-----TYLKYHF-----MGEKDCGAPCEPTRPNGLMYFREEEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFL--EDKVVCIDKFSDDGYKTVAQGTKK--EGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDMLTGVCYVGIYNVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPVNNFAPMS---PDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRRFYKRL 549          
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 278/534 (52.06%), Postives = 358/534 (67.04%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPK-EQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDC-FDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            C+ I +PMCK I YN T MPN FNH+ QDEAG E HQF+PLV I+CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL++KY F WPE+MNCD+ P + +P+  LCM+ N +  +TT         K   +D +                            C CR+P + I   +   +NR+ T  + NCA  C  P+F+ + ++ F  FW+GLW+I+C +STF+ VATF ID  R+RYPERPIIF+S CY  VS+G+++R+++GHE++AC+    KD             PA CT+VFLLIY+FGMA+S+WWV+LT TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GIC+VGN +  NL  FVL+PL+VYL  GT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+FSVLYT PA ++VAC IYE   R  W +  +C C  D  R+     RP Y+VFM KYFM + VG+TSG WIWS KT+ SWK    R   NS
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDT-LCMDYNWTETTTTPPPTHPPKVKTPSSDCDG--------------------------VCKCREPFLSITRESHPLYNRIKTGQVPNCAMPCFQPYFT-QDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACN----KDHIHYETTG-----PALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCPGDKKRY-----RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWKRFTGRCCRNS 523          
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 273/527 (51.80%), Postives = 356/527 (67.55%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+CKDI YN T MPN FNH+ QDEAG E HQF+PLV I CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER + GC PL+++Y F WP++M CD+ P   NP+  LCM+    T  TT A              +R   +     E      R       CQC  R P++ +       +NRV T  + NCA  C +P+FS E ++ F  FW+GLW+++C  STF+ V+TF ID  R++YPERPIIF+S CY +VS G+L+R++ GHE +AC      +     ++ Y  +GPA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P IKSI  L +S+VDGDPV+GIC+VGN +  NL  FVL+PL++YL IG++ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+FSVLYT PA ++VAC  YE  NR  W    +C+       Q    RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+  C R
Sbjct:   27 CQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDT-LCMDYYNRTEQTTAAPSHPEP----PKPPARSAPKGRTRVEPPRPRPRAPGCEPGCQC--RAPMVPVTNERHPLYNRVRTGQIPNCAMPCHNPYFSPE-ERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACS---RGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEVAQPR--RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRAFCTR 539          
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Match: bdh2 (3-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-985755])

HSP 1 Score: 434.106 bits (1115), Expect = 4.580e-141
Identity = 238/575 (41.39%), Postives = 336/575 (58.43%), Query Frame = 1
Query:  409 LVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTT---------LASVITLAPKEQNDAN-SRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNL---SCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            L+F LL     S   ++  K  +   D G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   ++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S  S +         L   IT  P    D    RQ+       +V   L  ++     C   C        E  KA+       G+           +  E + +F   W+G+W I+C +ST   V T+ +D  R+ YPERPIIF+S CYFMV++ +    ++    +  +        +++           CTI+F+++Y+FGMA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  VDGD +SG+CYVG  S  +L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSV+YT PA +++AC  YE   R  W +     +C  F       N     P ++VFM KY M M VG+TS FWIWS KT+ SW+   +RL
Sbjct:    7 LLFCLLLQPSPSAQQYHGEKGISVP-DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ---AIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGE--ICVGQNTSDNSPSGPTARPTPYLPDSITFHPHPNRDFTCPRQL-------KVPPYLGYRFLGEKDCGAPC--------EPGKAN-------GLM----------YFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYTAGFLLEERGVCVERFSEDSYRTVAQGTKK----EGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRL 538          
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 421.009 bits (1081), Expect = 5.879e-136
Identity = 222/551 (40.29%), Postives = 324/551 (58.80%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP---------RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGIN 2091
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   ++PPCRS+CER + GC+ L+ K+ F+WPE++ C+ FP +   +  +C+ +N S                ++   +               +    +    C    + P           +     LG  +CA  C+        F S+ + +F   W+ +W+++C  STF  V T+ +D  R+RYPERPIIF+S CY MVS+ ++   V+G + + C+   ++DG    +          CTI+F+++Y+F MA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  +DGD +SG+C+VG  +   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLE+LM+RIGVFSVLYT PA +++AC  YE   R  W ++        N   L +P          P ++V+M KY M + VG+TSGFWIWS KT+ SW+    RL  N
Sbjct:   36 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVCTVLEQ---AIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQ--ICVGQNHS----------------EDGGPTLLTTSPPHHGTPGPPIYATLDHPFHCPRVLKVP----------SYLNYRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLG-DKVVCNENFSEDGYKTVVQGTKK---EGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSW----VSQNCKSLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNN 546          
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 412.535 bits (1059), Expect = 2.152e-132
Identity = 224/544 (41.18%), Postives = 308/544 (56.62%), Query Frame = 1
Query:  472 DNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGG-KTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEW---YQNLSCDCF-DSNRHQLNLPR--PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK-MVCYR 2079
            D     + KCE I+IPMC+ I YNMT MPN   HE+Q+EA  +  +F PLV+  C   L+FFLCS+Y P+C +Q   S+P C+ +CE  ++ C P+++ + + WPE ++CD+ P  N+P   LCME                AP  +N  N       + +  V+ +  R   S +     C  P       +K  +   S +    C  G     + S  D+ F   W+  W+ +C +ST   V TF + P R++YPE+PIIF+S+CY + S  FLIR   G   +ACD            L       + CT+VFL++YYFGMA+SLWWV+LT+TWFLAA  KWG EAI  +   +H  AW +P IK+I+ LTM  V GD ++G+CYVG +    L  FVL PL  YL  GT  L++GF +LF IR ++K  TGG  TEKLEKLM++IGVFS+LYT PA  I+ C  YE  N A W    +  SC     S R   NLP   PS +VFM K FM + VG+TSG W+WS KT+ +W+ ++C R
Sbjct:   19 DVERGREAKCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHA-LCME----------------AP--ENATNGDPPTNGHGMLPVAPRPPRPSGSGIGISSRCANP-------DKFMYVERSGVCAPRCIPGVD--VYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDREGGAPYLIREGLES-----SGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRRVMK--TGGTNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCNLPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSKTLQAWQGILCQR 527          
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 272/543 (50.09%), Postives = 360/543 (66.30%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +      S              C+CR+P + I + +   +N+V T  + NCA  C  P FS + ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC    +        + Y  +GPA CT+VFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+GICYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C   +  Q    +P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSV-------------CTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSH-------IHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRA-KPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSR-----CCCSSRRGHKS 547          
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 272/543 (50.09%), Postives = 360/543 (66.30%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +      S              C+CR+P + I + +   +N+V T  + NCA  C  P FS + ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC    +        + Y  +GPA CT+VFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+GICYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C   +  Q    +P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSV-------------CTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSH-------IHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRA-KPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSR-----CCCSSRRGHKS 547          
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Match: Fzd8 (frizzled class receptor 8 [Source:MGI Symbol;Acc:MGI:108460])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 279/587 (47.53%), Postives = 369/587 (62.86%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKN---LSTASTTLASVITL-------------------APKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVF-CQ--CSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDX---------------------------------XXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTG-GKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCF-DSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+CK I YN T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD+ P   NP+  LCM+ N   L+TA+ +    +                     A       +SR   +            R        C+  C CR P++ ++      +NRV T  + NCA  C +PFFS + ++ F  FW+GLW+++C +STF+ V+TF ID  R++YPERPIIF+S CY  VS+G+L+R+V GHE +AC       G                                 +    +RY  +GPA CT+VFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN S  NL  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G  KT KLEKLMIR+G+F+VLYT PAAV+VAC+ YE  NR  W    +C C  D    Q    RP Y+VFM KYFM + VG+TSG W+WS KT+ SW+ +C R
Sbjct:   35 CQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDT-LCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFS-QDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQAR--RPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTR 617          
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Match: Fzd7 (frizzled class receptor 7 [Source:MGI Symbol;Acc:MGI:108570])

HSP 1 Score: 433.721 bits (1114), Expect = 1.377e-140
Identity = 227/548 (41.42%), Postives = 331/548 (60.40%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQ--NDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNL---SCDCF--DSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            D G C+ I IP+C DI YN T++PN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C     +++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S  S       T  P      D     ++  +    +S+              SC +      ++    +     LG  +C   C+        +  E +++F   W+G+W+++C  ST   V T+ +D  R+ YPERPIIF+S CYFMV++  +   ++  ED A  + +  D    ++ +        CTI+F+++Y+FGMA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  VDGD +SG+CYVG +S   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R  W +     +C  +         +   P ++VFM KY M M VG+T+GFWIWS KT+ SW+   +RL  +S
Sbjct:   45 DHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVC-TVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGE--ICVGQNTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPF------------SCPR------QLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLL--EDRAVCVERFSDDGYRTVAQGTKK--EGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSS 566          
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Match: Fzd2 (frizzled class receptor 2 [Source:MGI Symbol;Acc:MGI:1888513])

HSP 1 Score: 432.565 bits (1111), Expect = 3.126e-140
Identity = 233/553 (42.13%), Postives = 332/553 (60.04%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCK------SPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN-LSCDC----FDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVE 2106
            D G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   ++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FP +   +  +C+ +N S       +++T AP       +              +             +   P      +    +     LG  +CA  C+      S FFS E + +F   W+  W+++C  STF  V T+ +D  R+RYPERPIIF+S CY MVS+ ++   V+  E + C+   ++DG    +      G   CTI+F+++Y+F MA+S+WWV+L++TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  +DGD +SG+C+VG  S   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLE+LM+RIGVFSVLYT PA +++AC  YE   R  W ++ +S  C         H      P ++V+M KY M + VG+TSGFWIWS KT+ SW+    RL  NS H E
Sbjct:   40 DHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQ---AIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQ--ICVGQNHSEDGA--PALLTTAPPSGLQPGAGGTPGGPGGGGSPPRYA-----------TLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQE-ETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL-QERVVCNERFSEDGYRTVVQGTKKEG---CTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRL-TNSRHGE 567          
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Match: sp|O93274|FZD8_XENLA (Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 276/527 (52.37%), Postives = 360/527 (68.31%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+CKDI YN T MPN FNH+ QDEAG E HQF+PLV I CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER + GC PL+++Y F WP++M CD+ P   NP+  LCM+    T  TT A              +R V +     E     +R       CQC  R P++ ++      +NRV T  + NCA  C +PFFS E ++ F  FW+GLW+++C  STF+ V+TF ID  R++YPERPIIF+S CY +VS G+LIR++ GHE +AC      +     ++ Y  +GPA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P IKSI  L +S+VDGDPV+GIC+VGN +  NL  FVL+PL++YL IG++ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+FSVLYT PA ++VAC  YE  NR  W    +C+       Q +  RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+  C R
Sbjct:   28 CQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDT-LCMDYYNRTEQTTAAPSHPEP----PKPPARSVPKGRTRVEPPRSRSRATGCESGCQC--RAPMVQVSNERHPLYNRVRTGQIPNCAMPCHNPFFSPE-ERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSTGYLIRLIAGHEKVACS---RGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEMAQPH--RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRAFCTR 540          
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Match: sp|Q8CHL0|FZD5_RAT (Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 272/543 (50.09%), Postives = 361/543 (66.48%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +      S              C+CR+P + I + +   +N+V T  + NCA  C  P FS + ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC    +        + Y  +GPA CT+VFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+G+CYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C  S+  Q    +P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSV-------------CTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSH-------IHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGSDAGQPRA-KPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSR-----CCCSSRRGHKS 547          
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Match: sp|Q9EQD0|FZD5_MOUSE (Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 272/543 (50.09%), Postives = 360/543 (66.30%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +      S              C+CR+P + I + +   +N+V T  + NCA  C  P FS + ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC    +        + Y  +GPA CT+VFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+GICYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C   +  Q    +P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSV-------------CTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSH-------IHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRA-KPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSR-----CCCSSRRGHKS 547          
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Match: sp|Q13467|FZD5_HUMAN (Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 274/545 (50.28%), Postives = 360/545 (66.06%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPR--PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTS 2127
            C+ I +PMC+ I YN+T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL+++Y F WPE+M+CD+ PV     ++LCM+ N S A+T         P       +     +                     C CR+P + I + +   +N+V T  + NCA  C  P FS++ ++ F  FW+GLW+++C +ST + VATF ID  R+RYPERPIIF+S CY  VSLGFL+R+V+GH  +AC           + + Y  +GPA CTIVFLL+Y+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI AL +S+VDGDPV+GICYVGN +  +L  FVL PL++YL +GTL L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F++LYT PA+++VAC +YE   R  W   L+C C     H    PR  P Y V M KYFM + VG+TSG WIWS KT+ SW+    R     C    R  H S
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFV-------------CKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSAD-ERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACS-------REHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCAC---PGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSR-----CCCRPRRGHKS 547          
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Match: sp|P58421|FZD5_XENLA (Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 280/534 (52.43%), Postives = 358/534 (67.04%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPK-EQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDC-FDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            C+ I +PMCK I YN T MPN FNH+ QDEAG E HQF+PLV I+CS DL+FFLCS+YTPICL  Y K LPPCRSVCER K GC PL++KY F WPE+MNCD+ P + +P+  LCM  N +  +TTL        K   +D +                            C CR+P + I   +   +NR+ T  + NCA  C  P+F+ + ++ F+ FW+GLW+I+C +STF+ VATF ID  R+RYPERPIIF+S CY  VS+G+++R+++GHE++AC+    KD             PA CTIVFLLIY+FGMA+S+WWV+LT TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL+VYL  GT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+FSVLYT PA ++VAC IYE   R  W +  +C C  D  R+     RP Y+VFM KY M + VG+TSG WIWS KT+ SWK    R   NS
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDT-LCMYYNWTETTTTLPPTHPPKVKTPTSDCDG--------------------------VCKCREPFVSITRESHPLYNRIKTGQVPNCAMPCFQPYFT-QDEKMFVTFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYVVRLIVGHENVACN----KDHIHYETTG-----PALCTIVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVVYLFSGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKTHNCSCPGDKQRY-----RPDYAVFMLKYLMCLVVGITSGVWIWSGKTLESWKRFTGRCCRNS 523          
BLAST of Fzd-5/8-3 vs. TrEMBL
Match: T1DF42 (Fzd-5/8-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1389.4 bits (3595), Expect = 0.000e+0
Identity = 750/751 (99.87%), Postives = 751/751 (100.00%), Query Frame = 1
Query:  373 MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIXXXXXXXXXXXXXMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLXXXXXXTQNCFMSQSQMNHFNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFXXXXXXXXXXXXLPINSIQFPVIQL 2625
            MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASV+TLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL
Sbjct:    1 MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL 751          
BLAST of Fzd-5/8-3 vs. TrEMBL
Match: T1D138 (Fzd-5/8-3 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 519/750 (69.20%), Postives = 623/750 (83.07%), Query Frame = 1
Query:  397 WKKLLVFILLKT-VESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVIT--LAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVS---TLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIXXXXXXXXXXXXXMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLXXXXXXTQNCFMSQSQMN-HFNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFXXXXXXXXXXXXLPINSIQFPVIQL 2625
            W  L V +LL   +ES+ SDFYPLK +  + DK KCE IKIPMCKDI YNMT+MPNMFNHE QDEAGFEAHQF+PLVQI+CSEDL+FFLCSIYTPICL+ Y KSLPPCRSVCERVKKGC+PLL+KY FKWPEKM C QFPV++NPEKILCMEKN+ + +TT  +++   +A K+    + + +A Q+L  E+S+QL++Q N RVFCQC CRKPLI+I EINKAHFNRVS   TLGM NCA GCK  FF++ESDQKF  FWLGLWT ICL+STFSIVATFSIDP RYRYPERPIIF+SICYFM+SLGF++R+ MGHE++ACD I    G S SLL+YG +GPA CTIVF+LIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHF+AWF+PGIKSIVALTMSAVDGD ++GICY+GNTSDFNL LFVL+PL++YL IGTLVL SGFASLFRIR+IIK+QTGGKTEKLEKLMI+IG+FSVLYTAPA +I+AC+IYELQ+R+EWYQNLSCDC+D++R QLNLP+P Y+VFM KYFM+M VG+TSGFWIWSKKT+ SWK+ CYRLG+ SC++EER K+TSL ++E+R+GALLR+NN L +DNGS +SQ GG+KS SGVTHCPYTH+H +  N+        +C+M+Q   N H    I  A +APLP+PP+SSG STPPP  +   CI      Y+Q++ D+++++YLPFI+SHDTNPSCYFSSSG  S AS+ +P+    F V QL
Sbjct:    8 WITLTVLLLLSNHLESTESDFYPLKQNIIHTDK-KCERIKIPMCKDIDYNMTIMPNMFNHETQDEAGFEAHQFFPLVQIQCSEDLRFFLCSIYTPICLQGYGKSLPPCRSVCERVKKGCNPLLRKYKFKWPEKMECSQFPVFDNPEKILCMEKNIISVATTTTNLMEEPIAQKDFIKIDKKTIARQHLSTELSFQLSKQLNDRVFCQCQCRKPLIEIFEINKAHFNRVSYVSTLGMPNCALGCKLAFFATESDQKFTNFWLGLWTTICLISTFSIVATFSIDPSRYRYPERPIIFISICYFMLSLGFVLRLSMGHEEIACDSITGYGGQSFSLLKYGSTGPAQCTIVFILIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFIAWFIPGIKSIVALTMSAVDGDSITGICYIGNTSDFNLALFVLAPLMLYLLIGTLVLFSGFASLFRIRNIIKIQTGGKTEKLEKLMIKIGIFSVLYTAPATIIIACLIYELQHRSEWYQNLSCDCYDTHRRQLNLPQPIYAVFMLKYFMYMAVGITSGFWIWSKKTVRSWKIGCYRLGMTSCNIEERKKNTSLTNVELRHGALLRHNNMLSIDNGSSSSQHGGSKSVSGVTHCPYTHNHSNCTNIPGPNLLQNSCYMNQQCQNIHCRPIIACASTAPLPSPPRSSGNSTPPPHSIAGLCIP----SYLQNLQDTQDTTYLPFISSHDTNPSCYFSSSGGMSIASNGIPLKPNHFSVAQL 752          
BLAST of Fzd-5/8-3 vs. TrEMBL
Match: A0A3B4EPW2 (Frizzled class receptor 8a OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/538 (51.30%), Postives = 371/538 (68.96%), Query Frame = 1
Query:  466 KSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            +S  T   +  C+ I +P+CK + YN T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER + GC PL+++Y F WP++M CD  PV  +P+  LCM+ N  T STT + V++         +      ++       Q  R+  S     C CR P++ ++      +NRV T  M NCA  C +P+F+ + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS+G+++R++ GHE +AC   +  D   +     G   PA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA +IVAC  YE  NR  W  + +C C     H+L   RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+ +C R
Sbjct:   19 RSSGTTAKELTCQEIAVPLCKGVGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDTLPVQGDPDT-LCMDYN-RTDSTTASPVLSKPTGRPGKQHVPPHRTKHGHGRPGVQTKRKPGSPCEPGCQCRAPMVRVSSERHPLYNRVKTGQMPNCAMPCHNPYFT-QDERTFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACS--REYDVEHVHYETTG---PALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWETSHNCSCL--MEHELR--RPDYAVFMLKYFMCLSVGITSGVWIWSGKTLDSWRALCTR 543          
BLAST of Fzd-5/8-3 vs. TrEMBL
Match: A0A4W3HLB4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=3 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 278/535 (51.96%), Postives = 364/535 (68.04%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKN---LSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            C +I +P+CK I YN T MPN FNH++QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD+ P  +NPE  LCM+ N   LSTA+   A      P     AN     ++ L   +  +  +       CQC  R P++ ++      +NRV T  M NCA  C +P+FS + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS G+++R+V GHE +AC   +                PA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P IKSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIR++IK Q G KT+KLEKLMIRIG+F+VLYT PA ++VAC  YE  NR  W    +C C      +    RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+  C R   NS
Sbjct:   31 CHLITVPLCKGIGYNYTSMPNQFNHDSQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPQQSNPET-LCMDYNRTDLSTAAPGRARPSDKPPSGAGKANKGTNNKKPLQPALPPRPGKGRACERGCQC--RAPMVQVSSERHPLYNRVKTGQMANCALPCHNPYFS-QDERSFTAFWIGLWSVLCFVSTFTTVATFLIDMERFKYPERPIIFLSACYLFVSTGYIVRLVAGHESVACSQQRESGHIYYETTG-----PALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIANYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRNVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIVVACYFYEQHNRQSWEMTHNCSCLTEQEAR----RPDYAVFMLKYFMCLLVGITSGVWIWSGKTLESWRAFCTRCCWNS 551          
BLAST of Fzd-5/8-3 vs. TrEMBL
Match: V9KHZ2 (Frizzled-like 8a (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 278/530 (52.45%), Postives = 362/530 (68.30%), Query Frame = 1
Query:  514 IPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKN---LSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINS 2094
            +PMCK I YN+T MPN FNH+NQDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER K GC PL+++Y F WP++M CD+ P  +NPE  LCM+ N   LSTA+   A      P     AN     ++ L   +  +  +       CQC  R P++ ++      +NRV T  M NCA  C +P+FS + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS G+++R+V GHE +AC   +                PA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P IKSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIR++IK Q G KT+KLEKLMIRIG+F+VLYT PA ++VAC  YE  NR  W    +C C      +    RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+  C R   NS
Sbjct:    2 VPMCKGIGYNLTYMPNRFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPQQSNPE-TLCMDYNRTDLSTAAPGRARPSDKPPSGAGKANKGTNNKKPLQPALPPRPGKGRACERGCQC--RAPMVQVSSERHPLYNRVKTGQMANCALPCHNPYFS-QDERSFTAFWIGLWSVLCFVSTFTTVATFLIDMERFKYPERPIIFLSACYLFVSTGYIVRLVAGHESVACSQQRESGHIYYETTG-----PALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIANYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRNVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIVVACYFYEQHNRQSWEMTHNCSCLTEQEAR----RPDYAVFMLKYFMCLLVGITSGVWIWSGKTLESWRAFCTRCCWNS 517          
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 281/527 (53.32%), Postives = 371/527 (70.40%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            CE I +PMCK I YN+T MPN FNH+ Q+E G E HQF+PLV+I+CS DL FFLCS+YTPICL  Y K LPPCRSVCER K+GC PL+ +Y F+WPE+M+C+Q P+  +P++ LCM++N S+ +TTL+      PK     +SR  A     + V  +  R+        C CR+PL+ I + +   +NRV T  + NCA  C  P+FS + ++ F  FW+GLW+++C +ST + VATF ID  R++YPERPIIF++ CY  VSLG+++R++ GHE +AC             + Y  +GPA CT+VFLLIY+FGMA+S+WWV+L+ TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN S  +L  FVL+PL+VYL  G+L L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA ++VAC++YE   R EW Q L C C  S R Q  L  P Y+VFM KYFM + VG+TSG WIWS KT+ SW+    R
Sbjct:   37 CEPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDPDR-LCMDQN-SSETTTLSPSF---PKPTPRGSSRHRATSK--SAVPQKCDRE--------CRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQPYFS-QDERAFTTFWIGLWSVLCFVSTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACG-----GSGDQRHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQALGCSC-ASERQQQGL-GPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFVAR 539          
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 500.745 bits (1288), Expect = 6.975e-167
Identity = 260/558 (46.59%), Postives = 352/558 (63.08%), Query Frame = 1
Query:  406 LLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            L +F+ L T++         +S  T   +  C+ I +P+CK + YN T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LP                                  V  +P+  LCM+ N  T STT + V++         +      ++    V     R+  S     C CR P++ +       +NRV T  M NCA  C +P+F+ + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS+G+++R++ GHE +AC   +  D   +     G   PA CT+VFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ YSQ +H  AW +P +KSI  L +S+VDGDPV+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA +IVAC  YE  NR  W  + +C C     H+L   RP Y+VFM KYFM + VG+TSG WIWS KT+ SW+ +C R
Sbjct:   10 LFLFLALGTLQ---------RSSGTTAKELTCQEIAVPLCKGVGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLP----------------------------------VQGDPDT-LCMDYN-RTDSTTASPVLSKPTGRPGKPHVPPHRTKHGRPGVQ-PPKRKPGSPCDPGCQCRAPMVRVNSERHPLYNRVKTGQMPNCAMPCHNPYFT-QDERTFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACS--REYDVEHVHYETTG---PALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWETSHNCSCL--MEHELR--RPDYAVFMLKYFMCLSVGITSGVWIWSGKTLDSWRALCTR 510          
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 439.499 bits (1129), Expect = 4.511e-143
Identity = 224/548 (40.88%), Postives = 325/548 (59.31%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQN--------LSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLG 2085
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS DL+FFLCS+Y P+C  L+Q   ++PPCRS+CER + GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S   +  +     AP         +  +                           P     ++    +     LG  +C   C+        +  E + KF   W+G+W I+C +ST   V T+ +D  R+RYPERPIIF+S CYFMV++ ++   ++  + +  D  +     +++           CTI+F+++Y+FGMA+S+WWV+L++TWFL+AG+KWG EAI   SQ +H  AW +P +K+I  L +  VDGD ++G+C+VG  +   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R +W +          +  C  SN   ++   P ++VFM KY M M VG+TSGFWIWS KT+ SW+    RLG
Sbjct:   46 EHGFCQPISIPLCTDIQYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSADLKFFLCSMYAPVCTVLEQ---AIPPCRSLCERARHGCEALMNKFGFQWPERLRCEAFPVHGAGE--ICVGQNTSDPGSPTSEPTLYAPGLTPPPGPERSGQ---------------------------PFTCPLQLAVPSYLNYKFLGAKDCGAPCEHSQPHGLMYFREEEMKFGRLWVGIWAILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYVTGFLLEDKVVCIDKFREDAYRTVAQGTKK----EGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILALGQVDGDLLTGVCFVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPSSNFAPMS---PDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRSFYKRLG 553          
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Match: FZD7 (frizzled-7-A-like [Source:NCBI gene;Acc:103021589])

HSP 1 Score: 426.402 bits (1095), Expect = 6.381e-138
Identity = 227/546 (41.58%), Postives = 326/546 (59.71%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPR-------PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS DL+FFLCS+Y P+C  L+Q   ++PPCRS+CER + GC+ L+ K+ F+WPE++ C+ FPV+   E  +C+ +N S A+   A   +     +     R+          +  +     S     C  +   + +      HF     +G  +C   C+        +  E + KF   W+G+W+++C  ST   V T+ +D  R+RYPERPIIF+S CYFMV++ +     +  ED    + +  D    ++ +        CTI+F+++Y+FGMA+S+WWV+L++TWFL+AG+KWG EAI   +Q +H  AW +P +K+I  L +  VDGD ++G+CYVG  S   L  FVL+PL VYL +GT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA V++AC  YE   R +W +          R  +  P        P ++VFM KY M M VG+TSGFWIWS KT+ SW+    RL
Sbjct:   41 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSADLKFFLCSMYAPVCTVLEQ---AIPPCRSLCERARHGCEALMNKFGFQWPERLRCENFPVHGAGE--ICVGQNTSEAAGGGAGATS-----EPTGYGREPLTLPPGAGGAGGIGSGGKSSPHFTCPLQ---LRVPSYLNYHF-----MGEKDCGAPCEPTKPNGLMYFREEEVKFGRLWVGIWSVLCCASTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFL--EDRVVCIDRFSDDGYRTVAQGTKK--EGCTILFMILYFFGMASSIWWVVLSLTWFLSAGMKWGHEAIEANAQYFHLAAWAVPAVKTITILALGQVDGDVLAGVCYVGVHSVDALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATVVIACYFYEQAFRPQWERTWHMH--TCKRFAVPCPAGDFAPVTPDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRRFYKRL 561          
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 418.313 bits (1074), Expect = 1.388e-134
Identity = 217/544 (39.89%), Postives = 312/544 (57.35%), Query Frame = 1
Query:  472 DNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPF--FSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEW-YQNLSCDC--FDSNRHQ---LNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            D       KCE I IPMC+ I YN+T MPN  +H++Q EA  + ++F PLV+  C   L+FFLCS+Y P+C  Q   S+P CR +CE+ ++ C P+++K+ + WPE ++C + P  N+P   LCME                AP+       ++      +     Q             +C  P        K  +   S     +CA  C S    F S  D+ F   W+ +W+ +C +ST   V TF +DP R++YPERPIIF+S+CY + S+ F+IR V G E++ACD    +       +   G     CTIVFL++YYFGMA+S+WWV+LT+TWFLAAG KWG EAI  +S  +H  AW +P +K+IV LTM  V GD ++G+CYVG+     L  FVL PL  YL +GT  +++GF +LF IR ++K + G  TEKLEKLM++IG++S+LYT PA  ++ C  YE  N   W ++ L   C  F   R++   L+   P+ +VFM K FM + VG+TSG W+WS KT+ +W+ +C R
Sbjct:   33 DFERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNA-LCME----------------APENDTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACENP-------EKFQYVEKSE----SCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGE-----LYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRKVMKTE-GTNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRGLESKCVTFPGRRNEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSR 542          
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 536.954 bits (1382), Expect = 0.000e+0
Identity = 259/532 (48.68%), Postives = 349/532 (65.60%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAP-KEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRH----QLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +PMC+ I YN T MPN FNH++QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y + LPPCRSVCER + GC PL+++Y F WP++M CD+ PV  +  + LCM+ N S  +     V   AP +  N + +R                    S     C+CR P++ I       +NRV T  + NCA  C  P+F+ + ++ F  FW+GLW+I+C +STF+ V TF ID  R++YPERPIIF+S CY  VS+G+++R+V+GH+ + C+            + Y  +GPA CT+VFLL Y+FGMA+S+WWV+L++TWF+AAG+KW SEAI+ YSQ YH  AW LP ++S+  L  S+VD DP++GIC VG  S  NL  FVL PL VYL +G + L++GF SL RIR+ IK Q G KT+KLEKLM+RIG+FS+LYT PA  +VAC  YE ++R  W + L C     +      Q    RP Y +FM KYFM + VG+TSG WIWS KT+ +WK +C R
Sbjct:    9 CQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNR-LCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACES----GCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCHDPYFT-QDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICN-------QEHRHVHYETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGTKTDKLEKLMVRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDEEPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGKTVDTWKRLCCR 527          
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 440.654 bits (1132), Expect = 1.416e-144
Identity = 232/537 (43.20%), Postives = 327/537 (60.89%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGC--KSP---FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEW---YQNLSCDCFD---SNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS DL+FFLCS+Y P+C     K++PPCRS+C+R ++GC+ L+ K+ F+WPE++ C+ FPV  + E  +C+ +N     T  A    L P                  +     TR+   R      C + L     +N   F         NCA  C  K P    + SE + +F   W+G+W+++C  ST   V T+ +D  R+RYPERPIIF+S CYFMV++ ++   ++  + + C+   ++D                CTI+F+LIY+F MA+S+WWV+L +TWFLAAG+KWG EAI   SQ +H  AW +P +K+I  L M  VDGD +SG+C+VG +S   L  FVL+PL VYL +GT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIG+FSVLYT PA +++AC  YE   R +W   + + SC  F       H  N+ +P ++VFM KY M + VG+TSGFWIWS KT+ SW+
Sbjct:    9 EHGFCQPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVC-TVLEKAIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDE--ICVGQN----HTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTH-PFMCPRVLKVPPYLNAQLFRER------NCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAGFLL-DDKVVCNEQFSEDIYRTVTQGTKK---EGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTWVSQSCKGFAIPCPLNHYPNM-KPDFTVFMIKYLMTLIVGITSGFWIWSGKTLHSWR 525          
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 424.861 bits (1091), Expect = 1.052e-137
Identity = 225/550 (40.91%), Postives = 323/550 (58.73%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNL---SCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVE 2106
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS DL+FFLCS+Y P+C     +++PPCRS+CER ++GC+ L+ K+ F+WPE++ C+ FPV  +    +C+ +N +       +     P    D+ +     +         +            S    L     +    +     LG   C   C+        +    +  F   W+G+W+I+C  ST   V T+ +D  R+RYPERPIIF+S CY +VS+ +++      E + C+    K           G+    CTI+F+++Y+F MA+S+WWV+L++TWFL+AG+KWG EAI   SQ +H  AW +P IK+I  L M  VDGD ++G+C+VG  S   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIG+FSVLYT PA +++AC  YE   RA+W ++    +C  F     Q + P  +P ++VFM KY M + VG+TSGFWIWS KT+ SW+    RL  N  H E
Sbjct:   53 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVC-TVLEEAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENFPVQGSEN--ICVGQNHTDEKGGHPTPPDPHPIPHGDSFTLPPHYRPGGPSSGGGIGGGGGGGASGGDSSSYQLTCPHVLRVPSYLNYQFLGKKECGSPCEPSKSNGLMYFDADELWFARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFFF-EEKIVCN----KFFEDSYSTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVAHTCKSFAVQCPQGHYPNMKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWRNFYSRLS-NKSHGE 592          
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 372.474 bits (955), Expect = 1.335e-120
Identity = 189/355 (53.24%), Postives = 241/355 (67.89%), Query Frame = 1
Query: 1009 CSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGG-KTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            C CR PL+ I+      ++RV T  + NCA  C SPF   E  + F  FW+GLW+ +C  +TF+ V+TF ID  R++YPERPIIF+S+C  + SLG+++R+V GHE +AC        +    + Y  SGPA CT VFLL Y+FGMA  +WWV+L++TWF+AAGLKWGSEAI+ YSQ YH  AW LP IK+I AL M+AVDGDPV+GIC VGN S  NL  FVL+PL+ YL +GT  L++G  +LFRIR+ I    GG KTEKLE+LM+RIGVF+VLYT PAAV V C +YE Q+R  W + L C         L  P  RP ++VFM KYF+ +  G+TSG WIWS KT  SWK
Sbjct:    5 CGCRAPLVRISNPRHVLYDRVRTGQVRNCATPCHSPFLGRE-QRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACS-------ADWHHVLYASSGPALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKTEKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGARPDFAVFMLKYFVCLVGGITSGAWIWSGKTAGSWK 351          
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 226.098 bits (575), Expect = 4.095e-65
Identity = 135/337 (40.06%), Postives = 202/337 (59.94%), Query Frame = 1
Query: 1072 STLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTE-KLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNR----HQLNLP--RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSW 2061
            S +G+ +C+  C + +FSS  + +   + +G+ +++CL++T     TF +D  R+RYPERPIIF + CY  VSL FL+  ++     AC+      G++ ++ +   +  A CT VF+L+Y+  MA +LWWV+LTITWFLAAGLKWG EAI K +  +H LAW  P   ++  L ++ V+GD +SG+CY G      L  FVL+PL      G  +L++G  SL R+R  ++++  G+ + KL K M+RIGVFSVLY  P   +VAC++YE  +RA W      D     R    +Q N P  RP+  +F+ KYF  + VG+   FW+ S+KT L W
Sbjct:   23 SFMGVPDCSPPCPNMYFSS-GELELTRYLVGVMSVVCLVATTFTFLTFLLDRKRFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKA-CTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVR--LEMRHDGRNQTKLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWEATWLRDRCTEYRIPCPYQANQPKQRPALVLFLVKYFTTLVVGIPPAFWVGSRKTCLGW 355          
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 524.242 bits (1349), Expect = 1.076e-176
Identity = 272/529 (51.42%), Postives = 348/529 (65.78%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            KCE I IPMC+ I YN+T MPNMFNH+ Q EA  E HQF+PLV+I+CS DL+FFLCS+Y P+C K Y K LPPCRSVCER + GC PL++KY F WPE+M C+ FP   + E  LCM +N S  ST         PK    + S Q A       +S              CSCR P + IA  N      +S  G+  CA  C   +F+ + D  F  FW+GLW I+C +ST     TF +D  R++YPERPIIF+S CY MVS+G++IR++ GH+ +ACD        S  L+RY  SGPA CTIVFLL+Y+FGMA+S+WWV+L  TWFL+AG+KW SEAI+ YSQ +H +AW +P I++I  L MS +DGDPVSGICYVGN +  +L++FV+ PL+VYL  GT  L++GF SL RIR +++     KT+KLEKLMIRIGVFSVLYT PA ++VAC  YEL NR  W + ++C      R      +P +SVF+ KYFM + VG+TSGFWIWS KTI SW+  C RL
Sbjct:   28 KCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGD-ENTLCMGRNSSGEST---------PKP---SQSPQPAPSPDTAAISANC-----------CSCRPPFVSIAGKNIKPTRAISVGGVPQCAMACNRTYFTHDQDS-FASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIACD--------SNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQHGSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETWERTINCSGCGVTRV-----KPDHSVFIIKYFMALVVGITSGFWIWSGKTIESWRNFCARL 518          
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 420.239 bits (1079), Expect = 1.877e-136
Identity = 218/539 (40.45%), Postives = 312/539 (57.88%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNR--------AEWYQNLSCDCFDSN--------RHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            +CE + IP+C  + YNMT+ PN   H  Q+EA  E HQF+PLV++ CS+DL FFLCS+Y P+C       LPPCRS+C  V+ GC+ L++++ F WP+ ++C++FP   +    +C+ +N +T            P    D           +N  +Y        R  C            E  K   ++ +  G   CA  C++ FF+ + +++    W G+W I+C +ST   + TF ID  R+RYPERPIIF+S CYFMVS+ F+   V G + +AC+    K      +          CT++F+++Y+F MA+S+WWV+LT+TWFLAAGLKWG EAI   SQ +H  AW +P +K+I  L M+ VDGD +SG+CYVG +    L  +VL+PL VY  IG   L++GF SLFR+RS++K     K EK+EKLMIRIGVFS+LYT PA V++ C+ YE  NR          W +   C   ++          + + L +P + VFM KY MF+ VG+TSGFWIWS KT+ SW+
Sbjct:   28 RCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVC-TVLETPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDE---ICVGENTTT------------PTSDQDGG---------INNNTYPDVDMSTMRYRC-----------PESQKIPNDQYTFHGEKRCAATCRNVFFT-KREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIAFITGYVAG-DKIACNEPIKKGFPKTLVQGTKH---EGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRVRSVLK-DDYSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKTLNSWR 524          
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 403.29 bits (1035), Expect = 4.206e-129
Identity = 215/556 (38.67%), Postives = 316/556 (56.83%), Query Frame = 1
Query:  403 KLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPR--PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWK 2064
            K L  ILL  +  S +  Y  +S+  N    KC  I IP+C  I YN T  PN    E+Q+EA    H+F PL+ + C+  L+FFLCS++ P+C K+    +  CRS+CE  + GC P++Q++ F WP+ ++CD+ P   +P+           A +    +   AP      N +Q A    LNE       +     F + +   PL       +  +  V       C   CKS    S ++++F   W+ +W+++C +ST   V TF ID  R++YPERPIIF+S+CY + SLG+++R+  G  ++ CD    +  S +       +  A C++VFLL+YYFGMA+++WWV+LT  WFLAAG KWG EAI + +  +H +AW +P I++I+AL M  VD D ++G+CYVGN    NL  +VL+PL +YL +GT  L++GF SLFRIR+++K      T+KLEKL++RIGVFSVLYT P + ++AC  YE  N   W      + +     Q  L    PS  VF+ KYFM + +G+TS  WIWS KT  SW+
Sbjct:    4 KRLALILLLFITVS-AMVYGQRSEVPN---SKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLPKKGDPQ-----------AKSDPTKLCMAAP------NIKQTAP---LNESDIWSNFESLGPEFKKINNTGPL-------RYKYTYVEKYD--QCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICD----ETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLK-NKETNTDKLEKLIVRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPFNTYICRGDQACLENYGPSIEVFIVKYFMLLIIGITSNMWIWSTKTFKSWR 521          
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 369.392 bits (947), Expect = 1.555e-117
Identity = 208/544 (38.24%), Postives = 300/544 (55.15%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCS-EDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL-GINSCHVEERNKH 2121
            KCE I I +C+ + YN+T MPN+  HE Q EA  +  QF PL+Q  C+ E L FFLCS Y P+C  +    +  CR +CE V+K C P+L ++   WP  +NC +F V NN E+ +CM     T S           K + D        +   +  S Q  R  NS                   K +F   ST    +CA  C        SD++ +  W+ +W+I C +ST   + TF I+ GR++YPER II++++CY   SL ++IR+  G + ++CD       + +      G     C IVFL+ Y+F MAA++WWV+L +TWFLAAG+KWG EAI  Y++++H +AW LP IK+I  L    VDGD ++G+C+VGN     L  FVL P   YL IGTL LI+GF +LFRIR+ ++     KT+KLE+L++RIG+FSVL T PA  ++AC  YE  N+  WY           +    +  P++S+FM K FM +  G+ +G WIWS KT+ +W+   Y++ G       ERN +
Sbjct:    3 KCEKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVITSCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNN-ERNMCMPGPNFTES---------PEKPRPDFKPINDTTEKPPSTGSEQCRRFKNS-------------------KNYFYVQSTE---SCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCD---TDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTTVQRGGQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYWYY---------GQRDGAVAEPNFSIFMLKVFMSLFTGVITGMWIWSHKTMNTWRAFYYKVSGKRPPRKLERNGN 502          
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 150.214 bits (378), Expect = 3.253e-38
Identity = 132/546 (24.18%), Postives = 227/546 (41.58%), Query Frame = 1
Query:  496 KCEIIKIPMCK----DIHYNMTMMPNMFNHENQDEAG---FEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLA-AGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIR-SIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLN--------LPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            KCE +K   C     D HY  T +    + ++Q +     +E  +F P    KC E LQ FLC IY P C    V+   PCR  C   +K C  +++ Y  +WPE + CD+ P                                  + N     ++  LNE +                C+ PL++ A      +      G+  C   C +P FS E   +   F     T+  + + F++V        + RYP   + FM+ C+ + S+GFLI+      D    ++  +D +              C + F+L+YYF +A   W+V+L  +W +    L    +  +  +  +H ++W LP + +   L +  VD + +SGIC+VG  +      F+L+PL + L IG + L  G  +LF++R S     +   + K+++ ++R+G F+ +  A   +  AC +YE  N+  W ++          H++           R + SV         G G+    W W+  T  +WK + +R+
Sbjct:   25 KCEPLKEQTCLGEKLDYHYTTTELVTDSSSQDQVKKNLEKWEGLKFLP----KCWEVLQPFLCQIYKPKCKNGSVEL--PCREQCFATRKPCS-VVESYR-RWPEFLRCDKLP----------------------------------EGNCNGTLKKLHLNESA----------------CKAPLVETA------YKPSWYEGIEGCGIQCMNPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNRYPSVILFFMNACFCVASVGFLIQF---SSDARRKVVCRRDDTMRLGEPTESDS-FLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTRDNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTLFKLRKSNPNFLSNRASIKIKETIMRVGFFAFVAFAFVFITFACHVYEYYNQERWERSYRAFLMCIANHEVKGVSNTCSIKDRANLSVLELSLSSLFGAGIAMSGWTWTSNTFKTWKKLWHRV 502          
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Match: ENSORLT00000013002.2 (pep primary_assembly:ASM223467v1:21:5638676:5644296:-1 gene:ENSORLG00000010376.2 transcript:ENSORLT00000013002.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 277/527 (52.56%), Postives = 363/527 (68.88%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            CE I +PMCK I YN+T MPN FNH+ Q+E G E HQF+PLV+I+CS DL FFLCS+YTPICL  Y K LPPCRSVCER K+GC PL+ +Y F+WPE+M+C+  P   +  + LCM++N S A+T+        PK +    S    ++                    +C CR PLI I   + A F RV T  + NCA  C  P+FS++ ++ F  FW+GLW+++C +ST + VATF ID  R++YPERPIIF++ CY  VSLG++IR+V GHE +AC       G+S   + Y  +GPA CT+VFLL+Y+FGMA+S+WWV+L+ TWFLAAG+KWGSEAI+ YSQ +H  AW +P +KSI+ L +S+VDGDPV+GICYVGN S  NL  FVL+PL+VYL  GTL L++GF SLFRIRSIIK Q G KT+KLE+LMIRIG+F+VLYT PA ++VAC++YE   R  W + L+C C      Q ++  P Y+VFM KYFM + VG+TSG WIWS KT+ SW+    R
Sbjct:   24 CEPITVPMCKGIGYNLTYMPNKFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYRKPLPPCRSVCERAKRGCSPLMSQYGFEWPERMSCEGLPQLGD--ETLCMDQNSSEATTSAPPFPKSTPKVRTRPPSPSQCDR--------------------ECRCRDPLIPIKRESHALFGRVQTGPLPNCALPCHLPYFSAD-ERAFTSFWVGLWSVLCFISTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIIRLVAGHERVAC----GAGGTSQLHILYDATGPALCTLVFLLVYFFGMASSIWWVVLSFTWFLAAGMKWGSEAIAGYSQYFHLAAWLIPSVKSILVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLVVYLFTGTLFLLAGFVSLFRIRSIIK-QGGTKTDKLERLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSC--PLERQRSIRGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRSFVAR 520          
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Match: ENSORLT00000002667.2 (pep primary_assembly:ASM223467v1:17:316235:318512:1 gene:ENSORLG00000002147.2 transcript:ENSORLT00000002667.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 268/528 (50.76%), Postives = 356/528 (67.42%), Query Frame = 1
Query:  496 KCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            +C+ I +P+CK I YN T MPN F+H+ QDEAG E HQF+PLV+IKCS DL+FFLCS+YTPICL+ Y K LPPCR VCER K GC PL+++Y F WP++M CD  P   N +  LCM+   S+ +TT++  +    K  N         +           +   S     CSCR P++ ++       NRV T  + NCA  C +P+F+ E ++ F  FW+GLW+I+C +STF+ VATF ID  R++YPERPIIF+S CY  VS+G+++R+V GHE++AC++                  PA CTIVFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI  YSQ +H  AW +P +KSI  L +S+VDGD V+G+CYVGN +  +L  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G KT+KLE+L+IRIGVF+VLYT PA VIVAC  YE  NR  W    +C C      Q    RP+Y+VFM KYFM + VG+TSG WIWS KT+ +W+  C R
Sbjct:   23 QCQEISVPLCKGIGYNYTHMPNKFHHDTQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKKPLPPCRGVCERAKAGCAPLMRQYGFPWPDRMRCDLLPEQGNHDS-LCMD--YSSQTTTVSPALA---KPTNRPLKPYNKRKGPYGRTFPGKHKPAGSPCEAACSCRAPMVPVSSEGHPLHNRVRTGQIVNCAVPCYNPYFTQE-ERTFTSFWIGLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLVAGHEEVACNMWNGAGYIHYETTG-----PALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIGSYSQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGVCYVGNQNLDSLRGFVLAPLVIYLVIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLERLIIRIGVFTVLYTVPATVIVACYFYEQHNRQAWEITHNCTCATEPSKQ----RPNYAVFMLKYFMCLLVGITSGAWIWSGKTLDTWRTFCRR 533          
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 270/531 (50.85%), Postives = 364/531 (68.55%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCME--KNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQ--CSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            C+ I +P+CK I YN T MPN FNH+ QDEAG E HQF+PLV+I+CS DL+FFLCS+YTPICL+ Y K LPPCRSVCER + GC PL+++Y F WP++M CD  PV  NP+  LCM+  +N ST ++ + S  T  P     +   +          +            C+  C C +P++ +       +NRV T  + NCA  C +P+F+ + ++ F  FW+GLW+++C +STF+ VATF ID  R++YPERPIIF+S CY  VS+G+++R++ GHE +AC+    +D   +  + Y  +GPA CTIVFLLIY+FGMA+S+WWV+L++TWFLAAG+KWG+EAI+ Y+Q +H  AW +P +KSI  L +S+VDGD V+GICYVGN +  NL  FVL+PL++YL IGT+ L++GF SLFRIRS+IK Q G KT+KLEKLMIRIG+F+VLYT PA VIVAC  YE  NR +W    +C      R +     P Y+VFM KYFM + VG+TSG WIWS KT+ SW+  C R
Sbjct:   21 CQGIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDT-LCMDYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAP----------CEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPCHNPYFTHD-ERAFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACN----RD-FDVEHIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNCSSCLMERERAR-SGPDYAVFMLKYFMCLLVGITSGVWIWSGKTLDSWRTFCTR 532          
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 434.106 bits (1115), Expect = 2.979e-141
Identity = 234/552 (42.39%), Postives = 335/552 (60.69%), Query Frame = 1
Query:  487 DKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPIC--LKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP-----FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEW---YQNLSCDCF--DSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVE 2106
            + G C+ I IP+C DI YN T+MPN+  H NQ++AG E HQFYPLV+++CS +L+FFLCS+Y P+C  L+Q   ++PPCRS+CER ++GC+ L+ K+ F+WPE+++C+ FPV    E  +C+ +N S   +  +S             S  V E   +    +    Q     + Q SC  PL    ++    +     +G+ +C   C+        +  E + KF   W+G+W+I+C +ST   V T+ +D  R+RYPERPIIF+S CYFMV++ +     +  + +  D  K +   +++           CTI+F+++Y+FGMA+S+WWV+L++TWFL+AG+KWG EAI   SQ +H  AW +P IK+I  L M  VDGD ++G+C+VG  +   L  FVL+PL VYL IGT  L++GF SLFRIR+I+K   G KTEKLEKLM+RIGVFSVLYT PA +++AC  YE   R  W   +   +C  F      H      P ++VFM KY M M VG+TSGFW+WS KT+ SW+    RLG N  H E
Sbjct:   26 EHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSTELKFFLCSMYAPVCTVLEQ---AIPPCRSLCERARQGCEALMNKFGFQWPERLHCEAFPVNGGSE--ICVGQNTSEPGSPSSS-------------SPHVPELVTVPPNRFPNPPQPPHNSYHQFSC--PL----QLEVPSYLGYRFMGVKDCGAPCEPTKPSGIMYFREDEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFLEDKVVCVDKFKGEGFRTVAQGTKK----EGCTILFMVLYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGIFNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMK-HDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERTWHMQTCKRFAVPCPVHNFAPMTPDFTVFMIKYLMTMIVGITSGFWVWSGKTLQSWRRFYKRLG-NGNHGE 547          
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 419.853 bits (1078), Expect = 3.049e-135
Identity = 227/571 (39.75%), Postives = 324/571 (56.74%), Query Frame = 1
Query:  418 ILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASV---------ITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSP---FFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEW-YQNL--SCDCFDSNRHQLNLPR--PSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYR 2079
            +L  +  S    FY L+ D       KCE I IPMC  I YN+T MPN  +H++Q EA  +  +F PLV   C   L+FFLCS+Y P+C  +   S+P CR +CE+ +  C P+++K+++ WP+ ++C + P  N+P   LCME   +   T              +   P++ +  +SR     N                     SC  P       +K  F   S     +CA  C SP    + S  D+ F   W+ +W+I+C +ST   V TF ++P R++YPERPIIF+S+CY + SL F+IR V G E++ACD    +       +   G     CTIVFL++YYFGMA+S+WWV+LT+TWFLAAG KWG EAI  +S  +H  AW +P +K+IV LTM  V GD ++G+CYVG+     L  FVL PL  YL IGT  +++GF +LF IR ++K + G  TEKLEKLM++IG++S+LYT PA  ++ C  YE  N   W  + L   CD F S+  + +L    P+ +VFM K FM + VG+TSG W+WS KT+ +W+ +C R
Sbjct:   18 LLPVSASSLEMSFYDLERDR----PAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKVSTSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNA-LCMEAPENETRTEGKKDKKKGEGMLPVPPRPRQPDTPSSRLPGSGN---------------------SCENP-------DKFQFVEKSQ----SCAPRC-SPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDREHGE-----LYIIQEGLESTGCTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMKTE-GTNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRGLQEECDSFSSHNSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSR 544          
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 1384.78 bits (3583), Expect = 0.000e+0
Identity = 748/751 (99.60%), Postives = 750/751 (99.87%), Query Frame = 1
Query:  373 MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIXXXXXXXXXXXXXMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLXXXXXXTQNCFMSQSQMNHFNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFXXXXXXXXXXXXLPINSIQFPVIQL 2625
            MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASV+TLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACD IKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQ+GGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL
Sbjct:    1 MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQVGGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL 751          
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 691/694 (99.57%), Postives = 693/694 (99.86%), Query Frame = 1
Query:  544 MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIXXXXXXXXXXXXXMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLXXXXXXTQNCFMSQSQMNHFNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFXXXXXXXXXXXXLPINSIQFPVIQL 2625
            MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASV+TLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACD IKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQ+GGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL
Sbjct:    1 MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNNNNLGMDNGSCNSQVGGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFMSQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYIQHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQL 694          
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 273/553 (49.37%), Postives = 361/553 (65.28%), Query Frame = 1
Query:  466 KSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHT 2124
            +S+  N    KC  I IPMCK+I YN+T MPN F+HE Q+EAG   HQFYPLV+I CS++L+ FLCS+Y PICL  + K +  CRSVCE  + GC P++  Y FKWP+ M+CD+       E   C++K+           +T  P +                               C+C CR P I     NK  FN V T G+ NC Q C S  F S  D+ F+ FWLGLW ++C LS+ + V TF +D  R++YPERPI+F+S CY MVS+G++IR+ +GHE +ACD  K +         YG +GPA C+IVFLLIY+FGMAAS+WWV+LTITWFL+AGLKWGSEAISKYS+I+HFLAWFL G+KSI+ALT+ A+DGDPV GICY+GNT+  NL LF++ PL VYL IG+  L+SGF +L  IR  I+ +   KT+KLEKLM+RIG+F +LY+ PAAV++ C +YE++NR  W ++ +C C  + + Q N  +P YSVFM KYFM + VG+TSGFWIW+ KT+ SW     RL  + C   + +KHT
Sbjct:   48 RSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT-----ENQACLKKDTKN--------VTKPPSKG------------------------------CECKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVS-IDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLR---------YGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSIC--GQSDKHT 542          
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Match: SMESG000031852.1 (SMESG000031852.1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.254e-165
Identity = 253/534 (47.38%), Postives = 338/534 (63.30%), Query Frame = 1
Query:  499 CEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLAC--DLIKAKDXXXXXXXXXXXXXPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSW-----KMVCYR 2079
            C  I+I MCK I YN+T +PN  NH + +EAG E  QF  LV+I CSEDL+ FLCS+Y PICL  +   +P CRS+C   ++GC  ++ +Y FKWPE MNC++ P     E   C+ K                     D  +R     N ++E  Y L  +      C C CR PLI  +   + HFN+V T  + NC   C+SP+F  E D+ F  FWLG+W  +C++ST   + TF ID  R++YPERPIIF+SICY ++S+G+LIR+ +GHE +AC  D I+     +             C+IVFL IY+FGMA+S+WWV+LT TWFLAAGLKWGSEAI  Y+ IYHF AWF+PGI+SI+ LTMS+VDGDPVSGICYVGN + +NL+ FV+ PL+VYL +GT  L++GF +L +IR  IK +   KT+KLEKLMIRI +F ++Y+ P   +V C IYE   R  W Q+ +C C  + ++Q     P YSVFM KYFM + VG T+GFWIW+ KT+ SW     K++C R
Sbjct:   35 CIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLP-----EDNACLRK---------------------DNKTRSNKTANFVSERPYLLKSKK-----CHCHCRSPLIIDS---RDHFNKVVTGNISNCLMNCRSPYFG-EFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGA-----------VPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKLLCCR 516          
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Match: SMESG000040115.1 (SMESG000040115.1)

HSP 1 Score: 344.739 bits (883), Expect = 9.198e-107
Identity = 202/535 (37.76%), Postives = 293/535 (54.77%), Query Frame = 1
Query:  544 MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDLIKAKDXXXXXXXXXXXXXP-AHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGG-KTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQ-----------NLSCDCFDSNRHQLNLP---------RPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRL 2082
            MT+ PN   H  QDEA  E +++ PL++IKC   LQ FLCS+Y P+C     K+LPPCRS+C ++KK C+P+L+K+ FKWP+ M+CD +P     E  LC+  N +              ++++  N      ++L   VSY    + +     Q                           +C   C   +F+  + +KF   W+ LW+ +C+ ST   V TF ID  R++YPERPIIF+S CY +V L ++    +  +         KD +  +            C I+F+L+Y+F MA+++WWV+LTITW+LAA   W  E+I + SQ +HF AW +P  K+I  L +S VDGDP++G+C+ G +    L  F+++PL +YL IGT  LI+GF S+F IR+IIK  TGG KT+KLEKL+ RIG+FSVLY  PA V++AC  +E  N  +W Q               +C   + H+   P         +P + +FM KY M + VG+TSG WIWS KT+LSWK    RL
Sbjct:    1 MTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIMK-KALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYP-----ENNLCIRDNQT--------------EKESAPNVSLSCPKSLQIPVSYDFKIRLSQNSVIQ---------------------------DCGIPCNRYYFNEPNLRKFARVWVALWSFMCVGSTLFTVLTFLIDMKRFQYPERPIIFLSACYLVVGLTYVAGFFLNDKVACAGPFTNKDSTGKTPKIVVQGTKFESCIILFMLLYFFSMASAIWWVVLTITWYLAAKCHWAHESIGRNSQYFHFAAWAIPAGKTIGILALSKVDGDPLTGVCFTGLSDPSTLRGFLIAPLCIYLLIGTGFLIAGFVSMFEIRTIIK--TGGSKTDKLEKLITRIGIFSVLYVVPAVVVIACYFHESMNLYKWMQRWYLIDICRSAEYKDECKKIHDHKPINPGGNALIFSQKPEFELFMIKYLMSLIVGITSGIWIWSGKTLLSWKYFFSRL 486          
The following BLAST results are available for this feature:
BLAST of Fzd-5/8-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD50.000e+050.28frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD71.396e-14041.76frizzled class receptor 7 [Source:HGNC Symbol;Acc:... [more]
FZD23.931e-14042.31frizzled class receptor 2 [Source:HGNC Symbol;Acc:... [more]
FZD101.635e-13741.88frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD15.961e-13741.67frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfz-22.650e-11937.50Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ... [more]
mom-55.823e-9230.45pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
mom-52.689e-9130.03pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
lin-171.930e-7128.78Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-171.930e-7128.78Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz25.128e-17145.53gene:FBgn0016797 transcript:FBtr0112890[more]
fz25.128e-17145.53gene:FBgn0016797 transcript:FBtr0075029[more]
fz25.128e-17145.53gene:FBgn0016797 transcript:FBtr0332735[more]
fz25.128e-17145.53gene:FBgn0016797 transcript:FBtr0330194[more]
fz25.128e-17145.53gene:FBgn0016797 transcript:FBtr0075028[more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd50.000e+051.96frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd8a0.000e+051.11frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8b0.000e+051.23frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8b0.000e+051.04frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7a1.468e-14441.96frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc90.000e+052.06zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
fzd80.000e+051.80frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
bdh24.580e-14141.393-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;... [more]
ntrk15.879e-13640.29neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
FZD92.152e-13241.18frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd50.000e+050.09frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd50.000e+050.09frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd80.000e+047.53frizzled class receptor 8 [Source:MGI Symbol;Acc:M... [more]
Fzd71.377e-14041.42frizzled class receptor 7 [Source:MGI Symbol;Acc:M... [more]
Fzd23.126e-14042.13frizzled class receptor 2 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Fzd-5/8-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93274|FZD8_XENLA0.000e+052.37Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 ... [more]
sp|Q8CHL0|FZD5_RAT0.000e+050.09Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 P... [more]
sp|Q9EQD0|FZD5_MOUSE0.000e+050.09Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 S... [more]
sp|Q13467|FZD5_HUMAN0.000e+050.28Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV... [more]
sp|P58421|FZD5_XENLA0.000e+052.43Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 ... [more]
back to top
BLAST of Fzd-5/8-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DF420.000e+099.87Fzd-5/8-3 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
T1D1380.000e+069.20Fzd-5/8-3 OS=Dendrocoelum lacteum OX=27895 PE=2 SV... [more]
A0A3B4EPW20.000e+051.30Frizzled class receptor 8a OS=Pygocentrus natterer... [more]
A0A4W3HLB40.000e+051.96Uncharacterized protein OS=Callorhinchus milii OX=... [more]
V9KHZ20.000e+052.45Frizzled-like 8a (Fragment) OS=Callorhinchus milii... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000026985.20.000e+053.32pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
fzd8a6.975e-16746.59frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7b4.511e-14340.88frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
FZD76.381e-13841.58frizzled-7-A-like [Source:NCBI gene;Acc:103021589][more]
fzd9b1.388e-13439.89frizzled-9 [Source:NCBI gene;Acc:103027133][more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011009.10.000e+048.68pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd21.416e-14443.20frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd7a1.052e-13740.91frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8a1.335e-12053.24frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b4.095e-6540.06frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429321.076e-17651.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357511.877e-13640.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385674.206e-12938.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308651.555e-11738.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401193.253e-3824.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fzd-5/8-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000013002.20.000e+052.56pep primary_assembly:ASM223467v1:21:5638676:564429... [more]
ENSORLT00000002667.20.000e+050.76pep primary_assembly:ASM223467v1:17:316235:318512:... [more]
fzd8a0.000e+050.85frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7b2.979e-14142.39frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b3.049e-13539.75frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Fzd-5/8-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035834.10.000e+099.60SMESG000035834.1[more]
SMESG000035834.10.000e+099.57SMESG000035834.1[more]
SMESG000005043.10.000e+049.37SMESG000005043.1[more]
SMESG000031852.11.254e-16547.38SMESG000031852.1[more]
SMESG000040115.19.198e-10737.76SMESG000040115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017913 ID=SMED30017913|Name=Fzd-5/8-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2960bp
GCAAGTGTTTGACTTGCACCACTGCTGTTGATGTAATTACCGTTCATTGA
GTATATTTTCCAATCCAGTAGGGAGTTCGAAATTGGCATAAATGCAACTT
TGGATATTTGAACAATTGGATCTTGCAAACTAATTGAGTACGCATACACA
CTCACAGACAGACTTGAATCCAATATACAAGAATAAATAGAAAACTTTCT
TTTAGACATCCAGAATTTGTAAAATTATCAGTTGTCCAATAAACGTCAGA
ATTTTTATCAGAAATTTTATATACAAAAAAAGATCCACAATCAATTAGCA
TCAGATCATCAAGATAGCTTTCGACGATTAGGAGAAAAGGGAATTTTCAT
TATTTTATAATTCCAACAAACAATGTTTAAAATAATTTGTCTTTCATGGA
AAAAATTATTGGTTTTCATTTTATTGAAAACTGTCGAGTCGTCAAATTCG
GACTTCTATCCTTTAAAATCAGACAACACTAATCGAGATAAAGGTAAATG
TGAAATTATTAAAATACCAATGTGTAAGGATATACATTACAATATGACCA
TGATGCCAAATATGTTCAACCATGAAAACCAGGACGAAGCTGGGTTTGAA
GCTCATCAGTTTTATCCATTGGTGCAAATAAAGTGCTCAGAAGATCTTCA
ATTTTTCCTATGTTCGATTTACACACCAATTTGCTTAAAACAATACGTCA
AATCATTGCCACCATGTCGATCAGTCTGTGAACGGGTTAAAAAAGGCTGT
GATCCTCTATTGCAAAAGTACACTTTTAAGTGGCCAGAAAAAATGAATTG
TGATCAATTTCCTGTATACAATAATCCAGAGAAAATATTGTGTATGGAAA
AGAATTTATCTACAGCATCAACTACGCTGGCATCAGTCATAACTTTAGCG
CCGAAAGAACAGAATGATGCCAACAGTAGGCAAGTTGCTGAGCAAAATCT
TTTAAATGAAGTCAGCTATCAACTGACCAGACAGTATAATAGTCGAGTCT
TTTGCCAATGCAGCTGCAGGAAACCTTTGATAGATATTGCAGAAATAAAC
AAAGCTCATTTCAATAGAGTAAGTACTCTCGGTATGTTTAATTGTGCTCA
GGGCTGTAAATCTCCATTTTTCTCGTCAGAATCAGATCAGAAATTCATTG
GATTTTGGCTGGGATTATGGACAATAATTTGTCTTTTGAGTACATTTTCC
ATTGTCGCAACCTTTTCAATTGACCCCGGCAGATATCGCTATCCAGAACG
GCCGATTATTTTTATGAGTATATGCTATTTTATGGTTAGCTTGGGATTCT
TGATTCGAATCGTAATGGGTCACGAAGATCTTGCATGTGATTTAATTAAA
GCAAAGGATGGAAGTTCTTTATCGCTGTTGAGATATGGTGGATCTGGTCC
TGCTCATTGTACAATTGTGTTTCTATTAATTTACTATTTTGGAATGGCAG
CATCCTTGTGGTGGGTATTACTAACAATAACATGGTTTCTTGCTGCTGGC
TTAAAATGGGGATCCGAAGCAATATCGAAATATTCTCAAATTTATCATTT
CCTTGCATGGTTTCTTCCTGGAATAAAAAGCATAGTGGCTTTAACAATGT
CAGCTGTTGATGGCGACCCAGTTTCAGGGATATGTTATGTTGGCAATACA
AGTGACTTTAACTTAATTTTGTTTGTCCTGTCACCTTTATTGGTTTATCT
AACTATCGGAACCTTAGTGTTGATAAGTGGATTTGCATCGTTATTTAGAA
TTCGTAGTATAATCAAACTTCAAACCGGCGGAAAAACCGAAAAGCTGGAA
AAACTAATGATTCGAATAGGGGTTTTCAGCGTTCTCTATACAGCACCTGC
TGCAGTTATTGTGGCTTGCATAATTTATGAACTACAAAACAGAGCAGAAT
GGTATCAAAATTTATCCTGCGACTGTTTTGATTCGAATCGACATCAACTG
AATTTACCGCGTCCATCCTATTCGGTTTTCATGTTTAAATATTTCATGTT
TATGGGTGTTGGAATGACATCGGGATTCTGGATTTGGTCTAAAAAAACAA
TTCTATCATGGAAAATGGTGTGTTACCGCCTTGGAATTAATAGCTGTCAT
GTTGAAGAGCGAAATAAACATACTAGTCTAGCGCATTTAGAAATCAGGAA
TGGTGCCCTTCTAAGAAATAATAATAACTTAGGTATGGATAATGGAAGCT
GCAATTCTCAATTAGGCGGAACAAAAAGTAGCTCAGGGGTTACTCACTGT
CCATACACTCATAGTCATCCTAGCTCGGGAAATTTAGCCGCAGCTGCTGC
TGCAACTCAGAATTGTTTTATGAGCCAAAGTCAAATGAATCATTTTAATA
GGCCGATTCTGTCAGCTCCAAGTGCACCACTTCCAACCCCTCCTCAAAGC
AGTGGTCAGTCCACTCCTCCGCCTTTACCTTTAACGTCTCATTGTATAAC
TCAGCAACAAAACCAATATATACAGCACATTCATGATTCTAAAGAGAGCT
CATATCTTCCATTTATCACAAGTCACGATACAAATCCGAGCTGTTATTTT
TCCAGTTCCGGAGCAAGAAGCAATGCAAGCAGTGCTCTGCCTATCAATTC
AATCCAGTTTCCCGTCATTCAGTTGTAATTTAAAGAAAGCATTTTTCATA
TCATTTTATTGATCAAAAAGTTCCATAACATTATTTTTCAAATAAAGCAC
TAGAATTGCGAAATTTTCTTTTGAAGATTTGTTCAAACCTTTCTTTTCAA
ATTCATCACCTCATTTCTGTACATATCTATTAGTAGTATTTTTAAAAAAA
TGTATATTTGGTGCCTTTTATTATACAGGGTTTACTCTCAATTCGTGAGT
TTGTACATAATTAGCTAATGATCTGGATGGCGCAATTTTCTCATTTACAG
TTTTATTAGATAGAATTTTTATCGAATAAATTGTTTATTTCTTTTATATT
TCATTCGAGC
back to top

protein sequence of SMED30017913-orf-1

>SMED30017913-orf-1 ID=SMED30017913-orf-1|Name=SMED30017913-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=752bp
MFKIICLSWKKLLVFILLKTVESSNSDFYPLKSDNTNRDKGKCEIIKIPM
CKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIY
TPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYN
NPEKILCMEKNLSTASTTLASVITLAPKEQNDANSRQVAEQNLLNEVSYQ
LTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFF
SSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSI
CYFMVSLGFLIRIVMGHEDLACDLIKAKDGSSLSLLRYGGSGPAHCTIVF
LLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPG
IKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVL
ISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACI
IYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTS
GFWIWSKKTILSWKMVCYRLGINSCHVEERNKHTSLAHLEIRNGALLRNN
NNLGMDNGSCNSQLGGTKSSSGVTHCPYTHSHPSSGNLAAAAAATQNCFM
SQSQMNHFNRPILSAPSAPLPTPPQSSGQSTPPPLPLTSHCITQQQNQYI
QHIHDSKESSYLPFITSHDTNPSCYFSSSGARSNASSALPINSIQFPVIQ
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
GO:0042813Wnt-activated receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 348..372
score: 58.24
coord: 436..458
score: 51.3
coord: 290..312
score: 55.65
coord: 391..414
score: 42.33
coord: 478..499
score: 59.64
coord: 262..284
score: 39.3
coord: 535..555
score: 51.62
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 248..573
e-value: 9.2E-168
score: 573.3
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 252..569
e-value: 5.3E-125
score: 416.8
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 42..162
e-value: 2.1E-57
score: 206.7
IPR020067Frizzled domainPFAMPF01392Fzcoord: 43..150
e-value: 3.1E-32
score: 111.5
IPR020067Frizzled domainPROSITEPS50038FZcoord: 38..160
score: 27.885
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 35..164
e-value: 5.3E-43
score: 148.3
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 41..157
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 212..571
e-value: 2.3E-128
score: 429.9
NoneNo IPR availablePANTHERPTHR11309:SF136FRIZZLED-5coord: 39..573
NoneNo IPR availableCDDcd150357tmF_FZD5_FZD8-likecoord: 249..567
e-value: 1.35093E-175
score: 503.349
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.738
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 259..281
NoneNo IPR availableTMHMMTMhelixcoord: 390..412
NoneNo IPR availableTMHMMTMhelixcoord: 533..555
NoneNo IPR availableTMHMMTMhelixcoord: 294..316
NoneNo IPR availableTMHMMTMhelixcoord: 482..504
NoneNo IPR availableTMHMMTMhelixcoord: 432..454
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 39..573
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 256..562
score: 34.71